F425954

General Info

Members Datasets Scaffolds Average Seq Length
372 172 744 154

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100772760|Ga0070689_1007727601
Length 164
Sequence MDDGVAAPLRLCVRRSMAQPEPAEDGAAPAIVWVGIRVPADVRCVEEAVELMARHCFAGAVPSRRTSFRLRVLLAEALTNSILFGAQGDPNRTVSVSAVLGSGTIRLEVTDDGPGFDPKAVTDPTSPTALSRPVGRGLFLIRNLADQVEFNAQGNTIWMTLPRA

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
107 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
112 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
148 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
149 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.84
Rhizosphere 94.89
Stem 0
Stem Tuber 0
Unclassified 20.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100772760 3300005340 Bacteria 843
2 rootH1_10096061 3300003316 Bacteria 2389
3 Ga0058862_12676070 3300004803 Bacteria 730
4 Ga0070683_101249966 3300005329 Unclassified 714
5 Ga0070660_100123068 3300005339 Bacteria 2071
6 Ga0070660_100463799 3300005339 Bacteria 1052
7 Ga0070691_10107066 3300005341 Unclassified 1395
8 Ga0070692_10064486 3300005345 Unclassified 1938
9 Ga0070669_100984846 3300005353 Bacteria 723
10 Ga0070659_100098927 3300005366 Bacteria 2346
11 Ga0070659_100116244 3300005366 Bacteria 2162
12 Ga0070667_100401861 3300005367 Bacteria 1247
13 Ga0070703_10231248 3300005406 Unclassified 741
14 Ga0070709_10049482 3300005434 Bacteria 2628
15 Ga0070713_100786722 3300005436 Bacteria 912
16 Ga0070710_10403045 3300005437 Unclassified 917
17 Ga0070710_10469816 3300005437 Bacteria 856
18 Ga0070701_10021671 3300005438 Bacteria 3071
19 Ga0070701_10267097 3300005438 Bacteria 1039
20 Ga0070705_100008441 3300005440 Bacteria 5104
21 Ga0070694_100040885 3300005444 Bacteria 3091
22 Ga0070694_100109159 3300005444 Bacteria 1969
23 Ga0070694_100251488 3300005444 Bacteria 1337
24 Ga0070694_101232101 3300005444 Bacteria 628
25 Ga0070681_10135810 3300005458 Bacteria 2390
26 Ga0070681_10263868 3300005458 Bacteria 1634
27 Ga0070681_11124102 3300005458 Unclassified 707
28 Ga0068867_100857899 3300005459 Unclassified 814
29 Ga0070706_100147362 3300005467 Bacteria 2198
30 Ga0070706_100162756 3300005467 Bacteria 2084
31 Ga0070706_100382324 3300005467 Bacteria 1311
32 Ga0070707_100001277 3300005468 Bacteria 24773
33 Ga0070707_100068391 3300005468 Bacteria 3418
34 Ga0070707_100267080 3300005468 Bacteria 1664
35 Ga0070707_100289767 3300005468 Bacteria 1591
36 Ga0070707_100391105 3300005468 Bacteria 1350
37 Ga0070698_100025500 3300005471 Bacteria 6163
38 Ga0070698_100033083 3300005471 Bacteria 5356
39 Ga0070698_100245585 3300005471 Bacteria 1723
40 Ga0070698_100304411 3300005471 Bacteria 1525
41 Ga0070699_100000036 3300005518 Bacteria 133816
42 Ga0070699_100037201 3300005518 Bacteria 4211
43 Ga0070679_100784518 3300005530 Bacteria 896
44 Ga0070697_100009789 3300005536 Bacteria 7476
45 Ga0070697_100169649 3300005536 Unclassified 1846
46 Ga0068853_102010662 3300005539 Bacteria 560
47 Ga0070686_101035672 3300005544 Bacteria 675
48 Ga0070695_100030682 3300005545 Bacteria 3348
49 Ga0070695_100915242 3300005545 Bacteria 709
50 Ga0070696_100001111 3300005546 Bacteria 17408
51 Ga0070696_100091579 3300005546 Unclassified 2165
52 Ga0070704_100014809 3300005549 Bacteria 4880
53 Ga0070704_101001135 3300005549 Unclassified 756
54 Ga0070664_100792749 3300005564 Bacteria 885
55 Ga0068857_100823329 3300005577 Bacteria 887
56 Ga0070702_100194050 3300005615 Bacteria 1339
57 Ga0068852_100862569 3300005616 Bacteria 921
58 Ga0068852_101432257 3300005616 Unclassified 713
59 Ga0068859_100024587 3300005617 Bacteria 6043
60 Ga0068859_100062571 3300005617 Bacteria 3752
61 Ga0068859_100297558 3300005617 Bacteria 1707
62 Ga0068859_100734086 3300005617 Bacteria 1077
63 Ga0068864_100673721 3300005618 Unclassified 1008
64 Ga0068866_10237112 3300005718 Bacteria 1109
65 Ga0068862_100712487 3300005844 Bacteria 973
66 Ga0081455_10096814 3300005937 Bacteria 2379
67 Ga0070715_10154276 3300006163 Unclassified 1128
68 Ga0070716_100338785 3300006173 Unclassified 1060
69 Ga0070712_100244498 3300006175 Bacteria 1431
70 Ga0075428_100384513 3300006844 Bacteria 1504
71 Ga0075428_100397778 3300006844 Bacteria 1477
72 Ga0075428_100485560 3300006844 Bacteria 1322
73 Ga0075430_100154125 3300006846 Unclassified 1913
74 Ga0075430_100269583 3300006846 Bacteria 1409
75 Ga0075430_100524037 3300006846 Bacteria 978
76 Ga0075431_100053473 3300006847 Unclassified 4164
77 Ga0075431_100945931 3300006847 Unclassified 830
78 Ga0075433_10108007 3300006852 Bacteria 2468
79 Ga0075433_10287580 3300006852 Bacteria 1456
80 Ga0075433_11147817 3300006852 Bacteria 675
81 Ga0075433_11417839 3300006852 Unclassified 601
82 Ga0075434_100261801 3300006871 Bacteria 1749
83 Ga0075434_100304219 3300006871 Bacteria 1615
84 Ga0075429_100000283 3300006880 Bacteria 35844
85 Ga0075429_100061375 3300006880 Bacteria 3275
86 Ga0075429_100633571 3300006880 Bacteria 937
87 Ga0075429_101322977 3300006880 Bacteria 628
88 Ga0075436_100155429 3300006914 Bacteria 1611
89 Ga0075436_100606935 3300006914 Unclassified 806
90 Ga0097620_100024587 3300006931 Bacteria 6043
91 Ga0097620_100062571 3300006931 Bacteria 3752
92 Ga0097620_100297551 3300006931 Bacteria 1707
93 Ga0097620_100734199 3300006931 Bacteria 1077
94 Ga0075435_100074040 3300007076 Bacteria 2785
95 Ga0075435_100169920 3300007076 Bacteria 1839
96 Ga0075435_100694998 3300007076 Bacteria 884
97 Ga0075435_100894410 3300007076 Unclassified 774
98 Ga0111539_10251608 3300009094 Bacteria 2057
99 Ga0111539_10546702 3300009094 Bacteria 1349
100 Ga0105245_11164989 3300009098 Bacteria 818
101 Ga0114129_10231745 3300009147 Bacteria 2487
102 Ga0114129_10259266 3300009147 Bacteria 2331
103 Ga0114129_10273868 3300009147 Bacteria 2257
104 Ga0114129_10298387 3300009147 Bacteria 2149
105 Ga0114129_10815312 3300009147 Unclassified 1189
106 Ga0114129_11629070 3300009147 Bacteria 789
107 Ga0105242_10181321 3300009176 Unclassified 1858
108 Ga0105242_10594895 3300009176 Unclassified 1068
109 Ga0105242_11406094 3300009176 Bacteria 725
110 Ga0105248_11759351 3300009177 Bacteria 703
111 Ga0105249_10809129 3300009553 Bacteria 1001
112 Ga0105249_12881201 3300009553 Bacteria 552
113 Ga0105239_10382025 3300010375 Bacteria 1592
114 Ga0157373_10094955 3300013100 Bacteria 2099
115 Ga0157371_11412169 3300013102 Unclassified 541
116 Ga0157375_10828711 3300013308 Bacteria 1073
117 Ga0157375_12316086 3300013308 Bacteria 640
118 Ga0163163_10045291 3300014325 Bacteria 4317
119 Ga0163163_11065051 3300014325 Bacteria 872
120 Ga0182008_10077903 3300014497 Bacteria 1631
121 Ga0163161_10439088 3300017792 Bacteria 1053
122 Ga0207699_10176120 3300025906 Bacteria 1434
123 Ga0207684_10178055 3300025910 Bacteria 1833
124 Ga0207684_10598662 3300025910 Bacteria 942
125 Ga0207684_11357006 3300025910 Unclassified 583
126 Ga0207707_10018172 3300025912 Bacteria 6127
127 Ga0207707_10348594 3300025912 Bacteria 1276
128 Ga0207693_10421808 3300025915 Bacteria 1043
129 Ga0207663_10781476 3300025916 Bacteria 760
130 Ga0207660_10554519 3300025917 Bacteria 935
131 Ga0207657_10368137 3300025919 Bacteria 1132
132 Ga0207657_10670223 3300025919 Bacteria 807
133 Ga0207652_10245226 3300025921 Bacteria 1615
134 Ga0207652_10258200 3300025921 Bacteria 1572
135 Ga0207646_10003762 3300025922 Bacteria 16914
136 Ga0207646_10095710 3300025922 Bacteria 2660
137 Ga0207646_10784858 3300025922 Bacteria 849
138 Ga0207646_10908035 3300025922 Unclassified 781
139 Ga0207700_10717444 3300025928 Bacteria 893
140 Ga0207690_10278896 3300025932 Bacteria 1301
141 Ga0207670_10081408 3300025936 Bacteria 2266
142 Ga0207661_10282574 3300025944 Bacteria 1484
143 Ga0207661_10630820 3300025944 Unclassified 985
144 Ga0207679_10276220 3300025945 Bacteria 1439
145 Ga0207679_10861093 3300025945 Unclassified 828
146 Ga0207712_10568657 3300025961 Unclassified 977
147 Ga0207640_10286487 3300025981 Bacteria 1297
148 Ga0207658_10355879 3300025986 Bacteria 1276
149 Ga0207639_10965671 3300026041 Unclassified 797
150 Ga0207678_10334844 3300026067 Bacteria 1303
151 Ga0207708_10072155 3300026075 Bacteria 2645
152 Ga0207676_10637224 3300026095 Unclassified 1027
153 Ga0207675_100341058 3300026118 Bacteria 1467
154 Ga0207698_11196128 3300026142 Bacteria 774
155 Ga0209995_1013729 3300027471 Bacteria 1328
156 Ga0209966_1071541 3300027695 Unclassified 760
157 Ga0209974_10026337 3300027876 Bacteria 1925
158 Ga0207428_10281603 3300027907 Unclassified 1234
159 Ga0268266_10168923 3300028379 Bacteria 1984
160 Ga0268265_10243233 3300028380 Bacteria 1589
161 Ga0268265_11568338 3300028380 Bacteria 663
162 Ga0307408_100008337 3300031548 Bacteria 6844
163 Ga0307408_100070299 3300031548 Bacteria 2584
164 Ga0307408_100135652 3300031548 Bacteria 1925
165 Ga0307408_101531749 3300031548 Bacteria 631
166 Ga0307405_10036009 3300031731 Bacteria 2962
167 Ga0307405_10092885 3300031731 Bacteria 2003
168 Ga0307405_10155064 3300031731 Bacteria 1615
169 Ga0307405_10572505 3300031731 Bacteria 917
170 Ga0307413_10019705 3300031824 Bacteria 3571
171 Ga0307413_10037377 3300031824 Bacteria 2804
172 Ga0307413_10042391 3300031824 Bacteria 2674
173 Ga0307413_10136922 3300031824 Bacteria 1685
174 Ga0307410_10010146 3300031852 Bacteria 5323
175 Ga0307410_10070059 3300031852 Bacteria 2427
176 Ga0307410_10118421 3300031852 Bacteria 1927
177 Ga0307410_10467825 3300031852 Bacteria 1032
178 Ga0307410_10906332 3300031852 Unclassified 755
179 Ga0307406_10001688 3300031901 Bacteria 12133
180 Ga0307406_10006960 3300031901 Bacteria 6266
181 Ga0307406_10014718 3300031901 Bacteria 4506
182 Ga0307406_10033474 3300031901 Unclassified 3147
183 Ga0307406_10085068 3300031901 Bacteria 2114
184 Ga0307406_10490212 3300031901 Bacteria 994
185 Ga0307407_10045324 3300031903 Bacteria 2484
186 Ga0307407_10064191 3300031903 Bacteria 2157
187 Ga0307407_10085331 3300031903 Bacteria 1921
188 Ga0307407_10772704 3300031903 Unclassified 729
189 Ga0307412_10129946 3300031911 Bacteria 1828
190 Ga0307412_10659033 3300031911 Bacteria 894
191 Ga0307412_11095908 3300031911 Bacteria 708
192 Ga0307409_100000144 3300031995 Bacteria 26764
193 Ga0307409_100005669 3300031995 Bacteria 7231
194 Ga0307409_100015596 3300031995 Unclassified 4993
195 Ga0307409_100036337 3300031995 Unclassified 3620
196 Ga0307409_100048332 3300031995 Bacteria 3236
197 Ga0307409_100126080 3300031995 Unclassified 2178
198 Ga0307409_100254667 3300031995 Unclassified 1607
199 Ga0307409_100718833 3300031995 Bacteria 1000
200 Ga0307409_100894529 3300031995 Bacteria 901
201 Ga0307409_101912809 3300031995 Bacteria 623
202 Ga0307416_100000828 3300032002 Bacteria 16247
203 Ga0307416_100014248 3300032002 Bacteria 5438
204 Ga0307416_100023778 3300032002 Bacteria 4456
205 Ga0307416_100115655 3300032002 Bacteria 2376
206 Ga0307416_100247873 3300032002 Bacteria 1731
207 Ga0307416_100970423 3300032002 Bacteria 952
208 Ga0307416_101330619 3300032002 Bacteria 824
209 Ga0307416_101433081 3300032002 Unclassified 796
210 Ga0307416_102155006 3300032002 Bacteria 659
211 Ga0307414_10002383 3300032004 Bacteria 9831
212 Ga0307414_10030309 3300032004 Bacteria 3532
213 Ga0307414_10032844 3300032004 Bacteria 3422
214 Ga0307414_10174143 3300032004 Bacteria 1724
215 Ga0307414_10185990 3300032004 Bacteria 1676
216 Ga0307414_10291835 3300032004 Bacteria 1375
217 Ga0307414_10447526 3300032004 Unclassified 1132
218 Ga0307411_10007270 3300032005 Bacteria 5620
219 Ga0307411_10032114 3300032005 Bacteria 3240
220 Ga0307411_10131179 3300032005 Bacteria 1832
221 Ga0307411_10940237 3300032005 Bacteria 770
222 Ga0307411_10950559 3300032005 Unclassified 766
223 Ga0307411_11831383 3300032005 Bacteria 564
224 Ga0307415_100000419 3300032126 Bacteria 18192
225 Ga0307415_100022610 3300032126 Unclassified 3884
226 Ga0307415_100214808 3300032126 Unclassified 1537
227 Ga0307415_100616601 3300032126 Bacteria 968
228 Ga0307415_101196942 3300032126 Bacteria 716
229 Ga0373930_0079148 3300034816 Unclassified 758
230 Ga0373938_0040184 3300034957 Unclassified 1037
231 Ga0395900_0556842 3300037418 Unclassified 1091
232 Ga0395905_0175190 3300037471 Bacteria 2014
233 Ga0395905_0824928 3300037471 Bacteria 830
234 Ga0395901_0381729 3300038443 Bacteria 1450
235 Ga0439456_088754 3300042013 Bacteria 694
236 Ga0439444_0118361 3300042437 Unclassified 616
237 Ga0496100_0073025 3300048903 Bacteria 2295
238 Ga0496101_0038807 3300048904 Bacteria 3384
239 Ga0496102_0067085 3300048905 Bacteria 3290
240 Ga0496102_0134419 3300048905 Bacteria 2317
241 Ga0496102_0451550 3300048905 Unclassified 1206
242 Ga0496102_0651399 3300048905 Bacteria 976
243 Ga0496103_0181794 3300048906 Unclassified 1351
244 Ga0496104_0213008 3300048907 Bacteria 1844
245 Ga0496104_0623643 3300048907 Bacteria 988
246 Ga0496106_0053593 3300048909 Bacteria 3047
247 Ga0496106_0467735 3300048909 Bacteria 1013
248 Ga0496106_0503576 3300048909 Bacteria 973
249 Ga0496107_0562630 3300048910 Bacteria 844
250 Ga0496109_0043903 3300048912 Unclassified 4053
251 Ga0496110_0028810 3300048913 Bacteria 4773
252 Ga0496112_0022223 3300048915 Bacteria 6044
253 Ga0496113_0290170 3300048916 Bacteria 1309
254 Ga0496114_0134245 3300048917 Bacteria 2139
255 Ga0501290_038215 3300049513 Unclassified 711
256 Ga0501031_0037498 3300049568 Bacteria 3163
257 Ga0501031_0180444 3300049568 Unclassified 1379
258 Ga0501033_0037960 3300049570 Bacteria 3604
259 Ga0501036_0041282 3300049572 Bacteria 3904
260 Ga0501036_0107665 3300049572 Bacteria 2357
261 Ga0501036_0629600 3300049572 Bacteria 889
262 Ga0501037_0100813 3300049573 Bacteria 2085
263 Ga0501037_0385475 3300049573 Bacteria 963
264 Ga0501038_0102867 3300049574 Bacteria 2376
265 Ga0501038_0337671 3300049574 Bacteria 1175
266 Ga0501038_0818279 3300049574 Bacteria 691
267 Ga0501039_0306929 3300049575 Bacteria 1247
268 Ga0501039_0451151 3300049575 Unclassified 1010
269 Ga0501039_0790075 3300049575 Unclassified 741
270 Ga0501040_0015769 3300049576 Bacteria 4996
271 Ga0501040_0050648 3300049576 Bacteria 2841
272 Ga0501040_0092866 3300049576 Bacteria 2099
273 Ga0501041_0109189 3300049577 Bacteria 1716
274 Ga0501042_0056601 3300049578 Bacteria 2798
275 Ga0501042_0093536 3300049578 Bacteria 2159
276 Ga0501043_0430961 3300049579 Bacteria 993
277 Ga0501046_0067928 3300049580 Bacteria 2775
278 Ga0501046_0385729 3300049580 Bacteria 1013
279 Ga0501046_0415316 3300049580 Bacteria 970
280 Ga0501046_0504806 3300049580 Bacteria 866
281 Ga0501048_0121539 3300049582 Bacteria 1845
282 Ga0501048_0141550 3300049582 Bacteria 1701
283 Ga0501067_0044515 3300049583 Bacteria 2465
284 Ga0501067_0081790 3300049583 Bacteria 1791
285 Ga0501067_0383059 3300049583 Unclassified 784
286 Ga0501069_0166828 3300049585 Bacteria 1269
287 Ga0501069_0208868 3300049585 Unclassified 1133
288 Ga0501069_0390372 3300049585 Bacteria 823
289 Ga0501071_0050763 3300049587 Bacteria 2988
290 Ga0501071_0122533 3300049587 Bacteria 1928
291 Ga0501072_0020979 3300049588 Bacteria 5065
292 Ga0501072_0722380 3300049588 Unclassified 782
293 Ga0501072_1094412 3300049588 Bacteria 620
294 Ga0501073_0685620 3300049589 Unclassified 707
295 Ga0501074_0070072 3300049590 Bacteria 2521
296 Ga0501074_0152142 3300049590 Bacteria 1654
297 Ga0501075_0018150 3300049591 Bacteria 5088
298 Ga0501075_0054092 3300049591 Bacteria 3019
299 Ga0501075_0405455 3300049591 Bacteria 1039
300 Ga0501076_0021090 3300049592 Bacteria 4993
301 Ga0501076_0060835 3300049592 Bacteria 3005
302 Ga0501076_0166402 3300049592 Bacteria 1797
303 Ga0501076_0529814 3300049592 Unclassified 971
304 Ga0501077_0004768 3300049593 Bacteria 8242
305 Ga0501077_0138424 3300049593 Unclassified 1544
306 Ga0501217_142363 3300049661 Bacteria 711
307 Ga0501243_050550 3300049675 Bacteria 749
308 Ga0501257_118324 3300049686 Bacteria 708
309 Ga0501079_0012663 3300049741 Bacteria 6443
310 Ga0501079_0065742 3300049741 Bacteria 2798
311 Ga0501079_0076836 3300049741 Bacteria 2582
312 Ga0501079_0224592 3300049741 Bacteria 1467
313 Ga0501079_0874145 3300049741 Unclassified 708
314 Ga0501080_0206627 3300049742 Bacteria 1801
315 Ga0501080_0299269 3300049742 Bacteria 1459
316 Ga0501080_0814148 3300049742 Bacteria 818
317 Ga0501081_0046941 3300049743 Bacteria 2970
318 Ga0501081_0065012 3300049743 Bacteria 2534
319 Ga0501081_0528446 3300049743 Bacteria 880
320 Ga0501081_1110637 3300049743 Unclassified 598
321 Ga0501083_0127807 3300049744 Bacteria 1666
322 Ga0501083_0256390 3300049744 Bacteria 1138
323 Ga0501083_0407072 3300049744 Bacteria 885
324 Ga0501275_011114 3300049772 Bacteria 972
325 Ga0501035_0492101 3300049822 Bacteria 1010
326 Ga0501045_0009723 3300049824 Bacteria 6728
327 Ga0501045_0013141 3300049824 Bacteria 5839
328 Ga0501045_0014038 3300049824 Bacteria 5670
329 Ga0501045_0863202 3300049824 Unclassified 665
330 nmdc:mga05p37_446659_c1 3300050507 Unclassified 1498
331 nmdc:mga05p37_51636_c1 3300050507 Bacteria 5055
332 nmdc:mga05p37_82134_c1 3300050507 Bacteria 3970
333 nmdc:mga09592_132413_c1 3300050508 Bacteria 2146
334 nmdc:mga09592_3967_c1 3300050508 Bacteria 11923
335 nmdc:mga0qj67_168099_c1 3300050509 Unclassified 1780
336 nmdc:mga0qj67_37040_c1 3300050509 Unclassified 3819
337 nmdc:mga06r32_1029654_c1 3300050510 Bacteria 775
338 nmdc:mga06r32_1032798_c1 3300050510 Bacteria 773
339 nmdc:mga06r32_1545969_c1 3300050510 Bacteria 603
340 nmdc:mga06r32_276790_c1 3300050510 Unclassified 1665
341 nmdc:mga06r32_77898_c1 3300050510 Unclassified 3221
342 nmdc:mga08y16_345174_c1 3300050511 Bacteria 1530
343 nmdc:mga08y16_373637_c1 3300050511 Bacteria 1462
344 nmdc:mga0n895_1002418_c1 3300050512 Bacteria 816
345 nmdc:mga0n895_108355_c1 3300050512 Bacteria 2792
346 nmdc:mga0n895_1321467_c1 3300050512 Unclassified 691
347 nmdc:mga0n895_40283_c1 3300050512 Bacteria 4537
348 nmdc:mga0rr50_137799_c1 3300050513 Bacteria 1960
349 nmdc:mga08x19_52820_c2 3300050514 Bacteria 2013
350 nmdc:mga08x19_612891_c1 3300050514 Unclassified 771
351 nmdc:mga0a205_1032309_c1 3300050515 Unclassified 669
352 nmdc:mga0a205_125715_c1 3300050515 Bacteria 2464
353 nmdc:mga0a205_308214_c1 3300050515 Bacteria 1456
354 Ga0501084_0047038 3300054114 Bacteria 3613
355 Ga0501084_0066760 3300054114 Bacteria 3010
356 Ga0501084_0082936 3300054114 Bacteria 2690
357 Ga0501084_0086055 3300054114 Bacteria 2639
358 Ga0590071_001928 3300059421 Bacteria 5310
359 Ga0590071_013107 3300059421 Bacteria 1942
360 Ga0590071_083256 3300059421 Bacteria 796
361 Ga0590074_006431 3300059423 Bacteria 1949
362 Ga0590074_007437 3300059423 Bacteria 1821
363 Ga0590074_044016 3300059423 Bacteria 807
364 Ga0590075_018072 3300059424 Bacteria 1742
365 Ga0590075_036115 3300059424 Bacteria 1259
366 Ga0590077_133039 3300059426 Bacteria 591
367 Ga0501082_0014108 3300060353 Bacteria 6875
368 Ga0501082_0116172 3300060353 Bacteria 2317
369 Ga0501082_0674381 3300060353 Unclassified 905
370 Ga0530510_0114475 3300061734 Bacteria 1977
371 Ga0530510_0601879 3300061734 Unclassified 836
372 Ga0530510_1107952 3300061734 Bacteria 607
373 Ga0070689_100772760
374 rootH1_10096061
375 Ga0058862_12676070
376 Ga0070683_101249966
377 Ga0070660_100123068
378 Ga0070660_100463799
379 Ga0070691_10107066
380 Ga0070692_10064486
381 Ga0070669_100984846
382 Ga0070659_100098927
383 Ga0070659_100116244
384 Ga0070667_100401861
385 Ga0070703_10231248
386 Ga0070709_10049482
387 Ga0070713_100786722
388 Ga0070710_10403045
389 Ga0070710_10469816
390 Ga0070701_10021671
391 Ga0070701_10267097
392 Ga0070705_100008441
393 Ga0070694_100040885
394 Ga0070694_100109159
395 Ga0070694_100251488
396 Ga0070694_101232101
397 Ga0070681_10135810
398 Ga0070681_10263868
399 Ga0070681_11124102
400 Ga0068867_100857899
401 Ga0070706_100147362
402 Ga0070706_100162756
403 Ga0070706_100382324
404 Ga0070707_100001277
405 Ga0070707_100068391
406 Ga0070707_100267080
407 Ga0070707_100289767
408 Ga0070707_100391105
409 Ga0070698_100025500
410 Ga0070698_100033083
411 Ga0070698_100245585
412 Ga0070698_100304411
413 Ga0070699_100000036
414 Ga0070699_100037201
415 Ga0070679_100784518
416 Ga0070697_100009789
417 Ga0070697_100169649
418 Ga0068853_102010662
419 Ga0070686_101035672
420 Ga0070695_100030682
421 Ga0070695_100915242
422 Ga0070696_100001111
423 Ga0070696_100091579
424 Ga0070704_100014809
425 Ga0070704_101001135
426 Ga0070664_100792749
427 Ga0068857_100823329
428 Ga0070702_100194050
429 Ga0068852_100862569
430 Ga0068852_101432257
431 Ga0068859_100024587
432 Ga0068859_100062571
433 Ga0068859_100297558
434 Ga0068859_100734086
435 Ga0068864_100673721
436 Ga0068866_10237112
437 Ga0068862_100712487
438 Ga0081455_10096814
439 Ga0070715_10154276
440 Ga0070716_100338785
441 Ga0070712_100244498
442 Ga0075428_100384513
443 Ga0075428_100397778
444 Ga0075428_100485560
445 Ga0075430_100154125
446 Ga0075430_100269583
447 Ga0075430_100524037
448 Ga0075431_100053473
449 Ga0075431_100945931
450 Ga0075433_10108007
451 Ga0075433_10287580
452 Ga0075433_11147817
453 Ga0075433_11417839
454 Ga0075434_100261801
455 Ga0075434_100304219
456 Ga0075429_100000283
457 Ga0075429_100061375
458 Ga0075429_100633571
459 Ga0075429_101322977
460 Ga0075436_100155429
461 Ga0075436_100606935
462 Ga0097620_100024587
463 Ga0097620_100062571
464 Ga0097620_100297551
465 Ga0097620_100734199
466 Ga0075435_100074040
467 Ga0075435_100169920
468 Ga0075435_100694998
469 Ga0075435_100894410
470 Ga0111539_10251608
471 Ga0111539_10546702
472 Ga0105245_11164989
473 Ga0114129_10231745
474 Ga0114129_10259266
475 Ga0114129_10273868
476 Ga0114129_10298387
477 Ga0114129_10815312
478 Ga0114129_11629070
479 Ga0105242_10181321
480 Ga0105242_10594895
481 Ga0105242_11406094
482 Ga0105248_11759351
483 Ga0105249_10809129
484 Ga0105249_12881201
485 Ga0105239_10382025
486 Ga0157373_10094955
487 Ga0157371_11412169
488 Ga0157375_10828711
489 Ga0157375_12316086
490 Ga0163163_10045291
491 Ga0163163_11065051
492 Ga0182008_10077903
493 Ga0163161_10439088
494 Ga0207699_10176120
495 Ga0207684_10178055
496 Ga0207684_10598662
497 Ga0207684_11357006
498 Ga0207707_10018172
499 Ga0207707_10348594
500 Ga0207693_10421808
501 Ga0207663_10781476
502 Ga0207660_10554519
503 Ga0207657_10368137
504 Ga0207657_10670223
505 Ga0207652_10245226
506 Ga0207652_10258200
507 Ga0207646_10003762
508 Ga0207646_10095710
509 Ga0207646_10784858
510 Ga0207646_10908035
511 Ga0207700_10717444
512 Ga0207690_10278896
513 Ga0207670_10081408
514 Ga0207661_10282574
515 Ga0207661_10630820
516 Ga0207679_10276220
517 Ga0207679_10861093
518 Ga0207712_10568657
519 Ga0207640_10286487
520 Ga0207658_10355879
521 Ga0207639_10965671
522 Ga0207678_10334844
523 Ga0207708_10072155
524 Ga0207676_10637224
525 Ga0207675_100341058
526 Ga0207698_11196128
527 Ga0209995_1013729
528 Ga0209966_1071541
529 Ga0209974_10026337
530 Ga0207428_10281603
531 Ga0268266_10168923
532 Ga0268265_10243233
533 Ga0268265_11568338
534 Ga0307408_100008337
535 Ga0307408_100070299
536 Ga0307408_100135652
537 Ga0307408_101531749
538 Ga0307405_10036009
539 Ga0307405_10092885
540 Ga0307405_10155064
541 Ga0307405_10572505
542 Ga0307413_10019705
543 Ga0307413_10037377
544 Ga0307413_10042391
545 Ga0307413_10136922
546 Ga0307410_10010146
547 Ga0307410_10070059
548 Ga0307410_10118421
549 Ga0307410_10467825
550 Ga0307410_10906332
551 Ga0307406_10001688
552 Ga0307406_10006960
553 Ga0307406_10014718
554 Ga0307406_10033474
555 Ga0307406_10085068
556 Ga0307406_10490212
557 Ga0307407_10045324
558 Ga0307407_10064191
559 Ga0307407_10085331
560 Ga0307407_10772704
561 Ga0307412_10129946
562 Ga0307412_10659033
563 Ga0307412_11095908
564 Ga0307409_100000144
565 Ga0307409_100005669
566 Ga0307409_100015596
567 Ga0307409_100036337
568 Ga0307409_100048332
569 Ga0307409_100126080
570 Ga0307409_100254667
571 Ga0307409_100718833
572 Ga0307409_100894529
573 Ga0307409_101912809
574 Ga0307416_100000828
575 Ga0307416_100014248
576 Ga0307416_100023778
577 Ga0307416_100115655
578 Ga0307416_100247873
579 Ga0307416_100970423
580 Ga0307416_101330619
581 Ga0307416_101433081
582 Ga0307416_102155006
583 Ga0307414_10002383
584 Ga0307414_10030309
585 Ga0307414_10032844
586 Ga0307414_10174143
587 Ga0307414_10185990
588 Ga0307414_10291835
589 Ga0307414_10447526
590 Ga0307411_10007270
591 Ga0307411_10032114
592 Ga0307411_10131179
593 Ga0307411_10940237
594 Ga0307411_10950559
595 Ga0307411_11831383
596 Ga0307415_100000419
597 Ga0307415_100022610
598 Ga0307415_100214808
599 Ga0307415_100616601
600 Ga0307415_101196942
601 Ga0373930_0079148
602 Ga0373938_0040184
603 Ga0395900_0556842
604 Ga0395905_0175190
605 Ga0395905_0824928
606 Ga0395901_0381729
607 Ga0439456_088754
608 Ga0439444_0118361
609 Ga0496100_0073025
610 Ga0496101_0038807
611 Ga0496102_0067085
612 Ga0496102_0134419
613 Ga0496102_0451550
614 Ga0496102_0651399
615 Ga0496103_0181794
616 Ga0496104_0213008
617 Ga0496104_0623643
618 Ga0496106_0053593
619 Ga0496106_0467735
620 Ga0496106_0503576
621 Ga0496107_0562630
622 Ga0496109_0043903
623 Ga0496110_0028810
624 Ga0496112_0022223
625 Ga0496113_0290170
626 Ga0496114_0134245
627 Ga0501290_038215
628 Ga0501031_0037498
629 Ga0501031_0180444
630 Ga0501033_0037960
631 Ga0501036_0041282
632 Ga0501036_0107665
633 Ga0501036_0629600
634 Ga0501037_0100813
635 Ga0501037_0385475
636 Ga0501038_0102867
637 Ga0501038_0337671
638 Ga0501038_0818279
639 Ga0501039_0306929
640 Ga0501039_0451151
641 Ga0501039_0790075
642 Ga0501040_0015769
643 Ga0501040_0050648
644 Ga0501040_0092866
645 Ga0501041_0109189
646 Ga0501042_0056601
647 Ga0501042_0093536
648 Ga0501043_0430961
649 Ga0501046_0067928
650 Ga0501046_0385729
651 Ga0501046_0415316
652 Ga0501046_0504806
653 Ga0501048_0121539
654 Ga0501048_0141550
655 Ga0501067_0044515
656 Ga0501067_0081790
657 Ga0501067_0383059
658 Ga0501069_0166828
659 Ga0501069_0208868
660 Ga0501069_0390372
661 Ga0501071_0050763
662 Ga0501071_0122533
663 Ga0501072_0020979
664 Ga0501072_0722380
665 Ga0501072_1094412
666 Ga0501073_0685620
667 Ga0501074_0070072
668 Ga0501074_0152142
669 Ga0501075_0018150
670 Ga0501075_0054092
671 Ga0501075_0405455
672 Ga0501076_0021090
673 Ga0501076_0060835
674 Ga0501076_0166402
675 Ga0501076_0529814
676 Ga0501077_0004768
677 Ga0501077_0138424
678 Ga0501217_142363
679 Ga0501243_050550
680 Ga0501257_118324
681 Ga0501079_0012663
682 Ga0501079_0065742
683 Ga0501079_0076836
684 Ga0501079_0224592
685 Ga0501079_0874145
686 Ga0501080_0206627
687 Ga0501080_0299269
688 Ga0501080_0814148
689 Ga0501081_0046941
690 Ga0501081_0065012
691 Ga0501081_0528446
692 Ga0501081_1110637
693 Ga0501083_0127807
694 Ga0501083_0256390
695 Ga0501083_0407072
696 Ga0501275_011114
697 Ga0501035_0492101
698 Ga0501045_0009723
699 Ga0501045_0013141
700 Ga0501045_0014038
701 Ga0501045_0863202
702 nmdc:mga05p37_446659_c1
703 nmdc:mga05p37_51636_c1
704 nmdc:mga05p37_82134_c1
705 nmdc:mga09592_132413_c1
706 nmdc:mga09592_3967_c1
707 nmdc:mga0qj67_168099_c1
708 nmdc:mga0qj67_37040_c1
709 nmdc:mga06r32_1029654_c1
710 nmdc:mga06r32_1032798_c1
711 nmdc:mga06r32_1545969_c1
712 nmdc:mga06r32_276790_c1
713 nmdc:mga06r32_77898_c1
714 nmdc:mga08y16_345174_c1
715 nmdc:mga08y16_373637_c1
716 nmdc:mga0n895_1002418_c1
717 nmdc:mga0n895_108355_c1
718 nmdc:mga0n895_1321467_c1
719 nmdc:mga0n895_40283_c1
720 nmdc:mga0rr50_137799_c1
721 nmdc:mga08x19_52820_c2
722 nmdc:mga08x19_612891_c1
723 nmdc:mga0a205_1032309_c1
724 nmdc:mga0a205_125715_c1
725 nmdc:mga0a205_308214_c1
726 Ga0501084_0047038
727 Ga0501084_0066760
728 Ga0501084_0082936
729 Ga0501084_0086055
730 Ga0590071_001928
731 Ga0590071_013107
732 Ga0590071_083256
733 Ga0590074_006431
734 Ga0590074_007437
735 Ga0590074_044016
736 Ga0590075_018072
737 Ga0590075_036115
738 Ga0590077_133039
739 Ga0501082_0014108
740 Ga0501082_0116172
741 Ga0501082_0674381
742 Ga0530510_0114475
743 Ga0530510_0601879
744 Ga0530510_1107952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

38

161

0.92

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

65

164

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9145 23 154
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9086 23 154
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9015 23 154
6m36-assembly2.cif.gz_I the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9008 23 154
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8974 23 154
ID Description Score Start End Superfamily
af_P9WLZ7_398_539_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8193 23 154 3.30.565.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8036 25 150 3.30.565.10
af_C4IYM4_67_417_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7974 79 101 2.130.10.10
af_P71568_133_255_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7814 23 153 3.30.565.10
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7804 25 150 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A7V3RJN4-F1-model_v4 ATP-binding protein 0.9443 23 154 GO:0004674
GO:0005524
AF-A0A7V1L003-F1-model_v4 ATP-binding protein 0.94 23 154 GO:0004674
GO:0005524
AF-A0A1G1JVY7-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9334 25 154 GO:0004674
AF-A0A7X8PZT0-F1-model_v4 ATP-binding protein 0.9318 23 154 GO:0004674
GO:0005524
AF-A0A523J185-F1-model_v4 ATP-binding protein 0.9316 21 154 GO:0004674
GO:0005524

Map