F425887

General Info

Members Datasets Scaffolds Average Seq Length
371 248 742 259

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_001833|Ga0590071_001833_3719_4642
Length 307
Sequence MKTVTIERWTWVLIFGGLMVLSLSWFIDPAERVLAGLVGLGGLAVVMSTPVLELFSLAGRCALVTGGSRGLGLQMAEALGEAGAKVLLTARKAAELEEAAADLQARGIDTRWVAADMSLPEQVQHVVDEAMQRLGSIDILVNNAGATWGAPAADYPLAAWDKVMNLNVRSVFLLSQAAARASMIPRRHGRIINVASIAGLGGNPPEMTTVAYNTSKAAVINLTRALAVEWGRHGITVNALAPGFFPSRMTRSLIEQVGLEHMQARAPLGRVGDDDDLKGAVLLFASAAGKHITGQVLPVDGGVSAVV

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
248 2585428062 Methylibium sp. CF059 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 3.23
Rhizosphere 90.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_001833 3300059421 Bacteria 5484
2 Ga0065707_10083518 3300005295 Bacteria 8885
3 Ga0065707_10229843 3300005295 Bacteria 1191
4 Ga0070658_10244513 3300005327 Bacteria 1521
5 Ga0070676_10361967 3300005328 Bacteria 1000
6 Ga0070676_10529698 3300005328 Bacteria 840
7 Ga0070683_100327853 3300005329 Bacteria 1457
8 Ga0070690_100033868 3300005330 Bacteria 3199
9 Ga0070670_100001862 3300005331 Bacteria 17185
10 Ga0070670_100019423 3300005331 Bacteria 5831
11 Ga0070677_10007583 3300005333 Bacteria 3627
12 Ga0068869_100020009 3300005334 Bacteria 4584
13 Ga0068869_100041911 3300005334 Bacteria 3280
14 Ga0068869_100083020 3300005334 Bacteria 2396
15 Ga0068868_100012222 3300005338 Bacteria 6273
16 Ga0068868_100012637 3300005338 Bacteria 6175
17 Ga0068868_100267162 3300005338 Bacteria 1444
18 Ga0070660_100023013 3300005339 Bacteria 4613
19 Ga0070689_100224373 3300005340 Bacteria 1542
20 Ga0070689_100412114 3300005340 Bacteria 1144
21 Ga0070691_10065318 3300005341 Bacteria 1757
22 Ga0070668_100238188 3300005347 Bacteria 1506
23 Ga0070668_100337489 3300005347 Bacteria 1272
24 Ga0070669_100096394 3300005353 Bacteria 2225
25 Ga0070675_100000269 3300005354 Bacteria 34213
26 Ga0070675_100000373 3300005354 Bacteria 30278
27 Ga0070675_100031838 3300005354 Bacteria 4265
28 Ga0070675_100171075 3300005354 Bacteria 1873
29 Ga0070675_100233121 3300005354 Bacteria 1606
30 Ga0070671_100021249 3300005355 Bacteria 5301
31 Ga0070671_100105227 3300005355 Bacteria 2368
32 Ga0070674_100040918 3300005356 Bacteria 3137
33 Ga0070674_100042005 3300005356 Bacteria 3103
34 Ga0070674_100112884 3300005356 Bacteria 1998
35 Ga0070674_100123296 3300005356 Bacteria 1921
36 Ga0070673_100115659 3300005364 Bacteria 2230
37 Ga0070673_100298994 3300005364 Bacteria 1416
38 Ga0070659_100194398 3300005366 Bacteria 1668
39 Ga0070667_100141446 3300005367 Bacteria 2108
40 Ga0070713_100257361 3300005436 Bacteria 1594
41 Ga0070663_100109658 3300005455 Bacteria 2072
42 Ga0070663_100309293 3300005455 Bacteria 1267
43 Ga0070678_100029774 3300005456 Bacteria 3743
44 Ga0070678_100265735 3300005456 Bacteria 1445
45 Ga0070678_100323499 3300005456 Bacteria 1318
46 Ga0070662_100117833 3300005457 Bacteria 2032
47 Ga0068867_100015902 3300005459 Bacteria 5341
48 Ga0068867_100275992 3300005459 Bacteria 1376
49 Ga0070706_100185557 3300005467 Bacteria 1943
50 Ga0070679_100362565 3300005530 Bacteria 1396
51 Ga0070684_100315109 3300005535 Bacteria 1436
52 Ga0070672_100012318 3300005543 Bacteria 5999
53 Ga0070672_100061369 3300005543 Bacteria 2963
54 Ga0070672_100101170 3300005543 Bacteria 2338
55 Ga0070693_100203041 3300005547 Bacteria 1288
56 Ga0070665_100002748 3300005548 Bacteria 19069
57 Ga0068855_100656295 3300005563 Bacteria 1126
58 Ga0070664_100070334 3300005564 Bacteria 2997
59 Ga0068854_100140867 3300005578 Bacteria 1850
60 Ga0070702_100136930 3300005615 Bacteria 1555
61 Ga0068852_100068038 3300005616 Bacteria 3115
62 Ga0068852_100073814 3300005616 Bacteria 3002
63 Ga0068852_100110388 3300005616 Bacteria 2499
64 Ga0068859_100006353 3300005617 Bacteria 11993
65 Ga0068859_100167401 3300005617 Bacteria 2278
66 Ga0068859_100336130 3300005617 Bacteria 1605
67 Ga0068864_100001695 3300005618 Bacteria 18112
68 Ga0068864_100022304 3300005618 Bacteria 5308
69 Ga0068864_100220502 3300005618 Bacteria 1750
70 Ga0068866_10025499 3300005718 Bacteria 2780
71 Ga0068866_10116747 3300005718 Bacteria 1497
72 Ga0068866_10139720 3300005718 Bacteria 1389
73 Ga0068861_100000817 3300005719 Bacteria 18823
74 Ga0068851_10009865 3300005834 Bacteria 4446
75 Ga0068870_10119214 3300005840 Bacteria 1517
76 Ga0068863_100002152 3300005841 Bacteria 19541
77 Ga0068863_100041495 3300005841 Bacteria 4376
78 Ga0068858_100013023 3300005842 Bacteria 7844
79 Ga0068858_100217560 3300005842 Bacteria 1809
80 Ga0068860_100009779 3300005843 Bacteria 9521
81 Ga0068860_100069043 3300005843 Bacteria 3358
82 Ga0068860_100105989 3300005843 Bacteria 2685
83 Ga0068862_100004139 3300005844 Bacteria 12288
84 Ga0068862_100011310 3300005844 Bacteria 7369
85 Ga0068862_100100496 3300005844 Bacteria 2529
86 Ga0068862_100377934 3300005844 Bacteria 1321
87 Ga0081538_10122778 3300005981 Bacteria 1243
88 Ga0075432_10070131 3300006058 Bacteria 1258
89 Ga0075367_10138112 3300006178 Bacteria 1509
90 Ga0075366_10000743 3300006195 Bacteria 15491
91 Ga0075366_10123876 3300006195 Bacteria 1558
92 Ga0097621_100040530 3300006237 Bacteria 3745
93 Ga0097621_100103216 3300006237 Bacteria 2401
94 Ga0068871_100007566 3300006358 Bacteria 7772
95 Ga0068871_100128279 3300006358 Bacteria 2148
96 Ga0075430_100008481 3300006846 Bacteria 8682
97 Ga0075433_10155219 3300006852 Bacteria 2036
98 Ga0075433_10579383 3300006852 Bacteria 986
99 Ga0075429_100095840 3300006880 Bacteria 2588
100 Ga0075429_100305732 3300006880 Bacteria 1392
101 Ga0068865_100006175 3300006881 Bacteria 7304
102 Ga0097620_100006353 3300006931 Bacteria 11993
103 Ga0097620_100167402 3300006931 Bacteria 2278
104 Ga0097620_100336131 3300006931 Bacteria 1605
105 Ga0075435_100236721 3300007076 Bacteria 1552
106 Ga0105240_10034781 3300009093 Bacteria 6496
107 Ga0105240_10175796 3300009093 Bacteria 2531
108 Ga0105240_10464303 3300009093 Bacteria 1414
109 Ga0111539_10593832 3300009094 Bacteria 1289
110 Ga0111539_10678946 3300009094 Bacteria 1199
111 Ga0105245_10013754 3300009098 Bacteria 7047
112 Ga0105245_10078225 3300009098 Bacteria 3018
113 Ga0105247_10244828 3300009101 Bacteria 1223
114 Ga0114129_10023730 3300009147 Bacteria 8694
115 Ga0105243_10586059 3300009148 Bacteria 1071
116 Ga0105241_10125753 3300009174 Bacteria 2070
117 Ga0105248_10027634 3300009177 Bacteria 6319
118 Ga0105248_10383648 3300009177 Bacteria 1582
119 Ga0105238_10004231 3300009551 Bacteria 14254
120 Ga0105238_10116222 3300009551 Bacteria 2655
121 Ga0105249_10450646 3300009553 Bacteria 1325
122 Ga0105249_10739045 3300009553 Bacteria 1046
123 Ga0157325_1000850 3300012485 Bacteria 1279
124 Ga0157370_10230451 3300013104 Bacteria 1715
125 Ga0157374_10011952 3300013296 Bacteria 7537
126 Ga0157374_10022467 3300013296 Bacteria 5627
127 Ga0157374_10732677 3300013296 Bacteria 1003
128 Ga0157378_10524050 3300013297 Bacteria 1187
129 Ga0163162_10101667 3300013306 Bacteria 2967
130 Ga0157372_10157145 3300013307 Bacteria 2627
131 Ga0157375_10173235 3300013308 Bacteria 2306
132 Ga0163163_10000864 3300014325 Bacteria 25838
133 Ga0157380_10436160 3300014326 Bacteria 1254
134 Ga0157377_10037074 3300014745 Bacteria 2685
135 Ga0157379_10023287 3300014968 Bacteria 5494
136 Ga0157379_10041589 3300014968 Bacteria 4103
137 Ga0157376_10010615 3300014969 Bacteria 6746
138 Ga0157376_10022221 3300014969 Bacteria 4941
139 Ga0157376_10152833 3300014969 Bacteria 2083
140 Ga0157376_10217650 3300014969 Bacteria 1767
141 Ga0163161_10176803 3300017792 Bacteria 1634
142 Ga0207682_10000456 3300025893 Bacteria 18858
143 Ga0207682_10008066 3300025893 Bacteria 4177
144 Ga0207642_10074204 3300025899 Bacteria 1629
145 Ga0207688_10078455 3300025901 Bacteria 1882
146 Ga0207688_10092158 3300025901 Bacteria 1741
147 Ga0207680_10005735 3300025903 Bacteria 5951
148 Ga0207643_10072863 3300025908 Bacteria 1979
149 Ga0207684_10177943 3300025910 Bacteria 1834
150 Ga0207654_10138932 3300025911 Bacteria 1547
151 Ga0207654_10221004 3300025911 Bacteria 1256
152 Ga0207695_10025643 3300025913 Bacteria 6594
153 Ga0207695_10025800 3300025913 Bacteria 6570
154 Ga0207695_10175266 3300025913 Bacteria 2067
155 Ga0207695_10196625 3300025913 Bacteria 1932
156 Ga0207657_10083418 3300025919 Bacteria 2681
157 Ga0207649_10034144 3300025920 Bacteria 3045
158 Ga0207681_10388661 3300025923 Bacteria 1124
159 Ga0207694_10000623 3300025924 Bacteria 32207
160 Ga0207694_10093387 3300025924 Bacteria 2376
161 Ga0207650_10001236 3300025925 Bacteria 18596
162 Ga0207650_10003907 3300025925 Bacteria 10190
163 Ga0207659_10000135 3300025926 Bacteria 43365
164 Ga0207659_10000412 3300025926 Bacteria 25823
165 Ga0207659_10006579 3300025926 Bacteria 7133
166 Ga0207659_10052887 3300025926 Bacteria 2895
167 Ga0207687_10039480 3300025927 Bacteria 3232
168 Ga0207687_10079741 3300025927 Bacteria 2361
169 Ga0207644_10017743 3300025931 Bacteria 4811
170 Ga0207644_10142551 3300025931 Bacteria 1846
171 Ga0207690_10043164 3300025932 Bacteria 2966
172 Ga0207706_10010207 3300025933 Bacteria 8590
173 Ga0207706_10185828 3300025933 Bacteria 1825
174 Ga0207670_10226402 3300025936 Bacteria 1434
175 Ga0207669_10017445 3300025937 Bacteria 3682
176 Ga0207669_10298334 3300025937 Bacteria 1223
177 Ga0207704_10003397 3300025938 Bacteria 7234
178 Ga0207665_10175344 3300025939 Bacteria 1550
179 Ga0207691_10002618 3300025940 Bacteria 17576
180 Ga0207691_10245627 3300025940 Bacteria 1546
181 Ga0207691_10254412 3300025940 Bacteria 1515
182 Ga0207711_10004503 3300025941 Bacteria 11873
183 Ga0207711_10253026 3300025941 Bacteria 1618
184 Ga0207689_10008826 3300025942 Bacteria 8758
185 Ga0207689_10254682 3300025942 Bacteria 1452
186 Ga0207689_10304973 3300025942 Bacteria 1320
187 Ga0207679_10025752 3300025945 Bacteria 4049
188 Ga0207667_10224784 3300025949 Bacteria 1923
189 Ga0207651_10001078 3300025960 Bacteria 12121
190 Ga0207651_10018452 3300025960 Bacteria 4152
191 Ga0207651_10168496 3300025960 Bacteria 1725
192 Ga0207668_10087274 3300025972 Bacteria 2281
193 Ga0207658_10010935 3300025986 Bacteria 6178
194 Ga0207658_10046839 3300025986 Bacteria 3160
195 Ga0207677_10001713 3300026023 Bacteria 11602
196 Ga0207677_10022121 3300026023 Bacteria 3901
197 Ga0207677_10140985 3300026023 Bacteria 1845
198 Ga0207703_10001097 3300026035 Bacteria 25719
199 Ga0207703_10019720 3300026035 Bacteria 5271
200 Ga0207703_10038593 3300026035 Bacteria 3812
201 Ga0207678_10141686 3300026067 Bacteria 2052
202 Ga0207678_10257076 3300026067 Bacteria 1496
203 Ga0207678_10439658 3300026067 Bacteria 1133
204 Ga0207702_10105316 3300026078 Bacteria 2498
205 Ga0207641_10004871 3300026088 Bacteria 11549
206 Ga0207648_10038822 3300026089 Bacteria 4190
207 Ga0207648_10210804 3300026089 Bacteria 1725
208 Ga0207676_10001370 3300026095 Bacteria 18134
209 Ga0207676_10037870 3300026095 Bacteria 3679
210 Ga0207675_100172856 3300026118 Bacteria 2066
211 Ga0207683_10005554 3300026121 Bacteria 10802
212 Ga0207683_10372924 3300026121 Bacteria 1311
213 Ga0207683_10375967 3300026121 Bacteria 1306
214 Ga0207698_10008093 3300026142 Bacteria 6627
215 Ga0207698_10030616 3300026142 Bacteria 3873
216 Ga0207698_10482488 3300026142 Bacteria 1203
217 Ga0268266_10001397 3300028379 Bacteria 28929
218 Ga0268266_10853829 3300028379 Bacteria 880
219 Ga0268265_10040153 3300028380 Bacteria 3454
220 Ga0268265_10061371 3300028380 Bacteria 2884
221 Ga0268265_10088689 3300028380 Bacteria 2465
222 Ga0268265_10159962 3300028380 Bacteria 1911
223 Ga0268264_10015376 3300028381 Bacteria 6276
224 Ga0268264_10180776 3300028381 Bacteria 1915
225 Ga0268264_10551971 3300028381 Bacteria 1130
226 Ga0307515_10000187 3300028794 Bacteria 151904
227 Ga0307515_10000727 3300028794 Bacteria 75922
228 Ga0307515_10001587 3300028794 Bacteria 50732
229 Ga0307515_10006873 3300028794 Bacteria 22633
230 Ga0307515_10029344 3300028794 Bacteria 9302
231 Ga0307512_10047276 3300030522 Bacteria 3499
232 Ga0307513_10002833 3300031456 Bacteria 23769
233 Ga0307513_10032687 3300031456 Bacteria 5862
234 Ga0307509_10006998 3300031507 Bacteria 14944
235 Ga0307408_100136341 3300031548 Bacteria 1921
236 Ga0307516_10008844 3300031730 Bacteria 11310
237 Ga0307516_10041230 3300031730 Bacteria 4590
238 Ga0307413_10012999 3300031824 Bacteria 4165
239 Ga0307406_10006192 3300031901 Bacteria 6586
240 Ga0307409_100133999 3300031995 Bacteria 2122
241 Ga0307416_100340186 3300032002 Bacteria 1513
242 Ga0373928_0010268 3300035084 Bacteria 1838
243 Ga0373929_0026400 3300035085 Bacteria 1213
244 Ga0373934_0088914 3300035086 Bacteria 1244
245 Ga0373940_0037535 3300035088 Bacteria 1319
246 Ga0373944_0020431 3300035089 Bacteria 1908
247 Ga0373952_0019406 3300035092 Bacteria 1415
248 Ga0373946_0118162 3300035171 Bacteria 1208
249 Ga0373955_0167744 3300035172 Bacteria 1298
250 Ga0373961_0042756 3300035241 Bacteria 1315
251 Ga0373937_0226640 3300036401 Bacteria 1759
252 Ga0373937_0369410 3300036401 Bacteria 1360
253 Ga0395899_0091727 3300037312 Bacteria 2201
254 Ga0395900_0000535 3300037418 Bacteria 53622
255 Ga0395900_0161273 3300037418 Bacteria 2287
256 Ga0395898_0000485 3300037466 Bacteria 78871
257 Ga0395905_0169411 3300037471 Bacteria 2051
258 Ga0395901_0540295 3300038443 Bacteria 1182
259 Ga0439461_0050906 3300041410 Bacteria 918
260 Ga0451853_1671305 3300041512 Bacteria 1764
261 Ga0439449_0036669 3300042007 Bacteria 1824
262 Ga0439457_013075 3300042014 Bacteria 1866
263 Ga0439435_0000783 3300042436 Bacteria 5358
264 Ga0451577_0120692 3300042876 Bacteria 2348
265 Ga0466972_0046880 3300044658 Bacteria 2091
266 Ga0466965_0050239 3300044683 Bacteria 2067
267 Ga0453684_0049647 3300044712 Bacteria 5529
268 Ga0466971_0157029 3300044719 Bacteria 1063
269 Ga0466957_0026015 3300044842 Bacteria 3470
270 Ga0466960_0043735 3300044901 Bacteria 2132
271 Ga0466959_0008985 3300045049 Bacteria 7086
272 Ga0451576_0354118 3300045051 Bacteria 1537
273 Ga0466967_0041171 3300045976 Bacteria 3981
274 Ga0495592_0261851 3300046454 Bacteria 1139
275 Ga0495592_0283601 3300046454 Bacteria 1082
276 Ga0495629_0331343 3300046459 Bacteria 1040
277 Ga0495580_0313086 3300046472 Bacteria 1068
278 Ga0495662_0004818 3300046476 Bacteria 6763
279 Ga0495584_0196062 3300046491 Bacteria 1026
280 Ga0495583_0019472 3300046506 Bacteria 3541
281 Ga0495608_0010394 3300046511 Bacteria 6495
282 Ga0495610_0009117 3300046512 Bacteria 6315
283 Ga0495618_0111941 3300046514 Bacteria 1748
284 Ga0495628_0006337 3300046516 Bacteria 10341
285 Ga0495628_0178517 3300046516 Bacteria 1607
286 Ga0495630_0001124 3300046517 Bacteria 18441
287 Ga0495666_0006290 3300046526 Bacteria 5981
288 Ga0495652_0052066 3300046529 Bacteria 3493
289 Ga0495654_0007149 3300046530 Bacteria 6268
290 Ga0495665_0204230 3300046531 Bacteria 1024
291 Ga0495640_0001398 3300046533 Bacteria 18997
292 Ga0495640_0021347 3300046533 Bacteria 4755
293 Ga0495586_0001311 3300046535 Bacteria 13836
294 Ga0495586_0007199 3300046535 Bacteria 5935
295 Ga0495587_0006712 3300046536 Bacteria 7496
296 Ga0495621_0037602 3300046539 Bacteria 1684
297 Ga0495597_0001722 3300046542 Bacteria 15099
298 Ga0495645_0030431 3300046543 Bacteria 3931
299 Ga0495667_0017435 3300046559 Bacteria 4850
300 Ga0495668_0002253 3300046616 Bacteria 16242
301 Ga0495634_0004109 3300046642 Bacteria 11527
302 Ga0495625_0025635 3300046660 Bacteria 4469
303 Ga0495647_0057594 3300046681 Bacteria 1526
304 Ga0495658_0027285 3300046683 Bacteria 3071
305 Ga0495658_0036770 3300046683 Bacteria 2703
306 Ga0495613_0014125 3300046689 Bacteria 5925
307 Ga0495624_0016753 3300046690 Bacteria 4932
308 Ga0495624_0043008 3300046690 Bacteria 2883
309 Ga0495671_0011062 3300046692 Bacteria 4981
310 Ga0495649_0096855 3300046694 Bacteria 1570
311 Ga0495589_0124388 3300046794 Bacteria 1240
312 Ga0495604_0001361 3300047317 Bacteria 20003
313 Ga0495604_0057287 3300047317 Bacteria 2996
314 Ga0495672_0014159 3300047320 Bacteria 5473
315 Ga0495680_0014826 3300047322 Bacteria 6739
316 Ga0495683_0010176 3300047323 Bacteria 4982
317 Ga0495677_0124000 3300047445 Bacteria 986
318 Ga0495681_0008613 3300047470 Bacteria 6369
319 Ga0495686_0009232 3300047472 Bacteria 7135
320 Ga0496101_0102214 3300048904 Bacteria 2147
321 Ga0496106_0018478 3300048909 Bacteria 5155
322 Ga0496106_0020901 3300048909 Bacteria 4857
323 Ga0496107_0005574 3300048910 Bacteria 8622
324 Ga0496108_0049887 3300048911 Bacteria 3501
325 Ga0496109_0090089 3300048912 Bacteria 2836
326 Ga0496110_0218741 3300048913 Bacteria 1732
327 Ga0496110_0290896 3300048913 Bacteria 1488
328 Ga0496111_0022254 3300048914 Bacteria 4435
329 Ga0496112_0484234 3300048915 Bacteria 1173
330 Ga0496115_0011266 3300048918 Bacteria 6701
331 Ga0496115_0163917 3300048918 Bacteria 1838
332 Ga0501299_014701 3300049522 Bacteria 1366
333 Ga0501038_0037170 3300049574 Bacteria 4271
334 Ga0501039_0019978 3300049575 Bacteria 5134
335 Ga0501040_0057788 3300049576 Bacteria 2664
336 Ga0501041_0016937 3300049577 Bacteria 4336
337 Ga0501042_0141993 3300049578 Bacteria 1731
338 Ga0501046_0094882 3300049580 Bacteria 2292
339 Ga0501071_0032113 3300049587 Bacteria 3726
340 Ga0501072_0009825 3300049588 Bacteria 7274
341 Ga0501074_0214128 3300049590 Bacteria 1372
342 Ga0501075_0008633 3300049591 Bacteria 7104
343 Ga0501075_0257378 3300049591 Bacteria 1330
344 Ga0501076_0002070 3300049592 Bacteria 13739
345 Ga0501077_0044299 3300049593 Bacteria 2827
346 Ga0501079_0012688 3300049741 Bacteria 6436
347 Ga0501080_0065143 3300049742 Bacteria 3390
348 Ga0501081_0014040 3300049743 Bacteria 5275
349 Ga0501035_0205084 3300049822 Bacteria 1689
350 Ga0501045_0028852 3300049824 Bacteria 4005
351 nmdc:mga0k408_35725_c1 3300050493 Bacteria 2850
352 nmdc:mga0k408_48512_c1 3300050493 Bacteria 2457
353 nmdc:mga0k408_49965_c2 3300050493 Bacteria 2203
354 nmdc:mga05p37_29220_c1 3300050507 Bacteria 6728
355 nmdc:mga09592_26266_c1 3300050508 Bacteria 4823
356 nmdc:mga08y16_172222_c1 3300050511 Bacteria 2248
357 nmdc:mga08y16_174056_c1 3300050511 Bacteria 2235
358 nmdc:mga0rr50_303309_c1 3300050513 Bacteria 1336
359 nmdc:mga0a205_175813_c1 3300050515 Bacteria 2036
360 Ga0495601_0077618 3300053077 Bacteria 2127
361 Ga0495612_0039678 3300053078 Bacteria 1916
362 Ga0495619_0021928 3300053085 Bacteria 4083
363 Ga0495619_0379936 3300053085 Bacteria 976
364 Ga0500578_0043119 3300053086 Bacteria 2896
365 Ga0500595_005784 3300053119 Bacteria 5340
366 Ga0500645_022195 3300053730 Bacteria 1954
367 Ga0500587_000467 3300053739 Bacteria 4821
368 Ga0501084_0051816 3300054114 Bacteria 3435
369 Ga0501082_0022247 3300060353 Bacteria 5463
370 Ga0530510_0002052 3300061734 Bacteria 13839
371 2587756033 2585428062 Bacteria 6842168
372 Ga0590071_001833
373 Ga0065707_10083518
374 Ga0065707_10229843
375 Ga0070658_10244513
376 Ga0070676_10361967
377 Ga0070676_10529698
378 Ga0070683_100327853
379 Ga0070690_100033868
380 Ga0070670_100001862
381 Ga0070670_100019423
382 Ga0070677_10007583
383 Ga0068869_100020009
384 Ga0068869_100041911
385 Ga0068869_100083020
386 Ga0068868_100012222
387 Ga0068868_100012637
388 Ga0068868_100267162
389 Ga0070660_100023013
390 Ga0070689_100224373
391 Ga0070689_100412114
392 Ga0070691_10065318
393 Ga0070668_100238188
394 Ga0070668_100337489
395 Ga0070669_100096394
396 Ga0070675_100000269
397 Ga0070675_100000373
398 Ga0070675_100031838
399 Ga0070675_100171075
400 Ga0070675_100233121
401 Ga0070671_100021249
402 Ga0070671_100105227
403 Ga0070674_100040918
404 Ga0070674_100042005
405 Ga0070674_100112884
406 Ga0070674_100123296
407 Ga0070673_100115659
408 Ga0070673_100298994
409 Ga0070659_100194398
410 Ga0070667_100141446
411 Ga0070713_100257361
412 Ga0070663_100109658
413 Ga0070663_100309293
414 Ga0070678_100029774
415 Ga0070678_100265735
416 Ga0070678_100323499
417 Ga0070662_100117833
418 Ga0068867_100015902
419 Ga0068867_100275992
420 Ga0070706_100185557
421 Ga0070679_100362565
422 Ga0070684_100315109
423 Ga0070672_100012318
424 Ga0070672_100061369
425 Ga0070672_100101170
426 Ga0070693_100203041
427 Ga0070665_100002748
428 Ga0068855_100656295
429 Ga0070664_100070334
430 Ga0068854_100140867
431 Ga0070702_100136930
432 Ga0068852_100068038
433 Ga0068852_100073814
434 Ga0068852_100110388
435 Ga0068859_100006353
436 Ga0068859_100167401
437 Ga0068859_100336130
438 Ga0068864_100001695
439 Ga0068864_100022304
440 Ga0068864_100220502
441 Ga0068866_10025499
442 Ga0068866_10116747
443 Ga0068866_10139720
444 Ga0068861_100000817
445 Ga0068851_10009865
446 Ga0068870_10119214
447 Ga0068863_100002152
448 Ga0068863_100041495
449 Ga0068858_100013023
450 Ga0068858_100217560
451 Ga0068860_100009779
452 Ga0068860_100069043
453 Ga0068860_100105989
454 Ga0068862_100004139
455 Ga0068862_100011310
456 Ga0068862_100100496
457 Ga0068862_100377934
458 Ga0081538_10122778
459 Ga0075432_10070131
460 Ga0075367_10138112
461 Ga0075366_10000743
462 Ga0075366_10123876
463 Ga0097621_100040530
464 Ga0097621_100103216
465 Ga0068871_100007566
466 Ga0068871_100128279
467 Ga0075430_100008481
468 Ga0075433_10155219
469 Ga0075433_10579383
470 Ga0075429_100095840
471 Ga0075429_100305732
472 Ga0068865_100006175
473 Ga0097620_100006353
474 Ga0097620_100167402
475 Ga0097620_100336131
476 Ga0075435_100236721
477 Ga0105240_10034781
478 Ga0105240_10175796
479 Ga0105240_10464303
480 Ga0111539_10593832
481 Ga0111539_10678946
482 Ga0105245_10013754
483 Ga0105245_10078225
484 Ga0105247_10244828
485 Ga0114129_10023730
486 Ga0105243_10586059
487 Ga0105241_10125753
488 Ga0105248_10027634
489 Ga0105248_10383648
490 Ga0105238_10004231
491 Ga0105238_10116222
492 Ga0105249_10450646
493 Ga0105249_10739045
494 Ga0157325_1000850
495 Ga0157370_10230451
496 Ga0157374_10011952
497 Ga0157374_10022467
498 Ga0157374_10732677
499 Ga0157378_10524050
500 Ga0163162_10101667
501 Ga0157372_10157145
502 Ga0157375_10173235
503 Ga0163163_10000864
504 Ga0157380_10436160
505 Ga0157377_10037074
506 Ga0157379_10023287
507 Ga0157379_10041589
508 Ga0157376_10010615
509 Ga0157376_10022221
510 Ga0157376_10152833
511 Ga0157376_10217650
512 Ga0163161_10176803
513 Ga0207682_10000456
514 Ga0207682_10008066
515 Ga0207642_10074204
516 Ga0207688_10078455
517 Ga0207688_10092158
518 Ga0207680_10005735
519 Ga0207643_10072863
520 Ga0207684_10177943
521 Ga0207654_10138932
522 Ga0207654_10221004
523 Ga0207695_10025643
524 Ga0207695_10025800
525 Ga0207695_10175266
526 Ga0207695_10196625
527 Ga0207657_10083418
528 Ga0207649_10034144
529 Ga0207681_10388661
530 Ga0207694_10000623
531 Ga0207694_10093387
532 Ga0207650_10001236
533 Ga0207650_10003907
534 Ga0207659_10000135
535 Ga0207659_10000412
536 Ga0207659_10006579
537 Ga0207659_10052887
538 Ga0207687_10039480
539 Ga0207687_10079741
540 Ga0207644_10017743
541 Ga0207644_10142551
542 Ga0207690_10043164
543 Ga0207706_10010207
544 Ga0207706_10185828
545 Ga0207670_10226402
546 Ga0207669_10017445
547 Ga0207669_10298334
548 Ga0207704_10003397
549 Ga0207665_10175344
550 Ga0207691_10002618
551 Ga0207691_10245627
552 Ga0207691_10254412
553 Ga0207711_10004503
554 Ga0207711_10253026
555 Ga0207689_10008826
556 Ga0207689_10254682
557 Ga0207689_10304973
558 Ga0207679_10025752
559 Ga0207667_10224784
560 Ga0207651_10001078
561 Ga0207651_10018452
562 Ga0207651_10168496
563 Ga0207668_10087274
564 Ga0207658_10010935
565 Ga0207658_10046839
566 Ga0207677_10001713
567 Ga0207677_10022121
568 Ga0207677_10140985
569 Ga0207703_10001097
570 Ga0207703_10019720
571 Ga0207703_10038593
572 Ga0207678_10141686
573 Ga0207678_10257076
574 Ga0207678_10439658
575 Ga0207702_10105316
576 Ga0207641_10004871
577 Ga0207648_10038822
578 Ga0207648_10210804
579 Ga0207676_10001370
580 Ga0207676_10037870
581 Ga0207675_100172856
582 Ga0207683_10005554
583 Ga0207683_10372924
584 Ga0207683_10375967
585 Ga0207698_10008093
586 Ga0207698_10030616
587 Ga0207698_10482488
588 Ga0268266_10001397
589 Ga0268266_10853829
590 Ga0268265_10040153
591 Ga0268265_10061371
592 Ga0268265_10088689
593 Ga0268265_10159962
594 Ga0268264_10015376
595 Ga0268264_10180776
596 Ga0268264_10551971
597 Ga0307515_10000187
598 Ga0307515_10000727
599 Ga0307515_10001587
600 Ga0307515_10006873
601 Ga0307515_10029344
602 Ga0307512_10047276
603 Ga0307513_10002833
604 Ga0307513_10032687
605 Ga0307509_10006998
606 Ga0307408_100136341
607 Ga0307516_10008844
608 Ga0307516_10041230
609 Ga0307413_10012999
610 Ga0307406_10006192
611 Ga0307409_100133999
612 Ga0307416_100340186
613 Ga0373928_0010268
614 Ga0373929_0026400
615 Ga0373934_0088914
616 Ga0373940_0037535
617 Ga0373944_0020431
618 Ga0373952_0019406
619 Ga0373946_0118162
620 Ga0373955_0167744
621 Ga0373961_0042756
622 Ga0373937_0226640
623 Ga0373937_0369410
624 Ga0395899_0091727
625 Ga0395900_0000535
626 Ga0395900_0161273
627 Ga0395898_0000485
628 Ga0395905_0169411
629 Ga0395901_0540295
630 Ga0439461_0050906
631 Ga0451853_1671305
632 Ga0439449_0036669
633 Ga0439457_013075
634 Ga0439435_0000783
635 Ga0451577_0120692
636 Ga0466972_0046880
637 Ga0466965_0050239
638 Ga0453684_0049647
639 Ga0466971_0157029
640 Ga0466957_0026015
641 Ga0466960_0043735
642 Ga0466959_0008985
643 Ga0451576_0354118
644 Ga0466967_0041171
645 Ga0495592_0261851
646 Ga0495592_0283601
647 Ga0495629_0331343
648 Ga0495580_0313086
649 Ga0495662_0004818
650 Ga0495584_0196062
651 Ga0495583_0019472
652 Ga0495608_0010394
653 Ga0495610_0009117
654 Ga0495618_0111941
655 Ga0495628_0006337
656 Ga0495628_0178517
657 Ga0495630_0001124
658 Ga0495666_0006290
659 Ga0495652_0052066
660 Ga0495654_0007149
661 Ga0495665_0204230
662 Ga0495640_0001398
663 Ga0495640_0021347
664 Ga0495586_0001311
665 Ga0495586_0007199
666 Ga0495587_0006712
667 Ga0495621_0037602
668 Ga0495597_0001722
669 Ga0495645_0030431
670 Ga0495667_0017435
671 Ga0495668_0002253
672 Ga0495634_0004109
673 Ga0495625_0025635
674 Ga0495647_0057594
675 Ga0495658_0027285
676 Ga0495658_0036770
677 Ga0495613_0014125
678 Ga0495624_0016753
679 Ga0495624_0043008
680 Ga0495671_0011062
681 Ga0495649_0096855
682 Ga0495589_0124388
683 Ga0495604_0001361
684 Ga0495604_0057287
685 Ga0495672_0014159
686 Ga0495680_0014826
687 Ga0495683_0010176
688 Ga0495677_0124000
689 Ga0495681_0008613
690 Ga0495686_0009232
691 Ga0496101_0102214
692 Ga0496106_0018478
693 Ga0496106_0020901
694 Ga0496107_0005574
695 Ga0496108_0049887
696 Ga0496109_0090089
697 Ga0496110_0218741
698 Ga0496110_0290896
699 Ga0496111_0022254
700 Ga0496112_0484234
701 Ga0496115_0011266
702 Ga0496115_0163917
703 Ga0501299_014701
704 Ga0501038_0037170
705 Ga0501039_0019978
706 Ga0501040_0057788
707 Ga0501041_0016937
708 Ga0501042_0141993
709 Ga0501046_0094882
710 Ga0501071_0032113
711 Ga0501072_0009825
712 Ga0501074_0214128
713 Ga0501075_0008633
714 Ga0501075_0257378
715 Ga0501076_0002070
716 Ga0501077_0044299
717 Ga0501079_0012688
718 Ga0501080_0065143
719 Ga0501081_0014040
720 Ga0501035_0205084
721 Ga0501045_0028852
722 nmdc:mga0k408_35725_c1
723 nmdc:mga0k408_48512_c1
724 nmdc:mga0k408_49965_c2
725 nmdc:mga05p37_29220_c1
726 nmdc:mga09592_26266_c1
727 nmdc:mga08y16_172222_c1
728 nmdc:mga08y16_174056_c1
729 nmdc:mga0rr50_303309_c1
730 nmdc:mga0a205_175813_c1
731 Ga0495601_0077618
732 Ga0495612_0039678
733 Ga0495619_0021928
734 Ga0495619_0379936
735 Ga0500578_0043119
736 Ga0500595_005784
737 Ga0500645_022195
738 Ga0500587_000467
739 Ga0501084_0051816
740 Ga0501082_0022247
741 Ga0530510_0002052
742 2587756033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

60

258

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

66

304

0.93

PF08659

KR

KR domain

61

240

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

62

276

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t2u-assembly1.cif.gz_B short chain dehydrogenase/reductase family protein 0.9641 10 260
4afn-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa at 2.3a resolution 0.9635 10 257
4ag3-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with nadph at 1.8a resolution 0.9633 10 257
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9605 10 256
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9603 11 257
ID Description Score Start End Superfamily
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9641 10 260 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9579 11 257 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9561 10 260 3.40.50.720
4j2hA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9556 8 261 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 11 258 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C7JRJ5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9744 10 153
AF-A0A3E0B9U2-F1-model_v4 deleted 0.9704 11 94
AF-A0A2N0QKI9-F1-model_v4 NAD(P)-binding protein 0.9675 11 134 GO:0005829
GO:0009688
GO:0010301
AF-X1HCU3-F1-model_v4 Uncharacterized protein 0.967 11 98
AF-A0A3S1JNC0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9658 11 70 GO:0016020
GO:0016491

Map