F425667

General Info

Members Datasets Scaffolds Average Seq Length
371 247 358 146

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101070779|Ga0070708_1010707791
Length 163
Sequence MNDHKLPYLKKPVAILVLNGPNLNTLGTREPTIYGRVTLPQIYEMLQKRGAELEAKVECFQSNHEGVLIDYLQEHAGRADGIIINPGALTHYSIALRDALAAVAAPIIEVHLSNIYAREPFRHHSVIAAICRGHIVGLGWRGYLLALEALVELAREDNKEGNK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
5 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
6 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
7 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
8 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
9 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
10 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
11 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
12 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
13 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
14 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
15 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
16 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
17 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
177 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
178 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
181 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
184 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
185 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
189 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
190 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
223 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
238 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
244 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
245 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.34
Metatranscriptomes 2.16
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 1.35
Bulb 0
Endosphere 11.32
Nodule 0
Rhizoplane 0.54
Rhizosphere 83.56
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_202295 2162886007 Bacteria 1110
2 MBSR1b_contig_11328778 2162886012 Bacteria 820
3 MBSR1b_contig_1636348 2162886012 Bacteria 824
4 ARcpr5yngRDRAFT_c004755 3300000043 Bacteria 1271
5 JGI24746J21847_1003346 3300001977 Bacteria 2521
6 JGI24750J21931_1037151 3300002070 Bacteria 731
7 JGI24749J21850_1003641 3300002076 Bacteria 2151
8 JGI24035J26624_1026298 3300002126 Bacteria 626
9 JGI25153J46596_10051638 3300003215 Bacteria 1176
10 Ga0055537_1004078 3300003773 Bacteria 4280
11 Ga0055524_1000539 3300003775 Bacteria 28724
12 Ga0055530_10001987 3300003791 Bacteria 13891
13 Ga0055530_10042529 3300003791 Bacteria 1101
14 Ga0055531_10000525 3300003794 Bacteria 34457
15 Ga0055531_10004340 3300003794 Bacteria 8670
16 Ga0055531_10043445 3300003794 Bacteria 1271
17 Ga0055531_10074164 3300003794 Bacteria 773
18 Ga0058861_10915281 3300004800 Unclassified 1066
19 Ga0065165_1008458 3300005262 Bacteria 4809
20 Ga0065165_1013400 3300005262 Bacteria 3262
21 Ga0065704_10110565 3300005289 Bacteria 1977
22 Ga0065715_10060753 3300005293 Bacteria 717
23 Ga0065715_10098696 3300005293 Bacteria 3509
24 Ga0065715_10336412 3300005293 Bacteria 974
25 Ga0065715_10799051 3300005293 Bacteria 611
26 Ga0065707_10090604 3300005295 Bacteria 4108
27 Ga0070658_10000086 3300005327 Bacteria 86563
28 Ga0070676_10034103 3300005328 Bacteria 2922
29 Ga0070690_100540335 3300005330 Bacteria 877
30 Ga0070670_100037740 3300005331 Bacteria 4155
31 Ga0070670_100191975 3300005331 Bacteria 1774
32 Ga0070677_10011147 3300005333 Bacteria 3092
33 Ga0068869_100241237 3300005334 Bacteria 1440
34 Ga0068868_100761080 3300005338 Bacteria 871
35 Ga0070660_100000197 3300005339 Bacteria 40265
36 Ga0070689_100172077 3300005340 Bacteria 1755
37 Ga0070691_10799045 3300005341 Bacteria 574
38 Ga0070687_100160891 3300005343 Bacteria 1327
39 Ga0070687_100184519 3300005343 Bacteria 1252
40 Ga0070668_100033686 3300005347 Bacteria 3902
41 Ga0070668_100270558 3300005347 Bacteria 1416
42 Ga0070669_100005949 3300005353 Bacteria 8802
43 Ga0070669_100171693 3300005353 Bacteria 1691
44 Ga0070675_100007930 3300005354 Bacteria 8231
45 Ga0070675_102093040 3300005354 Bacteria 522
46 Ga0070671_100014372 3300005355 Bacteria 6395
47 Ga0070674_100074175 3300005356 Bacteria 2414
48 Ga0070674_101810461 3300005356 Bacteria 554
49 Ga0070673_100035265 3300005364 Bacteria 3792
50 Ga0070659_100005647 3300005366 Bacteria 8993
51 Ga0070667_100102095 3300005367 Bacteria 2478
52 Ga0070667_101899183 3300005367 Bacteria 561
53 Ga0070701_10327077 3300005438 Bacteria 950
54 Ga0070705_100095846 3300005440 Bacteria 1861
55 Ga0070700_101369953 3300005441 Bacteria 597
56 Ga0070708_101070779 3300005445 Bacteria 755
57 Ga0070708_101290978 3300005445 Bacteria 682
58 Ga0070663_100053602 3300005455 Bacteria 2880
59 Ga0070678_100053208 3300005456 Bacteria 2943
60 Ga0070678_102086428 3300005456 Bacteria 537
61 Ga0070662_100029506 3300005457 Bacteria 3828
62 Ga0070681_10125731 3300005458 Unclassified 2497
63 Ga0070685_10355371 3300005466 Bacteria 1003
64 Ga0070707_100046758 3300005468 Unclassified 4142
65 Ga0070698_100273981 3300005471 Bacteria 1619
66 Ga0070698_101077913 3300005471 Unclassified 752
67 Ga0070679_100297299 3300005530 Unclassified 1565
68 Ga0070679_100796969 3300005530 Bacteria 888
69 Ga0068853_100563811 3300005539 Bacteria 1080
70 Ga0068853_100713906 3300005539 Bacteria 957
71 Ga0070672_100027525 3300005543 Bacteria 4241
72 Ga0070672_100050341 3300005543 Bacteria 3243
73 Ga0070672_100400089 3300005543 Bacteria 1177
74 Ga0070686_100163792 3300005544 Bacteria 1568
75 Ga0070696_100968215 3300005546 Bacteria 709
76 Ga0070665_100392739 3300005548 Bacteria 1395
77 Ga0070665_100987533 3300005548 Bacteria 854
78 Ga0070664_100091870 3300005564 Bacteria 2628
79 Ga0070664_100703531 3300005564 Bacteria 941
80 Ga0068857_100238918 3300005577 Bacteria 1663
81 Ga0068859_100122393 3300005617 Bacteria 2669
82 Ga0068866_10317201 3300005718 Bacteria 979
83 Ga0068863_101395577 3300005841 Bacteria 708
84 Ga0068858_100001357 3300005842 Bacteria 25195
85 Ga0068860_100025002 3300005843 Bacteria 5766
86 Ga0068860_100269343 3300005843 Bacteria 1662
87 Ga0068862_100182383 3300005844 Bacteria 1885
88 Ga0068862_100372527 3300005844 Bacteria 1330
89 Ga0068862_101541173 3300005844 Bacteria 671
90 Ga0070717_10281265 3300006028 Unclassified 1476
91 Ga0075366_10028344 3300006195 Bacteria 3287
92 Ga0075366_10242466 3300006195 Bacteria 1099
93 Ga0097621_100388789 3300006237 Bacteria 1247
94 Ga0097621_100621239 3300006237 Bacteria 989
95 Ga0075370_10033548 3300006353 Bacteria 2875
96 Ga0075431_100018381 3300006847 Bacteria 7119
97 Ga0068865_101084021 3300006881 Bacteria 705
98 Ga0097620_100122395 3300006931 Bacteria 2669
99 Ga0111539_10067729 3300009094 Bacteria 4215
100 Ga0105245_10014507 3300009098 Bacteria 6862
101 Ga0105243_10251350 3300009148 Bacteria 1578
102 Ga0105248_10560781 3300009177 Bacteria 1289
103 Ga0105238_10017288 3300009551 Bacteria 7327
104 Ga0105238_10615197 3300009551 Bacteria 1095
105 Ga0105238_12456999 3300009551 Bacteria 557
106 Ga0105249_10056947 3300009553 Bacteria 3579
107 Ga0105249_10341575 3300009553 Bacteria 1514
108 Ga0105239_11434726 3300010375 Bacteria 797
109 Ga0105246_10829423 3300011119 Bacteria 823
110 Ga0157373_10383293 3300013100 Bacteria 1006
111 Ga0157369_10073192 3300013105 Bacteria 3677
112 Ga0157378_10042046 3300013297 Bacteria 4055
113 Ga0163162_10429869 3300013306 Bacteria 1453
114 Ga0157372_10212259 3300013307 Bacteria 2243
115 Ga0157380_10034780 3300014326 Bacteria 3889
116 Ga0157380_10132055 3300014326 Bacteria 2132
117 Ga0157380_10357186 3300014326 Bacteria 1369
118 Ga0157380_10370066 3300014326 Bacteria 1348
119 Ga0163161_10010979 3300017792 Bacteria 6275
120 Ga0163161_10891388 3300017792 Bacteria 753
121 Ga0197907_10413886 3300020069 Unclassified 1175
122 Ga0206355_1148942 3300020076 Unclassified 904
123 Ga0206350_10329018 3300020080 Bacteria 1270
124 Ga0206350_10426361 3300020080 Unclassified 3417
125 Ga0206353_11836939 3300020082 Unclassified 808
126 Ga0154015_1689851 3300020610 Unclassified 2995
127 Ga0224712_10010556 3300022467 Unclassified 2830
128 Ga0207425_1019078 3300025245 Bacteria 1481
129 Ga0209565_1000008 3300025263 Bacteria 774179
130 Ga0209673_1001779 3300025273 Bacteria 17881
131 Ga0209675_1005932 3300025291 Bacteria 5009
132 Ga0209758_1012098 3300025297 Bacteria 4880
133 Ga0209050_1000581 3300025298 Bacteria 59224
134 Ga0209050_1023516 3300025298 Bacteria 2165
135 Ga0209256_1000009 3300025299 Bacteria 922071
136 Ga0209256_1000010 3300025299 Bacteria 912110
137 Ga0207426_1070686 3300025302 Bacteria 974
138 Ga0209257_1000577 3300025304 Bacteria 61710
139 Ga0209257_1000597 3300025304 Bacteria 59900
140 Ga0209257_1004324 3300025304 Bacteria 11140
141 Ga0209257_1024886 3300025304 Bacteria 2060
142 Ga0209257_1087928 3300025304 Bacteria 782
143 Ga0207697_10003268 3300025315 Bacteria 8054
144 Ga0207682_10003307 3300025893 Bacteria 7039
145 Ga0207688_10053858 3300025901 Bacteria 2256
146 Ga0207647_10199894 3300025904 Bacteria 1157
147 Ga0207645_10029243 3300025907 Bacteria 3553
148 Ga0207705_10000002 3300025909 Bacteria 2046852
149 Ga0207684_10154633 3300025910 Bacteria 1974
150 Ga0207707_10328403 3300025912 Bacteria 1320
151 Ga0207657_10001791 3300025919 Bacteria 23171
152 Ga0207652_10141760 3300025921 Bacteria 2149
153 Ga0207652_10605802 3300025921 Bacteria 982
154 Ga0207646_10063168 3300025922 Bacteria 3306
155 Ga0207681_10135036 3300025923 Bacteria 1829
156 Ga0207694_10025475 3300025924 Bacteria 4497
157 Ga0207650_10004984 3300025925 Bacteria 9070
158 Ga0207650_10011042 3300025925 Bacteria 6210
159 Ga0207650_10146191 3300025925 Bacteria 1862
160 Ga0207650_10247445 3300025925 Bacteria 1442
161 Ga0207659_10022864 3300025926 Bacteria 4168
162 Ga0207687_10086478 3300025927 Bacteria 2276
163 Ga0207644_10016228 3300025931 Bacteria 5011
164 Ga0207690_10005539 3300025932 Bacteria 7453
165 Ga0207706_10001074 3300025933 Bacteria 27768
166 Ga0207709_10332360 3300025935 Bacteria 1141
167 Ga0207669_10003870 3300025937 Bacteria 6529
168 Ga0207691_10012198 3300025940 Bacteria 8237
169 Ga0207691_10656259 3300025940 Bacteria 886
170 Ga0207711_10486447 3300025941 Bacteria 1150
171 Ga0207689_10090635 3300025942 Bacteria 2512
172 Ga0207689_10332098 3300025942 Bacteria 1262
173 Ga0207661_10695833 3300025944 Unclassified 935
174 Ga0207679_10011476 3300025945 Bacteria 5743
175 Ga0207651_10029927 3300025960 Bacteria 3459
176 Ga0207712_10034943 3300025961 Bacteria 3410
177 Ga0207712_10286940 3300025961 Bacteria 1345
178 Ga0207668_10008146 3300025972 Bacteria 6237
179 Ga0207668_10131097 3300025972 Bacteria 1914
180 Ga0207668_10352944 3300025972 Bacteria 1230
181 Ga0207658_10071163 3300025986 Bacteria 2633
182 Ga0207658_10327456 3300025986 Bacteria 1328
183 Ga0207658_11153673 3300025986 Bacteria 708
184 Ga0207703_10000775 3300026035 Bacteria 31437
185 Ga0207639_10027877 3300026041 Bacteria 4118
186 Ga0207639_10824410 3300026041 Bacteria 865
187 Ga0207678_10018861 3300026067 Bacteria 6060
188 Ga0207641_10974412 3300026088 Bacteria 844
189 Ga0207648_10031394 3300026089 Bacteria 4697
190 Ga0207676_10111666 3300026095 Bacteria 2288
191 Ga0207674_10250128 3300026116 Bacteria 1720
192 Ga0207674_10517100 3300026116 Bacteria 1153
193 Ga0207675_100019373 3300026118 Bacteria 6349
194 Ga0207683_10008146 3300026121 Bacteria 8965
195 Ga0207683_10071191 3300026121 Bacteria 3073
196 Ga0209968_1032773 3300027526 Bacteria 872
197 Ga0209982_1012752 3300027552 Bacteria 1263
198 Ga0207428_10573672 3300027907 Bacteria 814
199 Ga0268266_10494466 3300028379 Bacteria 1167
200 Ga0268266_11542656 3300028379 Bacteria 640
201 Ga0268265_10033998 3300028380 Bacteria 3712
202 Ga0268265_10096128 3300028380 Bacteria 2380
203 Ga0268265_10107564 3300028380 Bacteria 2268
204 Ga0268264_10014949 3300028381 Bacteria 6372
205 Ga0268264_10285301 3300028381 Bacteria 1548
206 Ga0268264_11754997 3300028381 Bacteria 631
207 Ga0307517_10160099 3300028786 Bacteria 1514
208 Ga0316178_1001738 3300030735 Bacteria 623
209 Ga0307408_100379006 3300031548 Bacteria 1209
210 Ga0307408_100577198 3300031548 Bacteria 996
211 Ga0307408_100874148 3300031548 Bacteria 821
212 Ga0307408_101364492 3300031548 Bacteria 666
213 Ga0307405_10046107 3300031731 Bacteria 2676
214 Ga0307405_10082987 3300031731 Bacteria 2099
215 Ga0307405_10465232 3300031731 Bacteria 1006
216 Ga0307413_10129372 3300031824 Bacteria 1725
217 Ga0307413_10153842 3300031824 Bacteria 1606
218 Ga0307413_10254172 3300031824 Bacteria 1306
219 Ga0307413_10404723 3300031824 Bacteria 1070
220 Ga0307413_11192441 3300031824 Bacteria 662
221 Ga0307413_11422597 3300031824 Bacteria 610
222 Ga0307410_10063336 3300031852 Bacteria 2536
223 Ga0307410_10131285 3300031852 Bacteria 1840
224 Ga0307410_10149715 3300031852 Bacteria 1736
225 Ga0307410_11019102 3300031852 Bacteria 715
226 Ga0307406_10375608 3300031901 Bacteria 1119
227 Ga0307406_10486966 3300031901 Bacteria 997
228 Ga0307406_11485610 3300031901 Bacteria 596
229 Ga0307407_10139163 3300031903 Bacteria 1564
230 Ga0307407_10155057 3300031903 Bacteria 1492
231 Ga0307412_10001867 3300031911 Bacteria 11649
232 Ga0307412_10101568 3300031911 Bacteria 2035
233 Ga0307412_10122654 3300031911 Bacteria 1874
234 Ga0307412_10143836 3300031911 Bacteria 1750
235 Ga0307412_10175952 3300031911 Bacteria 1604
236 Ga0307412_10259993 3300031911 Bacteria 1353
237 Ga0307412_10583431 3300031911 Bacteria 944
238 Ga0307412_10606203 3300031911 Bacteria 928
239 Ga0307409_100181209 3300031995 Bacteria 1865
240 Ga0307409_100626947 3300031995 Bacteria 1066
241 Ga0307409_101601614 3300031995 Bacteria 679
242 Ga0307416_100194445 3300032002 Bacteria 1917
243 Ga0307416_100981322 3300032002 Bacteria 947
244 Ga0307416_101110806 3300032002 Bacteria 895
245 Ga0307414_10023542 3300032004 Bacteria 3908
246 Ga0307414_10077226 3300032004 Bacteria 2423
247 Ga0307414_10107001 3300032004 Bacteria 2118
248 Ga0307414_10116444 3300032004 Bacteria 2046
249 Ga0307414_10154967 3300032004 Bacteria 1812
250 Ga0307414_10188602 3300032004 Bacteria 1666
251 Ga0307414_11037869 3300032004 Bacteria 755
252 Ga0307414_11593074 3300032004 Bacteria 608
253 Ga0307411_10018008 3300032005 Bacteria 4043
254 Ga0307411_10073515 3300032005 Bacteria 2326
255 Ga0307411_10082529 3300032005 Bacteria 2217
256 Ga0307411_10158946 3300032005 Bacteria 1689
257 Ga0307411_10189653 3300032005 Bacteria 1568
258 Ga0307411_10402898 3300032005 Bacteria 1131
259 Ga0307411_10481161 3300032005 Bacteria 1045
260 Ga0307411_11060309 3300032005 Bacteria 728
261 Ga0307415_100272058 3300032126 Bacteria 1388
262 Ga0307415_100639642 3300032126 Bacteria 952
263 Ga0307415_101172906 3300032126 Bacteria 722
264 Ga0307415_101949723 3300032126 Bacteria 571
265 Ga0395900_0034392 3300037418 Bacteria 5218
266 Ga0395905_0000365 3300037471 Bacteria 64175
267 Ga0395905_1325088 3300037471 Bacteria 624
268 Ga0395901_0028381 3300038443 Bacteria 5754
269 Ga0436363_0419119 3300039450 Bacteria 2416
270 Ga0436362_0223526 3300039453 Unclassified 738
271 Ga0436362_0312687 3300039453 Bacteria 678
272 Ga0439436_0161259 3300041404 Bacteria 634
273 Ga0439453_0079760 3300041408 Bacteria 704
274 Ga0439453_0142650 3300041408 Bacteria 564
275 Ga0439461_0000448 3300041410 Bacteria 5948
276 Ga0439465_0001576 3300041413 Bacteria 7413
277 Ga0451837_1191648 3300041494 Bacteria 571
278 Ga0451841_0840733 3300041498 Bacteria 1072
279 Ga0439431_0000497 3300041997 Bacteria 8314
280 Ga0439437_019865 3300042000 Bacteria 809
281 Ga0439442_089388 3300042002 Bacteria 662
282 Ga0439445_0000081 3300042004 Bacteria 14728
283 Ga0439445_0002399 3300042004 Bacteria 4171
284 Ga0439445_0025536 3300042004 Bacteria 1507
285 Ga0439432_001134 3300042006 Bacteria 10109
286 Ga0439449_0055563 3300042007 Bacteria 1462
287 Ga0439450_048357 3300042008 Bacteria 1004
288 Ga0439462_0005356 3300042015 Bacteria 3160
289 Ga0439462_0082878 3300042015 Bacteria 877
290 Ga0450919_024577 3300042121 Bacteria 683
291 Ga0439446_0045223 3300042156 Bacteria 1304
292 Ga0439434_0001904 3300042435 Bacteria 6055
293 Ga0439434_0012571 3300042435 Bacteria 2505
294 Ga0439434_0185108 3300042435 Bacteria 698
295 Ga0439435_0218186 3300042436 Bacteria 634
296 Ga0439464_0016218 3300042439 Bacteria 2013
297 Ga0439464_0024798 3300042439 Bacteria 1658
298 Ga0451577_1927077 3300042876 Bacteria 517
299 Ga0466963_0284598 3300044694 Unclassified 1162
300 Ga0466968_0387480 3300044735 Bacteria 683
301 Ga0466957_0046705 3300044842 Bacteria 2630
302 Ga0466967_0375387 3300045976 Unclassified 1380
303 Ga0495663_0005798 3300046525 Bacteria 3418
304 Ga0495663_0166405 3300046525 Bacteria 758
305 Ga0495642_0203087 3300046528 Bacteria 864
306 Ga0495598_0031015 3300046537 Bacteria 1502
307 Ga0495633_0055535 3300046558 Bacteria 1862
308 Ga0495668_0098902 3300046616 Bacteria 1596
309 Ga0495625_0000629 3300046660 Bacteria 51047
310 Ga0495670_0000002 3300046691 Bacteria 601814
311 Ga0495670_0107586 3300046691 Bacteria 1441
312 Ga0495670_0717001 3300046691 Bacteria 545
313 Ga0495670_0818897 3300046691 Bacteria 508
314 Ga0495677_0065169 3300047445 Bacteria 1354
315 Ga0495681_0052897 3300047470 Bacteria 1903
316 Ga0496102_1132504 3300048905 Bacteria 702
317 Ga0496119_0294650 3300048922 Bacteria 802
318 Ga0496120_0043346 3300048923 Bacteria 2622
319 Ga0496121_0045570 3300048924 Bacteria 3766
320 Ga0496124_0003907 3300048927 Bacteria 17812
321 Ga0496126_0118720 3300048929 Bacteria 2296
322 Ga0501031_0039948 3300049568 Bacteria 3063
323 Ga0501034_0374453 3300049571 Bacteria 1350
324 Ga0501036_0870319 3300049572 Unclassified 740
325 Ga0501037_0023152 3300049573 Unclassified 4594
326 Ga0501047_0152542 3300049581 Unclassified 2185
327 Ga0501074_0075257 3300049590 Bacteria 2424
328 Ga0501075_0489907 3300049591 Bacteria 938
329 Ga0501224_009294 3300049664 Bacteria 1437
330 Ga0501249_023107 3300049679 Bacteria 1364
331 Ga0501079_1571870 3300049741 Bacteria 517
332 Ga0501080_0513848 3300049742 Bacteria 1069
333 Ga0501080_1484732 3300049742 Unclassified 576
334 Ga0501241_006486 3300049758 Bacteria 2153
335 Ga0501035_0318652 3300049822 Bacteria 1307
336 Ga0501044_0003896 3300049823 Bacteria 16722
337 Ga0501044_0504235 3300049823 Bacteria 1111
338 Ga0501044_0665577 3300049823 Bacteria 929
339 Ga0501044_1289197 3300049823 Bacteria 597
340 Ga0501045_0297450 3300049824 Bacteria 1201
341 nmdc:mga0k408_2730_c1 3300050493 Bacteria 9376
342 nmdc:mga07m45_847373_c1 3300050496 Bacteria 523
343 nmdc:mga06r32_31769_c1 3300050510 Bacteria 4962
344 nmdc:mga08y16_183152_c1 3300050511 Bacteria 2174
345 nmdc:mga0a205_300796_c1 3300050515 Bacteria 1477
346 Ga0500643_032182 3300053087 Bacteria 1594
347 Ga0500651_0282469 3300053093 Bacteria 957
348 Ga0500566_0025708 3300053094 Bacteria 3449
349 Ga0500650_0186090 3300053098 Bacteria 950
350 Ga0500595_077253 3300053119 Bacteria 979
351 Ga0500658_0001591 3300053134 Bacteria 9066
352 Ga0500564_211238 3300053138 Bacteria 791
353 Ga0500568_0091278 3300053139 Bacteria 1148
354 Ga0500624_000062 3300053157 Bacteria 66317
355 Ga0500627_0053542 3300053158 Bacteria 1764
356 Ga0500637_0000112 3300053178 Bacteria 29320
357 Ga0501084_0060792 3300054114 Bacteria 3163
358 Ga0501082_1142842 3300060353 Bacteria 681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_12456999 Ga0105238_124569991 131
2 3300046525 Ga0495663_0166405 Ga0495663_0166405_151_558 135
3 3300025922 Ga0207646_10063168 Ga0207646_100631684 136
4 3300042876 Ga0451577_1927077 Ga0451577_1927077_31_444 137
5 3300003794 Ga0055531_10074164 Ga0055531_100741641 139
6 3300005445 Ga0070708_101290978 Ga0070708_1012909781 139
7 3300025304 Ga0209257_1087928 Ga0209257_10879282 139
8 3300025910 Ga0207684_10154633 Ga0207684_101546332 139
9 3300005331 Ga0070670_100191975 Ga0070670_1001919752 140
10 3300025925 Ga0207650_10146191 Ga0207650_101461912 140
11 iso_pu_bacteria 2830075706 2830076911 140
12 iso_pu_bacteria 2885429604 2885431602 140
13 iso_pu_bacteria 2896184354 2896184472 140
14 iso_pu_bacteria 2928027323 2928030310 140
15 iso_pu_bacteria 2928526807 2928528651 140
16 iso_pu_bacteria 2928968154 2928970201 140
17 iso_pu_bacteria 2984555340 2984558887 140
18 iso_pu_bacteria 2984564862 2984566599 140
19 iso_pu_bacteria 2993356040 2993357795 140
20 3300005468 Ga0070707_100046758 Ga0070707_1000467584 141
21 3300005471 Ga0070698_100273981 Ga0070698_1002739812 142
22 3300005471 Ga0070698_101077913 Ga0070698_1010779131 142
23 3300006028 Ga0070717_10281265 Ga0070717_102812652 142
24 3300006195 Ga0075366_10242466 Ga0075366_102424662 142
25 3300006237 Ga0097621_100388789 Ga0097621_1003887892 142
26 3300010375 Ga0105239_11434726 Ga0105239_114347262 142
27 3300020080 Ga0206350_10329018 Ga0206350_103290182 142
28 3300039453 Ga0436362_0223526 Ga0436362_0223526_92_541 142
29 3300044694 Ga0466963_0284598 Ga0466963_0284598_96_551 142
30 3300044842 Ga0466957_0046705 Ga0466957_0046705_65_520 142
31 3300045976 Ga0466967_0375387 Ga0466967_0375387_305_742 142
32 3300049571 Ga0501034_0374453 Ga0501034_0374453_328_765 142
33 3300049572 Ga0501036_0870319 Ga0501036_0870319_115_552 142
34 3300049573 Ga0501037_0023152 Ga0501037_0023152_1671_2108 142
35 3300049581 Ga0501047_0152542 Ga0501047_0152542_1578_2015 142
36 3300049742 Ga0501080_1484732 Ga0501080_1484732_83_520 142
37 3300049823 Ga0501044_0003896 Ga0501044_0003896_4506_4943 142
38 3300049823 Ga0501044_0504235 Ga0501044_0504235_544_990 142
39 3300060353 Ga0501082_1142842 Ga0501082_1142842_42_485 142
40 2162886012 MBSR1b_contig_11328778 MBSR1b_0858.00002140 143
41 2162886012 MBSR1b_contig_1636348 MBSR1b_0085.00005890 143
42 3300004800 Ga0058861_10915281 Ga0058861_109152812 143
43 3300005293 Ga0065715_10336412 Ga0065715_103364122 143
44 3300005343 Ga0070687_100184519 Ga0070687_1001845192 143
45 3300005445 Ga0070708_101070779 Ga0070708_1010707791 143
46 3300005456 Ga0070678_100053208 Ga0070678_1000532082 143
47 3300005456 Ga0070678_102086428 Ga0070678_1020864281 143
48 3300005458 Ga0070681_10125731 Ga0070681_101257312 143
49 3300005530 Ga0070679_100297299 Ga0070679_1002972992 143
50 3300005543 Ga0070672_100027525 Ga0070672_1000275253 143
51 3300005564 Ga0070664_100703531 Ga0070664_1007035312 143
52 3300020069 Ga0197907_10413886 Ga0197907_104138862 143
53 3300020076 Ga0206355_1148942 Ga0206355_11489422 143
54 3300020080 Ga0206350_10426361 Ga0206350_104263613 143
55 3300020082 Ga0206353_11836939 Ga0206353_118369392 143
56 3300020610 Ga0154015_1689851 Ga0154015_16898512 143
57 3300022467 Ga0224712_10010556 Ga0224712_100105562 143
58 3300025921 Ga0207652_10141760 Ga0207652_101417602 143
59 3300025925 Ga0207650_10247445 Ga0207650_102474452 143
60 3300025944 Ga0207661_10695833 Ga0207661_106958332 143
61 3300025986 Ga0207658_10327456 Ga0207658_103274562 143
62 3300026121 Ga0207683_10008146 Ga0207683_100081462 143
63 3300041404 Ga0439436_0161259 Ga0439436_0161259_73_510 143
64 3300042008 Ga0439450_048357 Ga0439450_048357_264_731 143
65 3300042439 Ga0439464_0024798 Ga0439464_0024798_460_927 143
66 3300049568 Ga0501031_0039948 Ga0501031_0039948_790_1275 143
67 3300049590 Ga0501074_0075257 Ga0501074_0075257_1565_2050 143
68 3300049591 Ga0501075_0489907 Ga0501075_0489907_256_741 143
69 3300049741 Ga0501079_1571870 Ga0501079_1571870_12_497 143
70 3300049824 Ga0501045_0297450 Ga0501045_0297450_652_1137 143
71 3300053157 Ga0500624_000062 Ga0500624_000062_51991_52422 143
72 3300053178 Ga0500637_0000112 Ga0500637_0000112_7991_8422 143
73 3300054114 Ga0501084_0060792 Ga0501084_0060792_1514_1999 143
74 3300000043 ARcpr5yngRDRAFT_c004755 ARcpr5yngRDRAFT_0047552 144
75 3300003215 JGI25153J46596_10051638 JGI25153J46596_100516382 144
76 3300003773 Ga0055537_1004078 Ga0055537_10040786 144
77 3300003775 Ga0055524_1000539 Ga0055524_100053914 144
78 3300003791 Ga0055530_10001987 Ga0055530_100019877 144
79 3300003791 Ga0055530_10042529 Ga0055530_100425292 144
80 3300003794 Ga0055531_10000525 Ga0055531_1000052512 144
81 3300003794 Ga0055531_10004340 Ga0055531_100043406 144
82 3300003794 Ga0055531_10043445 Ga0055531_100434452 144
83 3300005262 Ga0065165_1008458 Ga0065165_10084583 144
84 3300005262 Ga0065165_1013400 Ga0065165_10134002 144
85 3300005338 Ga0068868_100761080 Ga0068868_1007610801 144
86 3300005347 Ga0070668_100270558 Ga0070668_1002705582 144
87 3300005354 Ga0070675_102093040 Ga0070675_1020930401 144
88 3300005530 Ga0070679_100796969 Ga0070679_1007969692 144
89 3300005539 Ga0068853_100563811 Ga0068853_1005638112 144
90 3300005718 Ga0068866_10317201 Ga0068866_103172012 144
91 3300005842 Ga0068858_100001357 Ga0068858_10000135723 144
92 3300006237 Ga0097621_100621239 Ga0097621_1006212391 144
93 3300009098 Ga0105245_10014507 Ga0105245_100145077 144
94 3300009148 Ga0105243_10251350 Ga0105243_102513502 144
95 3300009551 Ga0105238_10017288 Ga0105238_100172885 144
96 3300009551 Ga0105238_10615197 Ga0105238_106151971 144
97 3300011119 Ga0105246_10829423 Ga0105246_108294231 144
98 3300013297 Ga0157378_10042046 Ga0157378_100420463 144
99 3300013307 Ga0157372_10212259 Ga0157372_102122593 144
100 3300025245 Ga0207425_1019078 Ga0207425_10190781 144
101 3300025263 Ga0209565_1000008 Ga0209565_1000008656 144
102 3300025273 Ga0209673_1001779 Ga0209673_10017796 144
103 3300025291 Ga0209675_1005932 Ga0209675_10059326 144
104 3300025297 Ga0209758_1012098 Ga0209758_10120983 144
105 3300025298 Ga0209050_1000581 Ga0209050_100058142 144
106 3300025298 Ga0209050_1023516 Ga0209050_10235162 144
107 3300025299 Ga0209256_1000009 Ga0209256_1000009213 144
108 3300025299 Ga0209256_1000010 Ga0209256_1000010137 144
109 3300025302 Ga0207426_1070686 Ga0207426_10706862 144
110 3300025304 Ga0209257_1000577 Ga0209257_100057722 144
111 3300025304 Ga0209257_1000597 Ga0209257_100059722 144
112 3300025304 Ga0209257_1004324 Ga0209257_10043249 144
113 3300025304 Ga0209257_1024886 Ga0209257_10248862 144
114 3300025921 Ga0207652_10605802 Ga0207652_106058022 144
115 3300025924 Ga0207694_10025475 Ga0207694_100254755 144
116 3300025927 Ga0207687_10086478 Ga0207687_100864782 144
117 3300025935 Ga0207709_10332360 Ga0207709_103323602 144
118 3300025940 Ga0207691_10656259 Ga0207691_106562592 144
119 3300025942 Ga0207689_10090635 Ga0207689_100906352 144
120 3300025972 Ga0207668_10352944 Ga0207668_103529442 144
121 3300026035 Ga0207703_10000775 Ga0207703_1000077522 144
122 3300026041 Ga0207639_10824410 Ga0207639_108244102 144
123 3300026116 Ga0207674_10517100 Ga0207674_105171002 144
124 3300028786 Ga0307517_10160099 Ga0307517_101600992 144
125 3300031824 Ga0307413_10254172 Ga0307413_102541722 144
126 3300031911 Ga0307412_10001867 Ga0307412_1000186712 144
127 3300032004 Ga0307414_10188602 Ga0307414_101886023 144
128 3300039450 Ga0436363_0419119 Ga0436363_0419119_1013_1447 144
129 3300039453 Ga0436362_0312687 Ga0436362_0312687_206_640 144
130 3300041408 Ga0439453_0079760 Ga0439453_0079760_14_448 144
131 3300041410 Ga0439461_0000448 Ga0439461_0000448_2728_3162 144
132 3300041413 Ga0439465_0001576 Ga0439465_0001576_2981_3415 144
133 3300041997 Ga0439431_0000497 Ga0439431_0000497_2922_3356 144
134 3300042000 Ga0439437_019865 Ga0439437_019865_285_725 144
135 3300042002 Ga0439442_089388 Ga0439442_089388_75_509 144
136 3300042004 Ga0439445_0002399 Ga0439445_0002399_817_1251 144
137 3300042004 Ga0439445_0025536 Ga0439445_0025536_858_1292 144
138 3300042006 Ga0439432_001134 Ga0439432_001134_1565_1999 144
139 3300042007 Ga0439449_0055563 Ga0439449_0055563_325_759 144
140 3300042015 Ga0439462_0005356 Ga0439462_0005356_1771_2205 144
141 3300042015 Ga0439462_0082878 Ga0439462_0082878_176_610 144
142 3300042121 Ga0450919_024577 Ga0450919_024577_159_593 144
143 3300042156 Ga0439446_0045223 Ga0439446_0045223_507_941 144
144 3300042435 Ga0439434_0001904 Ga0439434_0001904_5397_5831 144
145 3300042435 Ga0439434_0012571 Ga0439434_0012571_772_1206 144
146 3300044735 Ga0466968_0387480 Ga0466968_0387480_90_524 144
147 3300046660 Ga0495625_0000629 Ga0495625_0000629_1461_1895 144
148 3300046691 Ga0495670_0000002 Ga0495670_0000002_62584_63018 144
149 3300046691 Ga0495670_0107586 Ga0495670_0107586_210_644 144
150 3300047470 Ga0495681_0052897 Ga0495681_0052897_74_508 144
151 3300048922 Ga0496119_0294650 Ga0496119_0294650_168_602 144
152 3300048923 Ga0496120_0043346 Ga0496120_0043346_2113_2547 144
153 3300048927 Ga0496124_0003907 Ga0496124_0003907_2270_2704 144
154 3300048929 Ga0496126_0118720 Ga0496126_0118720_356_790 144
155 3300049742 Ga0501080_0513848 Ga0501080_0513848_158_625 144
156 3300049758 Ga0501241_006486 Ga0501241_006486_355_789 144
157 3300049822 Ga0501035_0318652 Ga0501035_0318652_589_1023 144
158 3300049823 Ga0501044_0665577 Ga0501044_0665577_134_601 144
159 3300049823 Ga0501044_1289197 Ga0501044_1289197_25_459 144
160 3300050496 nmdc:mga07m45_847373_c1 nmdc:mga07m45_847373_c1_76_510 144
161 3300053087 Ga0500643_032182 Ga0500643_032182_970_1404 144
162 3300053093 Ga0500651_0282469 Ga0500651_0282469_502_936 144
163 3300053094 Ga0500566_0025708 Ga0500566_0025708_2854_3288 144
164 3300053098 Ga0500650_0186090 Ga0500650_0186090_264_698 144
165 3300053119 Ga0500595_077253 Ga0500595_077253_233_667 144
166 3300053134 Ga0500658_0001591 Ga0500658_0001591_7847_8281 144
167 3300053139 Ga0500568_0091278 Ga0500568_0091278_121_555 144
168 2162886007 SwRhRL2b_contig_202295 SwRhRL2b_0035.00004300 145
169 3300001977 JGI24746J21847_1003346 JGI24746J21847_10033463 145
170 3300002070 JGI24750J21931_1037151 JGI24750J21931_10371512 145
171 3300002076 JGI24749J21850_1003641 JGI24749J21850_10036412 145
172 3300002126 JGI24035J26624_1026298 JGI24035J26624_10262982 145
173 3300005289 Ga0065704_10110565 Ga0065704_101105652 145
174 3300005293 Ga0065715_10060753 Ga0065715_100607531 145
175 3300005293 Ga0065715_10098696 Ga0065715_100986964 145
176 3300005293 Ga0065715_10799051 Ga0065715_107990511 145
177 3300005295 Ga0065707_10090604 Ga0065707_100906044 145
178 3300005327 Ga0070658_10000086 Ga0070658_1000008637 145
179 3300005328 Ga0070676_10034103 Ga0070676_100341032 145
180 3300005330 Ga0070690_100540335 Ga0070690_1005403351 145
181 3300005331 Ga0070670_100037740 Ga0070670_1000377404 145
182 3300005333 Ga0070677_10011147 Ga0070677_100111473 145
183 3300005334 Ga0068869_100241237 Ga0068869_1002412373 145
184 3300005339 Ga0070660_100000197 Ga0070660_10000019737 145
185 3300005340 Ga0070689_100172077 Ga0070689_1001720771 145
186 3300005341 Ga0070691_10799045 Ga0070691_107990451 145
187 3300005343 Ga0070687_100160891 Ga0070687_1001608911 145
188 3300005347 Ga0070668_100033686 Ga0070668_1000336864 145
189 3300005353 Ga0070669_100005949 Ga0070669_1000059493 145
190 3300005353 Ga0070669_100171693 Ga0070669_1001716933 145
191 3300005354 Ga0070675_100007930 Ga0070675_1000079303 145
192 3300005355 Ga0070671_100014372 Ga0070671_1000143726 145
193 3300005356 Ga0070674_100074175 Ga0070674_1000741752 145
194 3300005356 Ga0070674_101810461 Ga0070674_1018104611 145
195 3300005364 Ga0070673_100035265 Ga0070673_1000352655 145
196 3300005366 Ga0070659_100005647 Ga0070659_10000564715 145
197 3300005367 Ga0070667_100102095 Ga0070667_1001020953 145
198 3300005367 Ga0070667_101899183 Ga0070667_1018991831 145
199 3300005438 Ga0070701_10327077 Ga0070701_103270772 145
200 3300005440 Ga0070705_100095846 Ga0070705_1000958462 145
201 3300005441 Ga0070700_101369953 Ga0070700_1013699531 145
202 3300005455 Ga0070663_100053602 Ga0070663_1000536023 145
203 3300005457 Ga0070662_100029506 Ga0070662_1000295064 145
204 3300005466 Ga0070685_10355371 Ga0070685_103553712 145
205 3300005539 Ga0068853_100713906 Ga0068853_1007139061 145
206 3300005543 Ga0070672_100050341 Ga0070672_1000503413 145
207 3300005543 Ga0070672_100400089 Ga0070672_1004000892 145
208 3300005544 Ga0070686_100163792 Ga0070686_1001637923 145
209 3300005546 Ga0070696_100968215 Ga0070696_1009682151 145
210 3300005548 Ga0070665_100392739 Ga0070665_1003927392 145
211 3300005548 Ga0070665_100987533 Ga0070665_1009875332 145
212 3300005564 Ga0070664_100091870 Ga0070664_1000918703 145
213 3300005577 Ga0068857_100238918 Ga0068857_1002389183 145
214 3300005617 Ga0068859_100122393 Ga0068859_1001223933 145
215 3300005841 Ga0068863_101395577 Ga0068863_1013955772 145
216 3300005843 Ga0068860_100025002 Ga0068860_1000250022 145
217 3300005843 Ga0068860_100269343 Ga0068860_1002693433 145
218 3300005844 Ga0068862_100182383 Ga0068862_1001823833 145
219 3300005844 Ga0068862_100372527 Ga0068862_1003725271 145
220 3300005844 Ga0068862_101541173 Ga0068862_1015411731 145
221 3300006195 Ga0075366_10028344 Ga0075366_100283444 145
222 3300006353 Ga0075370_10033548 Ga0075370_100335484 145
223 3300006847 Ga0075431_100018381 Ga0075431_1000183819 145
224 3300006881 Ga0068865_101084021 Ga0068865_1010840212 145
225 3300006931 Ga0097620_100122395 Ga0097620_1001223953 145
226 3300009094 Ga0111539_10067729 Ga0111539_100677294 145
227 3300009177 Ga0105248_10560781 Ga0105248_105607813 145
228 3300009553 Ga0105249_10056947 Ga0105249_100569474 145
229 3300009553 Ga0105249_10341575 Ga0105249_103415752 145
230 3300013100 Ga0157373_10383293 Ga0157373_103832933 145
231 3300013105 Ga0157369_10073192 Ga0157369_100731926 145
232 3300013306 Ga0163162_10429869 Ga0163162_104298692 145
233 3300014326 Ga0157380_10034780 Ga0157380_100347803 145
234 3300014326 Ga0157380_10132055 Ga0157380_101320553 145
235 3300014326 Ga0157380_10357186 Ga0157380_103571862 145
236 3300014326 Ga0157380_10370066 Ga0157380_103700663 145
237 3300017792 Ga0163161_10010979 Ga0163161_100109796 145
238 3300017792 Ga0163161_10891388 Ga0163161_108913881 145
239 3300025315 Ga0207697_10003268 Ga0207697_100032683 145
240 3300025893 Ga0207682_10003307 Ga0207682_100033078 145
241 3300025901 Ga0207688_10053858 Ga0207688_100538583 145
242 3300025904 Ga0207647_10199894 Ga0207647_101998942 145
243 3300025907 Ga0207645_10029243 Ga0207645_100292434 145
244 3300025909 Ga0207705_10000002 Ga0207705_1000000279 145
245 3300025912 Ga0207707_10328403 Ga0207707_103284032 145
246 3300025919 Ga0207657_10001791 Ga0207657_1000179129 145
247 3300025923 Ga0207681_10135036 Ga0207681_101350363 145
248 3300025925 Ga0207650_10004984 Ga0207650_100049844 145
249 3300025925 Ga0207650_10011042 Ga0207650_100110424 145
250 3300025926 Ga0207659_10022864 Ga0207659_100228645 145
251 3300025931 Ga0207644_10016228 Ga0207644_100162284 145
252 3300025932 Ga0207690_10005539 Ga0207690_100055393 145
253 3300025933 Ga0207706_10001074 Ga0207706_100010746 145
254 3300025937 Ga0207669_10003870 Ga0207669_100038707 145
255 3300025940 Ga0207691_10012198 Ga0207691_100121988 145
256 3300025941 Ga0207711_10486447 Ga0207711_104864472 145
257 3300025942 Ga0207689_10332098 Ga0207689_103320983 145
258 3300025945 Ga0207679_10011476 Ga0207679_100114765 145
259 3300025960 Ga0207651_10029927 Ga0207651_100299275 145
260 3300025961 Ga0207712_10034943 Ga0207712_100349434 145
261 3300025961 Ga0207712_10286940 Ga0207712_102869402 145
262 3300025972 Ga0207668_10008146 Ga0207668_100081466 145
263 3300025972 Ga0207668_10131097 Ga0207668_101310973 145
264 3300025986 Ga0207658_10071163 Ga0207658_100711633 145
265 3300025986 Ga0207658_11153673 Ga0207658_111536731 145
266 3300026041 Ga0207639_10027877 Ga0207639_100278773 145
267 3300026067 Ga0207678_10018861 Ga0207678_100188613 145
268 3300026088 Ga0207641_10974412 Ga0207641_109744122 145
269 3300026089 Ga0207648_10031394 Ga0207648_100313944 145
270 3300026095 Ga0207676_10111666 Ga0207676_101116663 145
271 3300026116 Ga0207674_10250128 Ga0207674_102501283 145
272 3300026118 Ga0207675_100019373 Ga0207675_1000193738 145
273 3300026121 Ga0207683_10071191 Ga0207683_100711913 145
274 3300027526 Ga0209968_1032773 Ga0209968_10327732 145
275 3300027552 Ga0209982_1012752 Ga0209982_10127521 145
276 3300027907 Ga0207428_10573672 Ga0207428_105736722 145
277 3300028379 Ga0268266_10494466 Ga0268266_104944662 145
278 3300028379 Ga0268266_11542656 Ga0268266_115426562 145
279 3300028380 Ga0268265_10033998 Ga0268265_100339985 145
280 3300028380 Ga0268265_10096128 Ga0268265_100961283 145
281 3300028380 Ga0268265_10107564 Ga0268265_101075643 145
282 3300028381 Ga0268264_10014949 Ga0268264_100149492 145
283 3300028381 Ga0268264_10285301 Ga0268264_102853013 145
284 3300028381 Ga0268264_11754997 Ga0268264_117549971 145
285 3300030735 Ga0316178_1001738 Ga0316178_10017382 145
286 3300031548 Ga0307408_100379006 Ga0307408_1003790063 145
287 3300031548 Ga0307408_100577198 Ga0307408_1005771982 145
288 3300031548 Ga0307408_100874148 Ga0307408_1008741482 145
289 3300031548 Ga0307408_101364492 Ga0307408_1013644921 145
290 3300031731 Ga0307405_10046107 Ga0307405_100461073 145
291 3300031731 Ga0307405_10082987 Ga0307405_100829873 145
292 3300031731 Ga0307405_10465232 Ga0307405_104652323 145
293 3300031824 Ga0307413_10129372 Ga0307413_101293724 145
294 3300031824 Ga0307413_10153842 Ga0307413_101538421 145
295 3300031824 Ga0307413_10404723 Ga0307413_104047231 145
296 3300031824 Ga0307413_11192441 Ga0307413_111924412 145
297 3300031824 Ga0307413_11422597 Ga0307413_114225971 145
298 3300031852 Ga0307410_10063336 Ga0307410_100633363 145
299 3300031852 Ga0307410_10131285 Ga0307410_101312851 145
300 3300031852 Ga0307410_10149715 Ga0307410_101497152 145
301 3300031852 Ga0307410_11019102 Ga0307410_110191021 145
302 3300031901 Ga0307406_10375608 Ga0307406_103756082 145
303 3300031901 Ga0307406_10486966 Ga0307406_104869662 145
304 3300031901 Ga0307406_11485610 Ga0307406_114856101 145
305 3300031903 Ga0307407_10139163 Ga0307407_101391633 145
306 3300031903 Ga0307407_10155057 Ga0307407_101550572 145
307 3300031911 Ga0307412_10101568 Ga0307412_101015683 145
308 3300031911 Ga0307412_10122654 Ga0307412_101226542 145
309 3300031911 Ga0307412_10143836 Ga0307412_101438362 145
310 3300031911 Ga0307412_10175952 Ga0307412_101759521 145
311 3300031911 Ga0307412_10259993 Ga0307412_102599933 145
312 3300031911 Ga0307412_10583431 Ga0307412_105834312 145
313 3300031911 Ga0307412_10606203 Ga0307412_106062032 145
314 3300031995 Ga0307409_100181209 Ga0307409_1001812092 145
315 3300031995 Ga0307409_100626947 Ga0307409_1006269471 145
316 3300031995 Ga0307409_101601614 Ga0307409_1016016141 145
317 3300032002 Ga0307416_100194445 Ga0307416_1001944453 145
318 3300032002 Ga0307416_100981322 Ga0307416_1009813222 145
319 3300032002 Ga0307416_101110806 Ga0307416_1011108062 145
320 3300032004 Ga0307414_10023542 Ga0307414_100235424 145
321 3300032004 Ga0307414_10077226 Ga0307414_100772264 145
322 3300032004 Ga0307414_10107001 Ga0307414_101070013 145
323 3300032004 Ga0307414_10116444 Ga0307414_101164443 145
324 3300032004 Ga0307414_10154967 Ga0307414_101549672 145
325 3300032004 Ga0307414_11037869 Ga0307414_110378692 145
326 3300032004 Ga0307414_11593074 Ga0307414_115930741 145
327 3300032005 Ga0307411_10018008 Ga0307411_100180082 145
328 3300032005 Ga0307411_10073515 Ga0307411_100735151 145
329 3300032005 Ga0307411_10082529 Ga0307411_100825292 145
330 3300032005 Ga0307411_10158946 Ga0307411_101589463 145
331 3300032005 Ga0307411_10189653 Ga0307411_101896531 145
332 3300032005 Ga0307411_10402898 Ga0307411_104028982 145
333 3300032005 Ga0307411_10481161 Ga0307411_104811613 145
334 3300032005 Ga0307411_11060309 Ga0307411_110603091 145
335 3300032126 Ga0307415_100272058 Ga0307415_1002720582 145
336 3300032126 Ga0307415_100639642 Ga0307415_1006396422 145
337 3300032126 Ga0307415_101172906 Ga0307415_1011729062 145
338 3300032126 Ga0307415_101949723 Ga0307415_1019497231 145
339 3300037418 Ga0395900_0034392 Ga0395900_0034392_4416_4856 145
340 3300037471 Ga0395905_0000365 Ga0395905_0000365_45987_46427 145
341 3300037471 Ga0395905_1325088 Ga0395905_1325088_89_529 145
342 3300038443 Ga0395901_0028381 Ga0395901_0028381_482_922 145
343 3300041408 Ga0439453_0142650 Ga0439453_0142650_38_478 145
344 3300041494 Ga0451837_1191648 Ga0451837_1191648_80_517 145
345 3300041498 Ga0451841_0840733 Ga0451841_0840733_96_533 145
346 3300042004 Ga0439445_0000081 Ga0439445_0000081_6906_7346 145
347 3300042435 Ga0439434_0185108 Ga0439434_0185108_222_662 145
348 3300042436 Ga0439435_0218186 Ga0439435_0218186_97_537 145
349 3300042439 Ga0439464_0016218 Ga0439464_0016218_1232_1672 145
350 3300046525 Ga0495663_0005798 Ga0495663_0005798_514_954 145
351 3300046528 Ga0495642_0203087 Ga0495642_0203087_320_760 145
352 3300046537 Ga0495598_0031015 Ga0495598_0031015_959_1399 145
353 3300046558 Ga0495633_0055535 Ga0495633_0055535_1364_1804 145
354 3300046616 Ga0495668_0098902 Ga0495668_0098902_538_978 145
355 3300046691 Ga0495670_0717001 Ga0495670_0717001_54_494 145
356 3300046691 Ga0495670_0818897 Ga0495670_0818897_13_453 145
357 3300047445 Ga0495677_0065169 Ga0495677_0065169_167_607 145
358 3300048905 Ga0496102_1132504 Ga0496102_1132504_50_490 145
359 3300048924 Ga0496121_0045570 Ga0496121_0045570_2220_2657 145
360 3300049664 Ga0501224_009294 Ga0501224_009294_743_1180 145
361 3300049679 Ga0501249_023107 Ga0501249_023107_868_1305 145
362 3300050493 nmdc:mga0k408_2730_c1 nmdc:mga0k408_2730_c1_6079_6516 145
363 3300050510 nmdc:mga06r32_31769_c1 nmdc:mga06r32_31769_c1_825_1265 145
364 3300050511 nmdc:mga08y16_183152_c1 nmdc:mga08y16_183152_c1_1679_2119 145
365 3300050515 nmdc:mga0a205_300796_c1 nmdc:mga0a205_300796_c1_304_744 145
366 3300053138 Ga0500564_211238 Ga0500564_211238_308_745 145
367 3300053158 Ga0500627_0053542 Ga0500627_0053542_656_1096 145
368 iso_pu_bacteria 2599185359 2600225654 145
369 iso_pu_bacteria 2818991466 2819714092 145
370 iso_pu_bacteria 2990265787 2990266669 145
371 iso_pu_bacteria 2993693658 2993695530 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

14

151

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uyg-assembly1.cif.gz_F crystallogaphic structure of the typeii 3-dehydroquinase from thermus thermophilus 0.9797 6 145
3n8k-assembly2.cif.gz_M type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid 0.977 5 144
1gqo-assembly1.cif.gz_K type ii dehydroquinase from bacillus subtilis 0.9762 5 145
3n59-assembly2.cif.gz_P type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate 0.9755 5 145
4kij-assembly1.cif.gz_A design and structural analysis of aromatic inhibitors of type ii dehydroquinase dehydratase from mycobacterium tuberculosis - compound 35c [3,4-dihydroxy-5-(3-nitrophenoxy)benzoic acid] 0.9751 5 145
ID Description Score Start End Superfamily
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9734 5 145 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9724 5 145 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9683 3 144 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9594 5 145 3.40.50.9100
1gqoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9591 5 145 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A2A2M521-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 1.003 50 145 GO:0003855
GO:0019631
AF-A0A147J2E8-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 1.002 3 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A3D2LFI5-F1-model_v4 deleted 0.9994 12 145
AF-A0A1Y5Q4M3-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9988 1 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A7Y4YVU0-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9986 4 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631

Feature Viewer

pLDDT pTM Quality
95.62 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map