F425793

General Info

Members Datasets Scaffolds Average Seq Length
371 204 742 74

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0487390|Ga0373923_0487390_91_354
Length 87
Sequence MKSGIHPLYETRTFHCYGCGEEWSTRTTLKPSSSDGKVHLDICSKCHPFFTGKQKLLDKAGRVDRFRKRYAKVTPAGATEAAEATDK

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
139 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
142 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 2.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 98.38
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0487390 3300035111 Bacteria 600
2 Ga0058863_11890639 3300004799 Bacteria 533
3 Ga0065704_10230832 3300005289 Bacteria 1043
4 Ga0070658_10004447 3300005327 Bacteria 11416
5 Ga0070670_101909605 3300005331 Unclassified 547
6 Ga0070680_100208324 3300005336 Bacteria 1649
7 Ga0070660_100582506 3300005339 Bacteria 935
8 Ga0070689_102143476 3300005340 Bacteria 512
9 Ga0070691_10612601 3300005341 Bacteria 644
10 Ga0070661_100018166 3300005344 Bacteria 4997
11 Ga0070668_100132758 3300005347 Bacteria 2000
12 Ga0070675_100341267 3300005354 Bacteria 1327
13 Ga0070688_100603071 3300005365 Bacteria 841
14 Ga0070659_101039578 3300005366 Bacteria 720
15 Ga0070703_10006643 3300005406 Bacteria 3239
16 Ga0070703_10041069 3300005406 Bacteria 1441
17 Ga0070709_10000532 3300005434 Bacteria 22284
18 Ga0070713_100040644 3300005436 Bacteria 3782
19 Ga0070710_10112703 3300005437 Bacteria 1636
20 Ga0070711_100000119 3300005439 Bacteria 41361
21 Ga0070705_100002222 3300005440 Bacteria 9864
22 Ga0070705_100303799 3300005440 Bacteria 1145
23 Ga0070705_100601696 3300005440 Bacteria 850
24 Ga0070705_101618470 3300005440 Unclassified 545
25 Ga0070700_100385700 3300005441 Unclassified 1049
26 Ga0070694_100024237 3300005444 Bacteria 3915
27 Ga0070694_100048533 3300005444 Bacteria 2856
28 Ga0070694_100059033 3300005444 Bacteria 2611
29 Ga0070708_100003612 3300005445 Bacteria 12138
30 Ga0070708_100025394 3300005445 Bacteria 5064
31 Ga0070708_100036517 3300005445 Bacteria 4285
32 Ga0070708_100199841 3300005445 Bacteria 1871
33 Ga0070708_100203544 3300005445 Bacteria 1854
34 Ga0070663_100527126 3300005455 Bacteria 984
35 Ga0068867_101107815 3300005459 Bacteria 723
36 Ga0068867_101109377 3300005459 Bacteria 723
37 Ga0070685_11283969 3300005466 Bacteria 559
38 Ga0070706_100048087 3300005467 Bacteria 3937
39 Ga0070706_100101268 3300005467 Bacteria 2677
40 Ga0070706_100111369 3300005467 Bacteria 2547
41 Ga0070706_100138790 3300005467 Bacteria 2269
42 Ga0070706_100222211 3300005467 Bacteria 1763
43 Ga0070706_101363720 3300005467 Bacteria 649
44 Ga0070707_100005300 3300005468 Bacteria 12069
45 Ga0070707_100011042 3300005468 Bacteria 8412
46 Ga0070707_100054351 3300005468 Bacteria 3838
47 Ga0070707_100113981 3300005468 Bacteria 2623
48 Ga0070707_100117565 3300005468 Bacteria 2580
49 Ga0070707_100134556 3300005468 Bacteria 2404
50 Ga0070707_100382405 3300005468 Bacteria 1367
51 Ga0070707_100773906 3300005468 Bacteria 923
52 Ga0070698_100000232 3300005471 Bacteria 55170
53 Ga0070698_100021843 3300005471 Bacteria 6703
54 Ga0070698_100202352 3300005471 Bacteria 1921
55 Ga0070698_100225892 3300005471 Bacteria 1805
56 Ga0070699_100000787 3300005518 Bacteria 29287
57 Ga0070699_100048061 3300005518 Bacteria 3692
58 Ga0070699_100067693 3300005518 Bacteria 3101
59 Ga0070699_100087032 3300005518 Bacteria 2727
60 Ga0070699_100159694 3300005518 Bacteria 1995
61 Ga0070699_100617363 3300005518 Bacteria 989
62 Ga0070699_101987607 3300005518 Bacteria 531
63 Ga0070679_100037580 3300005530 Bacteria 4811
64 Ga0070697_100015903 3300005536 Bacteria 5911
65 Ga0070697_100054041 3300005536 Bacteria 3264
66 Ga0070697_100086284 3300005536 Bacteria 2590
67 Ga0070697_100196501 3300005536 Bacteria 1713
68 Ga0070697_100342199 3300005536 Bacteria 1291
69 Ga0070697_100525846 3300005536 Bacteria 1036
70 Ga0070697_100731304 3300005536 Bacteria 874
71 Ga0070697_100919390 3300005536 Bacteria 776
72 Ga0068853_100011418 3300005539 Bacteria 7216
73 Ga0070695_100010677 3300005545 Bacteria 5487
74 Ga0070695_101039072 3300005545 Bacteria 668
75 Ga0070696_100050267 3300005546 Bacteria 2897
76 Ga0070696_100369216 3300005546 Bacteria 1115
77 Ga0070696_100411653 3300005546 Bacteria 1060
78 Ga0070665_100776423 3300005548 Bacteria 971
79 Ga0070704_100005777 3300005549 Bacteria 7239
80 Ga0070704_100619459 3300005549 Bacteria 953
81 Ga0070704_101260628 3300005549 Bacteria 675
82 Ga0068855_100034492 3300005563 Bacteria 6035
83 Ga0068854_100193192 3300005578 Bacteria 1596
84 Ga0068856_100146898 3300005614 Bacteria 2365
85 Ga0068856_100244291 3300005614 Bacteria 1810
86 Ga0070702_101640450 3300005615 Bacteria 533
87 Ga0068852_100097419 3300005616 Bacteria 2646
88 Ga0068859_102554248 3300005617 Bacteria 562
89 Ga0068864_100680311 3300005618 Bacteria 1004
90 Ga0068851_10009714 3300005834 Bacteria 4481
91 Ga0068863_100026714 3300005841 Bacteria 5505
92 Ga0068863_101403982 3300005841 Bacteria 706
93 Ga0068860_100570926 3300005843 Bacteria 1134
94 Ga0068862_101188396 3300005844 Bacteria 761
95 Ga0075432_10058978 3300006058 Bacteria 1364
96 Ga0075432_10505552 3300006058 Bacteria 539
97 Ga0070716_100010629 3300006173 Bacteria 4619
98 Ga0070716_100017049 3300006173 Bacteria 3758
99 Ga0075428_100002845 3300006844 Bacteria 18875
100 Ga0075428_100003389 3300006844 Bacteria 17427
101 Ga0075428_100031336 3300006844 Bacteria 5879
102 Ga0075428_100496555 3300006844 Bacteria 1306
103 Ga0075430_100878277 3300006846 Bacteria 739
104 Ga0075431_100006749 3300006847 Bacteria 11398
105 Ga0075431_100121165 3300006847 Bacteria 2699
106 Ga0075431_100280201 3300006847 Bacteria 1688
107 Ga0075433_10001574 3300006852 Bacteria 16891
108 Ga0075433_10004021 3300006852 Bacteria 11370
109 Ga0075433_10006755 3300006852 Bacteria 9092
110 Ga0075433_10029727 3300006852 Bacteria 4658
111 Ga0075433_10089395 3300006852 Bacteria 2722
112 Ga0075433_10111856 3300006852 Bacteria 2423
113 Ga0075434_100003648 3300006871 Bacteria 13747
114 Ga0075434_100007956 3300006871 Bacteria 9825
115 Ga0075434_100101947 3300006871 Bacteria 2878
116 Ga0075434_100201254 3300006871 Bacteria 2011
117 Ga0075434_100241712 3300006871 Bacteria 1825
118 Ga0075434_100348275 3300006871 Bacteria 1502
119 Ga0075434_101064089 3300006871 Bacteria 822
120 Ga0075429_100000717 3300006880 Bacteria 25956
121 Ga0075429_100009115 3300006880 Bacteria 8612
122 Ga0075429_100111857 3300006880 Bacteria 2387
123 Ga0075436_100006734 3300006914 Bacteria 7865
124 Ga0075436_100015197 3300006914 Bacteria 5274
125 Ga0075436_100016319 3300006914 Bacteria 5084
126 Ga0075436_100026646 3300006914 Bacteria 3980
127 Ga0075436_100032742 3300006914 Bacteria 3583
128 Ga0075436_100055965 3300006914 Bacteria 2724
129 Ga0075436_100070509 3300006914 Unclassified 2416
130 Ga0075436_100082879 3300006914 Bacteria 2225
131 Ga0097620_102555761 3300006931 Bacteria 562
132 Ga0075435_100009731 3300007076 Bacteria 6986
133 Ga0075435_100039218 3300007076 Bacteria 3779
134 Ga0075435_100165541 3300007076 Bacteria 1864
135 Ga0075435_100188575 3300007076 Bacteria 1744
136 Ga0099794_10057191 3300007265 Bacteria 1889
137 Ga0099794_10131039 3300007265 Bacteria 1266
138 Ga0099794_10339862 3300007265 Bacteria 780
139 Ga0099794_10482012 3300007265 Bacteria 652
140 Ga0105240_10125260 3300009093 Bacteria 3088
141 Ga0105240_10388794 3300009093 Bacteria 1574
142 Ga0114129_10000481 3300009147 Bacteria 48108
143 Ga0114129_10091198 3300009147 Bacteria 4223
144 Ga0114129_10291038 3300009147 Bacteria 2180
145 Ga0114129_10405897 3300009147 Bacteria 1795
146 Ga0114129_10962658 3300009147 Bacteria 1077
147 Ga0105243_11859064 3300009148 Bacteria 634
148 Ga0105248_10211964 3300009177 Bacteria 2183
149 Ga0105237_10585554 3300009545 Bacteria 1123
150 Ga0105238_10085140 3300009551 Bacteria 3150
151 Ga0105238_11331554 3300009551 Bacteria 744
152 Ga0105249_10058089 3300009553 Bacteria 3546
153 Ga0105249_11962561 3300009553 Bacteria 658
154 Ga0099796_10274940 3300010159 Unclassified 707
155 Ga0105239_11122393 3300010375 Bacteria 905
156 Ga0105246_11601140 3300011119 Bacteria 615
157 Ga0157373_10334685 3300013100 Bacteria 1078
158 Ga0157371_10251755 3300013102 Bacteria 1272
159 Ga0157370_11881175 3300013104 Bacteria 537
160 Ga0157369_10036674 3300013105 Bacteria 5371
161 Ga0157369_10242336 3300013105 Bacteria 1883
162 Ga0157372_10016136 3300013307 Bacteria 8014
163 Ga0157372_10445717 3300013307 Bacteria 1509
164 Ga0157372_11161252 3300013307 Bacteria 893
165 Ga0163163_12062475 3300014325 Bacteria 630
166 Ga0157380_11947864 3300014326 Unclassified 649
167 Ga0197907_10003569 3300020069 Bacteria 603
168 Ga0206354_10430134 3300020081 Bacteria 565
169 Ga0206354_11064876 3300020081 Bacteria 587
170 Ga0154015_1439404 3300020610 Bacteria 921
171 Ga0224712_10216036 3300022467 Bacteria 876
172 Ga0207656_10011671 3300025321 Bacteria 3324
173 Ga0207653_10004436 3300025885 Bacteria 4399
174 Ga0207653_10032364 3300025885 Bacteria 1691
175 Ga0207692_10448447 3300025898 Bacteria 812
176 Ga0207685_10026866 3300025905 Bacteria 2007
177 Ga0207685_10683448 3300025905 Unclassified 557
178 Ga0207699_10000656 3300025906 Bacteria 16673
179 Ga0207643_10670459 3300025908 Bacteria 670
180 Ga0207684_10023464 3300025910 Bacteria 5267
181 Ga0207684_10029483 3300025910 Bacteria 4672
182 Ga0207684_10034275 3300025910 Bacteria 4314
183 Ga0207684_10097838 3300025910 Bacteria 2506
184 Ga0207684_10202884 3300025910 Bacteria 1711
185 Ga0207684_11073270 3300025910 Bacteria 671
186 Ga0207695_10000259 3300025913 Bacteria 133796
187 Ga0207663_10028928 3300025916 Bacteria 3249
188 Ga0207660_10275142 3300025917 Bacteria 1335
189 Ga0207657_10148572 3300025919 Bacteria 1910
190 Ga0207649_10164880 3300025920 Bacteria 1538
191 Ga0207652_10115269 3300025921 Bacteria 2387
192 Ga0207646_10003214 3300025922 Bacteria 18656
193 Ga0207646_10012366 3300025922 Bacteria 8208
194 Ga0207646_10033110 3300025922 Bacteria 4676
195 Ga0207646_10053778 3300025922 Bacteria 3601
196 Ga0207646_10065044 3300025922 Bacteria 3255
197 Ga0207646_10082834 3300025922 Bacteria 2869
198 Ga0207646_10178668 3300025922 Bacteria 1917
199 Ga0207646_10283437 3300025922 Bacteria 1497
200 Ga0207694_11477079 3300025924 Bacteria 574
201 Ga0207650_11284565 3300025925 Unclassified 623
202 Ga0207659_10527458 3300025926 Bacteria 1002
203 Ga0207665_10011598 3300025939 Bacteria 5790
204 Ga0207665_10379676 3300025939 Unclassified 1072
205 Ga0207691_10585700 3300025940 Bacteria 945
206 Ga0207667_10034813 3300025949 Bacteria 5405
207 Ga0207667_10057232 3300025949 Bacteria 4093
208 Ga0207712_10022932 3300025961 Bacteria 4116
209 Ga0207712_10371744 3300025961 Bacteria 1194
210 Ga0207640_10246658 3300025981 Bacteria 1383
211 Ga0207640_12085986 3300025981 Bacteria 514
212 Ga0207639_10060012 3300026041 Bacteria 2933
213 Ga0207678_10207841 3300026067 Bacteria 1674
214 Ga0207678_11843569 3300026067 Bacteria 529
215 Ga0207708_10755746 3300026075 Bacteria 834
216 Ga0207708_11357957 3300026075 Bacteria 623
217 Ga0207702_10090591 3300026078 Bacteria 2676
218 Ga0207702_10758162 3300026078 Bacteria 958
219 Ga0207641_10619980 3300026088 Bacteria 1060
220 Ga0207641_11505559 3300026088 Bacteria 674
221 Ga0207648_10153037 3300026089 Bacteria 2035
222 Ga0207648_10437450 3300026089 Bacteria 1189
223 Ga0207674_10731783 3300026116 Bacteria 955
224 Ga0207674_11965696 3300026116 Bacteria 550
225 Ga0207698_10299909 3300026142 Bacteria 1495
226 Ga0209970_1105913 3300027614 Bacteria 539
227 Ga0209588_1127540 3300027671 Bacteria 813
228 Ga0207428_10572107 3300027907 Bacteria 816
229 Ga0268265_10150136 3300028380 Bacteria 1964
230 Ga0268264_10570557 3300028381 Bacteria 1112
231 Ga0265338_10047565 3300028800 Bacteria 3916
232 Ga0265316_10785886 3300031344 Unclassified 668
233 Ga0316575_10001650 3300031665 Bacteria 7292
234 Ga0316576_10547357 3300031727 Unclassified 848
235 Ga0316578_10274318 3300031728 Bacteria 1010
236 Ga0316578_10294846 3300031728 Bacteria 970
237 Ga0307413_11614810 3300031824 Unclassified 576
238 Ga0307414_10260562 3300032004 Unclassified 1447
239 Ga0307414_11059124 3300032004 Unclassified 748
240 Ga0307411_11162256 3300032005 Unclassified 698
241 Ga0316583_10341512 3300032133 Bacteria 518
242 Ga0373936_0087218 3300035113 Bacteria 1305
243 Ga0373953_0115507 3300035117 Bacteria 1137
244 Ga0373954_0056138 3300035118 Bacteria 1853
245 Ga0373956_0010131 3300035119 Bacteria 3851
246 Ga0373955_0029660 3300035172 Bacteria 2847
247 Ga0316574_0067134 3300035398 Bacteria 2261
248 Ga0316574_0157141 3300035398 Bacteria 1465
249 Ga0316574_0932592 3300035398 Bacteria 524
250 Ga0373924_0090153 3300035410 Bacteria 1311
251 Ga0373924_0136749 3300035410 Bacteria 1068
252 Ga0373933_0047138 3300035724 Bacteria 2561
253 Ga0373933_0625441 3300035724 Bacteria 707
254 Ga0316582_0076268 3300036647 Bacteria 2180
255 Ga0316582_0685821 3300036647 Bacteria 704
256 Ga0395898_1379043 3300037466 Bacteria 633
257 Ga0316581_0067371 3300037588 Bacteria 1099
258 Ga0395901_0966097 3300038443 Bacteria 830
259 Ga0242420_014006 3300038996 Bacteria 1371
260 Ga0242420_098039 3300038996 Unclassified 621
261 Ga0451795_0265679 3300041456 Bacteria 518
262 Ga0451795_0516805 3300041456 Bacteria 622
263 Ga0451795_1302606 3300041456 Bacteria 557
264 Ga0451837_0378889 3300041494 Bacteria 527
265 Ga0451837_0424127 3300041494 Bacteria 912
266 Ga0439441_134395 3300042001 Bacteria 575
267 Ga0450909_062190 3300042185 Bacteria 591
268 Ga0451577_0299413 3300042876 Bacteria 1457
269 Ga0451577_0484669 3300042876 Bacteria 1123
270 Ga0466969_0019839 3300044656 Bacteria 3487
271 Ga0453683_0520238 3300044673 Bacteria 773
272 Ga0453683_0523518 3300044673 Bacteria 770
273 Ga0453683_1066807 3300044673 Bacteria 538
274 Ga0466966_0007146 3300044684 Bacteria 7399
275 Ga0466966_0263103 3300044684 Bacteria 1038
276 Ga0453684_1428875 3300044712 Bacteria 716
277 Ga0466970_0307642 3300044765 Bacteria 895
278 Ga0451576_0018835 3300045051 Bacteria 7547
279 Ga0451576_0125913 3300045051 Bacteria 2669
280 Ga0451576_0212597 3300045051 Bacteria 2019
281 Ga0451576_0994967 3300045051 Bacteria 879
282 Ga0451576_1888262 3300045051 Unclassified 616
283 Ga0451576_2606197 3300045051 Bacteria 515
284 Ga0495592_0077502 3300046454 Bacteria 2409
285 Ga0495603_0146880 3300046455 Bacteria 1371
286 Ga0495629_0233051 3300046459 Bacteria 1269
287 Ga0495651_0446534 3300046462 Bacteria 836
288 Ga0495580_0533360 3300046472 Bacteria 781
289 Ga0495582_0118589 3300046473 Bacteria 1490
290 Ga0495608_0026689 3300046511 Bacteria 3936
291 Ga0495618_0203804 3300046514 Bacteria 1252
292 Ga0495628_0016750 3300046516 Bacteria 6110
293 Ga0495628_0034486 3300046516 Bacteria 4070
294 Ga0495630_1403263 3300046517 Unclassified 525
295 Ga0495644_0350699 3300046523 Bacteria 581
296 Ga0495663_0014818 3300046525 Unclassified 2190
297 Ga0495642_0035418 3300046528 Unclassified 2014
298 Ga0495652_0124846 3300046529 Bacteria 2047
299 Ga0495640_0808549 3300046533 Bacteria 558
300 Ga0495586_0647823 3300046535 Bacteria 610
301 Ga0495587_0213449 3300046536 Bacteria 1089
302 Ga0495621_0007971 3300046539 Bacteria 3156
303 Ga0495622_0231731 3300046557 Bacteria 816
304 Ga0495667_0093910 3300046559 Bacteria 1942
305 Ga0495635_0203549 3300046663 Bacteria 1342
306 Ga0495635_0653568 3300046663 Bacteria 684
307 Ga0495657_0106248 3300046675 Bacteria 1782
308 Ga0495599_0371001 3300046678 Bacteria 855
309 Ga0495613_1085162 3300046689 Unclassified 511
310 Ga0495600_0128153 3300046809 Bacteria 1650
311 Ga0495604_0118792 3300047317 Bacteria 1916
312 Ga0495636_0673668 3300047318 Bacteria 509
313 Ga0495676_1024040 3300047321 Bacteria 526
314 Ga0495680_0034501 3300047322 Bacteria 4084
315 Ga0495680_0145357 3300047322 Bacteria 1732
316 Ga0495675_0232344 3300047444 Bacteria 1112
317 Ga0495684_0408041 3300047471 Bacteria 952
318 Ga0496126_0000014 3300048929 Bacteria 686881
319 Ga0501323_029026 3300049539 Bacteria 768
320 Ga0501034_0209475 3300049571 Bacteria 1905
321 Ga0501039_0639897 3300049575 Bacteria 833
322 Ga0501072_0539290 3300049588 Bacteria 922
323 Ga0501074_0663781 3300049590 Bacteria 736
324 Ga0501076_1224432 3300049592 Bacteria 618
325 Ga0501077_0335762 3300049593 Bacteria 964
326 Ga0501079_0591236 3300049741 Bacteria 873
327 Ga0501081_0430619 3300049743 Bacteria 979
328 nmdc:mga05p37_1205251_c1 3300050507 Bacteria 782
329 nmdc:mga05p37_1379635_c1 3300050507 Bacteria 712
330 nmdc:mga05p37_17723_c1 3300050507 Bacteria 8592
331 nmdc:mga05p37_213170_c1 3300050507 Bacteria 2333
332 nmdc:mga05p37_218369_c1 3300050507 Bacteria 2302
333 nmdc:mga05p37_576_c1 3300050507 Bacteria 40317
334 nmdc:mga09592_24364_c1 3300050508 Bacteria 5004
335 nmdc:mga09592_406_c1 3300050508 Bacteria 31601
336 nmdc:mga09592_8179_c1 3300050508 Bacteria 8503
337 nmdc:mga0qj67_1045263_c1 3300050509 Bacteria 639
338 nmdc:mga0qj67_274930_c1 3300050509 Bacteria 1365
339 nmdc:mga06r32_247744_c1 3300050510 Bacteria 1769
340 nmdc:mga06r32_4353_c1 3300050510 Bacteria 12668
341 nmdc:mga06r32_803890_c1 3300050510 Bacteria 901
342 nmdc:mga06r32_806279_c1 3300050510 Bacteria 899
343 nmdc:mga08y16_440344_c1 3300050511 Bacteria 1330
344 nmdc:mga0n895_10433_c1 3300050512 Bacteria 8206
345 nmdc:mga0n895_1087297_c1 3300050512 Bacteria 778
346 nmdc:mga0n895_209690_c1 3300050512 Bacteria 1979
347 nmdc:mga0n895_2200620_c1 3300050512 Unclassified 507
348 nmdc:mga0n895_3757_c1 3300050512 Bacteria 12285
349 nmdc:mga0n895_68266_c1 3300050512 Bacteria 3522
350 nmdc:mga0rr50_171653_c1 3300050513 Bacteria 1767
351 nmdc:mga0rr50_20205_c1 3300050513 Bacteria 4515
352 nmdc:mga0rr50_5797_c1 3300050513 Bacteria 7419
353 nmdc:mga0rr50_88084_c1 3300050513 Bacteria 2411
354 nmdc:mga08x19_344526_c1 3300050514 Bacteria 1040
355 nmdc:mga08x19_36964_c1 3300050514 Bacteria 3096
356 nmdc:mga08x19_5748_c1 3300050514 Bacteria 7336
357 nmdc:mga08x19_88204_c1 3300050514 Bacteria 2045
358 nmdc:mga0a205_1089163_c1 3300050515 Bacteria 646
359 nmdc:mga0a205_13733_c1 3300050515 Bacteria 7547
360 nmdc:mga0a205_157082_c1 3300050515 Bacteria 2173
361 nmdc:mga0a205_230234_c1 3300050515 Bacteria 1737
362 nmdc:mga0a205_49361_c1 3300050515 Bacteria 3132
363 nmdc:mga0a205_681037_c1 3300050515 Bacteria 879
364 nmdc:mga0a205_957920_c1 3300050515 Bacteria 703
365 Ga0495595_0061288 3300053084 Bacteria 1761
366 Ga0495595_0516707 3300053084 Unclassified 609
367 Ga0495619_0229191 3300053085 Bacteria 1287
368 Ga0495619_0376029 3300053085 Bacteria 982
369 Ga0501084_0464439 3300054114 Bacteria 1070
370 Ga0587068_147285 3300059641 Bacteria 530
371 Ga0501082_0715750 3300060353 Bacteria 876
372 Ga0373923_0487390
373 Ga0058863_11890639
374 Ga0065704_10230832
375 Ga0070658_10004447
376 Ga0070670_101909605
377 Ga0070680_100208324
378 Ga0070660_100582506
379 Ga0070689_102143476
380 Ga0070691_10612601
381 Ga0070661_100018166
382 Ga0070668_100132758
383 Ga0070675_100341267
384 Ga0070688_100603071
385 Ga0070659_101039578
386 Ga0070703_10006643
387 Ga0070703_10041069
388 Ga0070709_10000532
389 Ga0070713_100040644
390 Ga0070710_10112703
391 Ga0070711_100000119
392 Ga0070705_100002222
393 Ga0070705_100303799
394 Ga0070705_100601696
395 Ga0070705_101618470
396 Ga0070700_100385700
397 Ga0070694_100024237
398 Ga0070694_100048533
399 Ga0070694_100059033
400 Ga0070708_100003612
401 Ga0070708_100025394
402 Ga0070708_100036517
403 Ga0070708_100199841
404 Ga0070708_100203544
405 Ga0070663_100527126
406 Ga0068867_101107815
407 Ga0068867_101109377
408 Ga0070685_11283969
409 Ga0070706_100048087
410 Ga0070706_100101268
411 Ga0070706_100111369
412 Ga0070706_100138790
413 Ga0070706_100222211
414 Ga0070706_101363720
415 Ga0070707_100005300
416 Ga0070707_100011042
417 Ga0070707_100054351
418 Ga0070707_100113981
419 Ga0070707_100117565
420 Ga0070707_100134556
421 Ga0070707_100382405
422 Ga0070707_100773906
423 Ga0070698_100000232
424 Ga0070698_100021843
425 Ga0070698_100202352
426 Ga0070698_100225892
427 Ga0070699_100000787
428 Ga0070699_100048061
429 Ga0070699_100067693
430 Ga0070699_100087032
431 Ga0070699_100159694
432 Ga0070699_100617363
433 Ga0070699_101987607
434 Ga0070679_100037580
435 Ga0070697_100015903
436 Ga0070697_100054041
437 Ga0070697_100086284
438 Ga0070697_100196501
439 Ga0070697_100342199
440 Ga0070697_100525846
441 Ga0070697_100731304
442 Ga0070697_100919390
443 Ga0068853_100011418
444 Ga0070695_100010677
445 Ga0070695_101039072
446 Ga0070696_100050267
447 Ga0070696_100369216
448 Ga0070696_100411653
449 Ga0070665_100776423
450 Ga0070704_100005777
451 Ga0070704_100619459
452 Ga0070704_101260628
453 Ga0068855_100034492
454 Ga0068854_100193192
455 Ga0068856_100146898
456 Ga0068856_100244291
457 Ga0070702_101640450
458 Ga0068852_100097419
459 Ga0068859_102554248
460 Ga0068864_100680311
461 Ga0068851_10009714
462 Ga0068863_100026714
463 Ga0068863_101403982
464 Ga0068860_100570926
465 Ga0068862_101188396
466 Ga0075432_10058978
467 Ga0075432_10505552
468 Ga0070716_100010629
469 Ga0070716_100017049
470 Ga0075428_100002845
471 Ga0075428_100003389
472 Ga0075428_100031336
473 Ga0075428_100496555
474 Ga0075430_100878277
475 Ga0075431_100006749
476 Ga0075431_100121165
477 Ga0075431_100280201
478 Ga0075433_10001574
479 Ga0075433_10004021
480 Ga0075433_10006755
481 Ga0075433_10029727
482 Ga0075433_10089395
483 Ga0075433_10111856
484 Ga0075434_100003648
485 Ga0075434_100007956
486 Ga0075434_100101947
487 Ga0075434_100201254
488 Ga0075434_100241712
489 Ga0075434_100348275
490 Ga0075434_101064089
491 Ga0075429_100000717
492 Ga0075429_100009115
493 Ga0075429_100111857
494 Ga0075436_100006734
495 Ga0075436_100015197
496 Ga0075436_100016319
497 Ga0075436_100026646
498 Ga0075436_100032742
499 Ga0075436_100055965
500 Ga0075436_100070509
501 Ga0075436_100082879
502 Ga0097620_102555761
503 Ga0075435_100009731
504 Ga0075435_100039218
505 Ga0075435_100165541
506 Ga0075435_100188575
507 Ga0099794_10057191
508 Ga0099794_10131039
509 Ga0099794_10339862
510 Ga0099794_10482012
511 Ga0105240_10125260
512 Ga0105240_10388794
513 Ga0114129_10000481
514 Ga0114129_10091198
515 Ga0114129_10291038
516 Ga0114129_10405897
517 Ga0114129_10962658
518 Ga0105243_11859064
519 Ga0105248_10211964
520 Ga0105237_10585554
521 Ga0105238_10085140
522 Ga0105238_11331554
523 Ga0105249_10058089
524 Ga0105249_11962561
525 Ga0099796_10274940
526 Ga0105239_11122393
527 Ga0105246_11601140
528 Ga0157373_10334685
529 Ga0157371_10251755
530 Ga0157370_11881175
531 Ga0157369_10036674
532 Ga0157369_10242336
533 Ga0157372_10016136
534 Ga0157372_10445717
535 Ga0157372_11161252
536 Ga0163163_12062475
537 Ga0157380_11947864
538 Ga0197907_10003569
539 Ga0206354_10430134
540 Ga0206354_11064876
541 Ga0154015_1439404
542 Ga0224712_10216036
543 Ga0207656_10011671
544 Ga0207653_10004436
545 Ga0207653_10032364
546 Ga0207692_10448447
547 Ga0207685_10026866
548 Ga0207685_10683448
549 Ga0207699_10000656
550 Ga0207643_10670459
551 Ga0207684_10023464
552 Ga0207684_10029483
553 Ga0207684_10034275
554 Ga0207684_10097838
555 Ga0207684_10202884
556 Ga0207684_11073270
557 Ga0207695_10000259
558 Ga0207663_10028928
559 Ga0207660_10275142
560 Ga0207657_10148572
561 Ga0207649_10164880
562 Ga0207652_10115269
563 Ga0207646_10003214
564 Ga0207646_10012366
565 Ga0207646_10033110
566 Ga0207646_10053778
567 Ga0207646_10065044
568 Ga0207646_10082834
569 Ga0207646_10178668
570 Ga0207646_10283437
571 Ga0207694_11477079
572 Ga0207650_11284565
573 Ga0207659_10527458
574 Ga0207665_10011598
575 Ga0207665_10379676
576 Ga0207691_10585700
577 Ga0207667_10034813
578 Ga0207667_10057232
579 Ga0207712_10022932
580 Ga0207712_10371744
581 Ga0207640_10246658
582 Ga0207640_12085986
583 Ga0207639_10060012
584 Ga0207678_10207841
585 Ga0207678_11843569
586 Ga0207708_10755746
587 Ga0207708_11357957
588 Ga0207702_10090591
589 Ga0207702_10758162
590 Ga0207641_10619980
591 Ga0207641_11505559
592 Ga0207648_10153037
593 Ga0207648_10437450
594 Ga0207674_10731783
595 Ga0207674_11965696
596 Ga0207698_10299909
597 Ga0209970_1105913
598 Ga0209588_1127540
599 Ga0207428_10572107
600 Ga0268265_10150136
601 Ga0268264_10570557
602 Ga0265338_10047565
603 Ga0265316_10785886
604 Ga0316575_10001650
605 Ga0316576_10547357
606 Ga0316578_10274318
607 Ga0316578_10294846
608 Ga0307413_11614810
609 Ga0307414_10260562
610 Ga0307414_11059124
611 Ga0307411_11162256
612 Ga0316583_10341512
613 Ga0373936_0087218
614 Ga0373953_0115507
615 Ga0373954_0056138
616 Ga0373956_0010131
617 Ga0373955_0029660
618 Ga0316574_0067134
619 Ga0316574_0157141
620 Ga0316574_0932592
621 Ga0373924_0090153
622 Ga0373924_0136749
623 Ga0373933_0047138
624 Ga0373933_0625441
625 Ga0316582_0076268
626 Ga0316582_0685821
627 Ga0395898_1379043
628 Ga0316581_0067371
629 Ga0395901_0966097
630 Ga0242420_014006
631 Ga0242420_098039
632 Ga0451795_0265679
633 Ga0451795_0516805
634 Ga0451795_1302606
635 Ga0451837_0378889
636 Ga0451837_0424127
637 Ga0439441_134395
638 Ga0450909_062190
639 Ga0451577_0299413
640 Ga0451577_0484669
641 Ga0466969_0019839
642 Ga0453683_0520238
643 Ga0453683_0523518
644 Ga0453683_1066807
645 Ga0466966_0007146
646 Ga0466966_0263103
647 Ga0453684_1428875
648 Ga0466970_0307642
649 Ga0451576_0018835
650 Ga0451576_0125913
651 Ga0451576_0212597
652 Ga0451576_0994967
653 Ga0451576_1888262
654 Ga0451576_2606197
655 Ga0495592_0077502
656 Ga0495603_0146880
657 Ga0495629_0233051
658 Ga0495651_0446534
659 Ga0495580_0533360
660 Ga0495582_0118589
661 Ga0495608_0026689
662 Ga0495618_0203804
663 Ga0495628_0016750
664 Ga0495628_0034486
665 Ga0495630_1403263
666 Ga0495644_0350699
667 Ga0495663_0014818
668 Ga0495642_0035418
669 Ga0495652_0124846
670 Ga0495640_0808549
671 Ga0495586_0647823
672 Ga0495587_0213449
673 Ga0495621_0007971
674 Ga0495622_0231731
675 Ga0495667_0093910
676 Ga0495635_0203549
677 Ga0495635_0653568
678 Ga0495657_0106248
679 Ga0495599_0371001
680 Ga0495613_1085162
681 Ga0495600_0128153
682 Ga0495604_0118792
683 Ga0495636_0673668
684 Ga0495676_1024040
685 Ga0495680_0034501
686 Ga0495680_0145357
687 Ga0495675_0232344
688 Ga0495684_0408041
689 Ga0496126_0000014
690 Ga0501323_029026
691 Ga0501034_0209475
692 Ga0501039_0639897
693 Ga0501072_0539290
694 Ga0501074_0663781
695 Ga0501076_1224432
696 Ga0501077_0335762
697 Ga0501079_0591236
698 Ga0501081_0430619
699 nmdc:mga05p37_1205251_c1
700 nmdc:mga05p37_1379635_c1
701 nmdc:mga05p37_17723_c1
702 nmdc:mga05p37_213170_c1
703 nmdc:mga05p37_218369_c1
704 nmdc:mga05p37_576_c1
705 nmdc:mga09592_24364_c1
706 nmdc:mga09592_406_c1
707 nmdc:mga09592_8179_c1
708 nmdc:mga0qj67_1045263_c1
709 nmdc:mga0qj67_274930_c1
710 nmdc:mga06r32_247744_c1
711 nmdc:mga06r32_4353_c1
712 nmdc:mga06r32_803890_c1
713 nmdc:mga06r32_806279_c1
714 nmdc:mga08y16_440344_c1
715 nmdc:mga0n895_10433_c1
716 nmdc:mga0n895_1087297_c1
717 nmdc:mga0n895_209690_c1
718 nmdc:mga0n895_2200620_c1
719 nmdc:mga0n895_3757_c1
720 nmdc:mga0n895_68266_c1
721 nmdc:mga0rr50_171653_c1
722 nmdc:mga0rr50_20205_c1
723 nmdc:mga0rr50_5797_c1
724 nmdc:mga0rr50_88084_c1
725 nmdc:mga08x19_344526_c1
726 nmdc:mga08x19_36964_c1
727 nmdc:mga08x19_5748_c1
728 nmdc:mga08x19_88204_c1
729 nmdc:mga0a205_1089163_c1
730 nmdc:mga0a205_13733_c1
731 nmdc:mga0a205_157082_c1
732 nmdc:mga0a205_230234_c1
733 nmdc:mga0a205_49361_c1
734 nmdc:mga0a205_681037_c1
735 nmdc:mga0a205_957920_c1
736 Ga0495595_0061288
737 Ga0495595_0516707
738 Ga0495619_0229191
739 Ga0495619_0376029
740 Ga0501084_0464439
741 Ga0587068_147285
742 Ga0501082_0715750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01197

Ribosomal_L31

Ribosomal protein L31

1

71

0.98

Map