metagRoot

F425578

General Info

Members	Datasets	Scaffolds	Average Seq Length
370	247	364	134

Family's Representative Sequence

Representative Sequence	3300050511\|nmdc:mga08y16_1036201_c1\|nmdc:mga08y16_1036201_c1_169_570
Length	133
Sequence	MKKTYHGSCHCGKIRYEADIDLAEGTGKCNCTYCWKLRWWGAAIKPDAFRLLAGQEQSGYKFPTDKPITRAHCDCAVTSFGWGHIPEVGGDFVSINLACLDDLDPTELIAAPIRYMDGRNNNWWHPPAETRHL

Samples

	Sample ID	Description	Type	Environment
1	2537561836	Rhodanobacter spathiphylli B39	Isolate	Unclassified
2	2643221562	Rhodanobacter sp. Root561	Isolate	Unclassified
3	2643221577	Rhodanobacter sp. Root627	Isolate	Unclassified
4	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
5	2643221685	Rhodanobacter sp. Root480	Isolate	Unclassified
6	2895395659	Rhodanobacter sp. T12-5	Isolate	Unclassified
7	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
8	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
9	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
10	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
11	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
12	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
13	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
14	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
15	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
16	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
17	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
18	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
19	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
20	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
21	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
22	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
23	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
24	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
25	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
26	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
27	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
28	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
29	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
30	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
31	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
32	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
33	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
34	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
35	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
36	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
37	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
38	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
39	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
40	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
41	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
42	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
43	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
46	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
47	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
48	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
49	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
50	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
51	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
52	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
53	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
54	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
55	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
56	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
57	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
58	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
59	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
60	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
61	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
62	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
63	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
64	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
66	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
67	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
68	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
69	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
71	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
73	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
74	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
75	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
76	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
77	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
78	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
79	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
80	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
81	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
82	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
83	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
84	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
85	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
86	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
87	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
88	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
89	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
90	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
91	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
92	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
93	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
94	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
95	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
96	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
97	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
98	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
99	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
100	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
101	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
102	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
103	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
105	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
107	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
111	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
140	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
142	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
145	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
146	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
147	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
148	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
149	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
150	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
151	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
152	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
153	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
154	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
155	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
156	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
157	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
158	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
159	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
160	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
161	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
162	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
163	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
164	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
165	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
166	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
167	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
168	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
169	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
170	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
171	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
172	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
173	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
174	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
175	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
176	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
177	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
178	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
179	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
180	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
181	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
182	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
183	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
184	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
185	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
186	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
187	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
188	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
189	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
190	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
191	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
192	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
193	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
194	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
195	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
196	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
197	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
198	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
199	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
200	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
201	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
202	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
203	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
204	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
205	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
206	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
207	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
208	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
209	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
210	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
211	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
212	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
213	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
214	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
215	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
216	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
221	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
222	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
223	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
225	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
228	3300049672	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought	Metagenome	Rhizosphere
229	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
230	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
231	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
232	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
233	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
234	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
235	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
236	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
237	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
238	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
239	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
240	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
241	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
242	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
243	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
244	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
245	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
246	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
247	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.68
Metatranscriptomes	2.7
Isolates	1.62

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	17.84
Nodule	1.08
Rhizoplane	5.41
Rhizosphere	62.16
Stem	0
Stem Tuber	0
Unclassified	13.51

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10042753	3300002067	Bacteria	1319
2	JGI25155J39150_1000002	3300002704	Bacteria	292156
3	JGI25156J39149_1000003	3300002705	Bacteria	305434
4	JGI25154J39366_1000009	3300002738	Bacteria	305408
5	JGI25157J39369_1000002	3300002741	Bacteria	305434
6	JGI25406J46586_10031557	3300003203	Bacteria	1979
7	rootL2_10010810	3300003322	Bacteria	8638
8	rootL2_10128842	3300003322	Bacteria	1392
9	JGI25161J50226_1024474	3300003374	Bacteria	592
10	JGI25404J52841_10001897	3300003659	Bacteria	3826
11	Ga0055526_1005920	3300003771	Bacteria	6823
12	Ga0055537_1000008	3300003773	Bacteria	142572
13	Ga0055524_1000080	3300003775	Bacteria	120203
14	Ga0055524_1000083	3300003775	Bacteria	119259
15	Ga0055536_1007317	3300003781	Bacteria	4963
16	Ga0055536_1027621	3300003781	Bacteria	1564
17	Ga0055534_1001365	3300003784	Bacteria	9770
18	Ga0055528_1000652	3300003790	Bacteria	25243
19	Ga0055540_1002305	3300003792	Bacteria	10261
20	Ga0055540_1070908	3300003792	Bacteria	681
21	Ga0055531_10000289	3300003794	Bacteria	50645
22	Ga0055531_10001904	3300003794	Bacteria	14618
23	Ga0065165_1001164	3300005262	Bacteria	30599
24	Ga0065165_1070823	3300005262	Bacteria	927
25	Ga0065165_1153594	3300005262	Bacteria	536
26	Ga0070683_100123382	3300005329	Bacteria	2448
27	Ga0068869_101532576	3300005334	Bacteria	592
28	Ga0070666_10133569	3300005335	Bacteria	1725
29	Ga0070666_10152228	3300005335	Bacteria	1614
30	Ga0070682_100028537	3300005337	Bacteria	3357
31	Ga0070660_100880382	3300005339	Bacteria	755
32	Ga0070691_10040237	3300005341	Bacteria	2209
33	Ga0070661_100069357	3300005344	Bacteria	2592
34	Ga0070671_100000961	3300005355	Bacteria	21091
35	Ga0070671_100030999	3300005355	Bacteria	4415
36	Ga0070674_100629022	3300005356	Bacteria	910
37	Ga0070659_100254525	3300005366	Bacteria	1456
38	Ga0070667_100065031	3300005367	Unclassified	3096
39	Ga0070663_100025688	3300005455	Bacteria	3979
40	Ga0070663_100198417	3300005455	Bacteria	1565
41	Ga0070663_101276804	3300005455	Bacteria	647
42	Ga0070662_100041043	3300005457	Bacteria	3299
43	Ga0070681_10325342	3300005458	Bacteria	1447
44	Ga0070679_100136786	3300005530	Bacteria	2431
45	Ga0070686_100182989	3300005544	Bacteria	1490
46	Ga0070696_100119398	3300005546	Bacteria	1907
47	Ga0070665_100009118	3300005548	Bacteria	10050
48	Ga0070665_100307779	3300005548	Bacteria	1588
49	Ga0068855_100026982	3300005563	Bacteria	6872
50	Ga0070664_100586416	3300005564	Bacteria	1033
51	Ga0068857_100617091	3300005577	Bacteria	1026
52	Ga0068854_100246978	3300005578	Bacteria	1423
53	Ga0068856_100000307	3300005614	Bacteria	53659
54	Ga0068859_100000863	3300005617	Bacteria	30882
55	Ga0068863_100002530	3300005841	Bacteria	18141
56	Ga0068863_100154113	3300005841	Bacteria	2200
57	Ga0068858_100002069	3300005842	Bacteria	20431
58	Ga0068860_100312714	3300005843	Bacteria	1540
59	Ga0081455_10472631	3300005937	Bacteria	850
60	Ga0081540_1000015	3300005983	Bacteria	178704
61	Ga0081539_10001361	3300005985	Bacteria	42392
62	Ga0075365_10011841	3300006038	Bacteria	5148
63	Ga0075363_100017022	3300006048	Bacteria	3599
64	Ga0075363_100064114	3300006048	Bacteria	1985
65	Ga0075362_10011334	3300006177	Bacteria	3510
66	Ga0075367_10131421	3300006178	Bacteria	1547
67	Ga0075367_10402751	3300006178	Bacteria	865
68	Ga0075369_10270331	3300006186	Bacteria	791
69	Ga0075366_10041128	3300006195	Bacteria	2736
70	Ga0075366_10311906	3300006195	Bacteria	963
71	Ga0075370_10024494	3300006353	Bacteria	3335
72	Ga0075370_10104550	3300006353	Bacteria	1641
73	Ga0075370_10698133	3300006353	Bacteria	617
74	Ga0075428_100428056	3300006844	Bacteria	1418
75	Ga0075433_10037932	3300006852	Bacteria	4159
76	Ga0097620_100000863	3300006931	Bacteria	30882
77	Ga0079104_1000017	3300006946	Bacteria	313784
78	Ga0079104_1062154	3300006946	Bacteria	802
79	Ga0099794_10062589	3300007265	Bacteria	1810
80	Ga0105250_10018421	3300009092	Unclassified	2828
81	Ga0105240_10000625	3300009093	Bacteria	65350
82	Ga0105240_10065738	3300009093	Bacteria	4501
83	Ga0105240_11711104	3300009093	Bacteria	656
84	Ga0111539_10595469	3300009094	Bacteria	1287
85	Ga0105247_10001207	3300009101	Bacteria	19178
86	Ga0114129_10874264	3300009147	Bacteria	1141
87	Ga0105241_10499602	3300009174	Bacteria	1084
88	Ga0105248_10042167	3300009177	Bacteria	5118
89	Ga0105237_10000108	3300009545	Bacteria	116481
90	Ga0105237_12009924	3300009545	Unclassified	587
91	Ga0105238_10047850	3300009551	Bacteria	4311
92	Ga0105238_10054107	3300009551	Bacteria	4032
93	Ga0105238_10119434	3300009551	Bacteria	2616
94	Ga0105238_12868075	3300009551	Bacteria	518
95	Ga0105249_10750075	3300009553	Bacteria	1038
96	Ga0099796_10042076	3300010159	Bacteria	1550
97	Ga0105239_10000054	3300010375	Bacteria	159216
98	Ga0105246_10123298	3300011119	Bacteria	1924
99	Ga0157373_10043196	3300013100	Bacteria	3220
100	Ga0157373_10082028	3300013100	Bacteria	2273
101	Ga0157371_10104123	3300013102	Bacteria	2014
102	Ga0157371_10111737	3300013102	Bacteria	1939
103	Ga0157371_10853141	3300013102	Bacteria	689
104	Ga0157370_10203503	3300013104	Bacteria	1836
105	Ga0157370_10759481	3300013104	Bacteria	883
106	Ga0157370_11362664	3300013104	Bacteria	639
107	Ga0157369_10161037	3300013105	Bacteria	2369
108	Ga0157369_11191147	3300013105	Bacteria	778
109	Ga0157374_11133679	3300013296	Bacteria	803
110	Ga0157372_10409949	3300013307	Bacteria	1579
111	Ga0157372_10433580	3300013307	Bacteria	1532
112	Ga0157372_11176325	3300013307	Bacteria	886
113	Ga0163163_10022313	3300014325	Bacteria	5991
114	Ga0182008_10123171	3300014497	Bacteria	1289
115	Ga0182006_1068639	3300015261	Bacteria	1320
116	Ga0197907_10395020	3300020069	Bacteria	1183
117	Ga0206356_10766623	3300020070	Bacteria	1018
118	Ga0206352_10750473	3300020078	Bacteria	970
119	Ga0206350_11039141	3300020080	Bacteria	567
120	Ga0206354_10386948	3300020081	Bacteria	1854
121	Ga0206354_10759292	3300020081	Bacteria	702
122	Ga0206353_10630617	3300020082	Bacteria	1866
123	Ga0206353_11131310	3300020082	Bacteria	913
124	Ga0154015_1144485	3300020610	Bacteria	751
125	Ga0213872_10065724	3300021361	Unclassified	1637
126	Ga0224712_10022282	3300022467	Bacteria	2181
127	Ga0209435_100001	3300025206	Bacteria	1424171
128	Ga0209646_1000001	3300025246	Bacteria	3092932
129	Ga0209646_1006696	3300025246	Bacteria	1922
130	Ga0209026_1000003	3300025250	Bacteria	1060571
131	Ga0209026_1000061	3300025250	Bacteria	219572
132	Ga0209759_1000001	3300025256	Bacteria	2799452
133	Ga0209759_1004850	3300025256	Bacteria	4892
134	Ga0209759_1027330	3300025256	Bacteria	1180
135	Ga0209565_1000004	3300025263	Bacteria	983150
136	Ga0209565_1007674	3300025263	Bacteria	2887
137	Ga0209455_1000111	3300025272	Bacteria	188820
138	Ga0209673_1000074	3300025273	Bacteria	233552
139	Ga0209673_1017541	3300025273	Bacteria	2637
140	Ga0209673_1046248	3300025273	Bacteria	1190
141	Ga0209130_1003325	3300025284	Bacteria	6927
142	Ga0209675_1000044	3300025291	Bacteria	230392
143	Ga0209675_1002215	3300025291	Bacteria	10167
144	Ga0209675_1005124	3300025291	Bacteria	5577
145	Ga0209676_1005983	3300025292	Bacteria	6148
146	Ga0209564_1000470	3300025295	Bacteria	67507
147	Ga0209564_1056389	3300025295	Bacteria	913
148	Ga0209050_1000102	3300025298	Bacteria	229971
149	Ga0209050_1052673	3300025298	Bacteria	1017
150	Ga0209256_1000001	3300025299	Bacteria	2166974
151	Ga0209256_1000011	3300025299	Bacteria	865309
152	Ga0209051_1000196	3300025303	Bacteria	107028
153	Ga0209051_1015704	3300025303	Bacteria	3469
154	Ga0209257_1000112	3300025304	Bacteria	234058
155	Ga0209257_1000305	3300025304	Bacteria	107001
156	Ga0209257_1011714	3300025304	Bacteria	4173
157	Ga0207696_1091769	3300025711	Unclassified	832
158	Ga0207710_10000643	3300025900	Bacteria	19814
159	Ga0207680_10053509	3300025903	Bacteria	2424
160	Ga0207680_10218027	3300025903	Unclassified	1307
161	Ga0207647_10068464	3300025904	Bacteria	2149
162	Ga0207647_10095278	3300025904	Bacteria	1772
163	Ga0207647_10348870	3300025904	Bacteria	838
164	Ga0207707_10003398	3300025912	Bacteria	14123
165	Ga0207707_10709280	3300025912	Unclassified	844
166	Ga0207695_10000884	3300025913	Bacteria	54443
167	Ga0207695_10002215	3300025913	Bacteria	29238
168	Ga0207695_11196457	3300025913	Bacteria	640
169	Ga0207671_10000151	3300025914	Bacteria	107659
170	Ga0207657_10655062	3300025919	Bacteria	817
171	Ga0207649_10431111	3300025920	Bacteria	992
172	Ga0207694_10013696	3300025924	Bacteria	6112
173	Ga0207694_10156408	3300025924	Bacteria	1839
174	Ga0207694_10498523	3300025924	Bacteria	1019
175	Ga0207644_10002059	3300025931	Bacteria	13018
176	Ga0207644_10126625	3300025931	Bacteria	1950
177	Ga0207690_10333309	3300025932	Bacteria	1196
178	Ga0207706_10036405	3300025933	Bacteria	4371
179	Ga0207706_10053390	3300025933	Bacteria	3568
180	Ga0207669_10596036	3300025937	Bacteria	897
181	Ga0207711_10052786	3300025941	Bacteria	3485
182	Ga0207661_10290199	3300025944	Bacteria	1464
183	Ga0207667_10704743	3300025949	Bacteria	1012
184	Ga0207712_10048458	3300025961	Unclassified	2956
185	Ga0207658_10004404	3300025986	Bacteria	9793
186	Ga0207703_10002203	3300026035	Bacteria	17110
187	Ga0207678_10005803	3300026067	Bacteria	11004
188	Ga0207678_10168485	3300026067	Bacteria	1870
189	Ga0207678_10429844	3300026067	Bacteria	1146
190	Ga0207708_11223651	3300026075	Unclassified	657
191	Ga0207702_10000068	3300026078	Bacteria	116478
192	Ga0207702_11737310	3300026078	Bacteria	616
193	Ga0207641_10004359	3300026088	Bacteria	12265
194	Ga0207648_10440048	3300026089	Bacteria	1186
195	Ga0207674_10444458	3300026116	Bacteria	1253
196	Ga0207674_11258386	3300026116	Bacteria	709
197	Ga0209281_1000042	3300027111	Bacteria	344748
198	Ga0209281_1039380	3300027111	Bacteria	802
199	Ga0209179_1017091	3300027512	Bacteria	1370
200	Ga0207428_10524737	3300027907	Bacteria	858
201	Ga0268266_10033572	3300028379	Bacteria	4362
202	Ga0268266_10333793	3300028379	Bacteria	1421
203	Ga0268264_10018933	3300028381	Bacteria	5629
204	Ga0307515_10012474	3300028794	Bacteria	15981
205	Ga0307515_10202158	3300028794	Bacteria	1859
206	Ga0316177_1200559	3300030731	Bacteria	1352
207	Ga0316183_1042014	3300030742	Bacteria	633
208	Ga0316182_1195901	3300030745	Bacteria	1007
209	Ga0307513_10355737	3300031456	Bacteria	1210
210	Ga0307508_10000466	3300031616	Bacteria	48802
211	Ga0307514_10008972	3300031649	Bacteria	8449
212	Ga0307416_101513939	3300032002	Unclassified	777
213	Ga0307411_12099988	3300032005	Bacteria	529
214	Ga0307507_10096556	3300033179	Bacteria	2499
215	Ga0395899_0034025	3300037312	Bacteria	3825
216	Ga0395899_0046221	3300037312	Bacteria	3243
217	Ga0395899_0100388	3300037312	Bacteria	2090
218	Ga0395900_0086054	3300037418	Bacteria	3230
219	Ga0395900_0106573	3300037418	Bacteria	2879
220	Ga0395898_0040616	3300037466	Bacteria	4599
221	Ga0395898_0065949	3300037466	Bacteria	3509
222	Ga0395898_0091377	3300037466	Bacteria	2929
223	Ga0395898_0161148	3300037466	Bacteria	2145
224	Ga0395901_0002882	3300038443	Bacteria	17358
225	Ga0395901_0024620	3300038443	Bacteria	6181
226	Ga0395901_0038124	3300038443	Bacteria	4971
227	Ga0395901_0204392	3300038443	Bacteria	2070
228	Ga0395901_0321342	3300038443	Bacteria	1601
229	Ga0436365_1202084	3300039437	Bacteria	661
230	Ga0436360_1201576	3300039438	Bacteria	555
231	Ga0436361_0335269	3300039447	Unclassified	1112
232	Ga0436361_0778766	3300039447	Bacteria	4499
233	Ga0439436_0008284	3300041404	Plasmid	3194
234	Ga0439436_0043963	3300041404	Bacteria	1273
235	Ga0439439_0189951	3300041406	Bacteria	594
236	Ga0439461_0002027	3300041410	Bacteria	3201
237	Ga0439465_0000667	3300041413	Bacteria	10503
238	Ga0451802_0193982	3300041460	Bacteria	962
239	Ga0451802_2084435	3300041460	Unclassified	839
240	Ga0451807_0773450	3300041486	Bacteria	699
241	Ga0451807_1036128	3300041486	Unclassified	707
242	Ga0439431_0000187	3300041997	Bacteria	12043
243	Ga0439445_0000562	3300042004	Bacteria	7575
244	Ga0439445_0016074	3300042004	Unclassified	1838
245	Ga0439448_0003467	3300042005	Bacteria	4370
246	Ga0439448_0005772	3300042005	Bacteria	3536
247	Ga0439432_104868	3300042006	Unclassified	844
248	Ga0439449_0000666	3300042007	Bacteria	13010
249	Ga0439452_136369	3300042010	Bacteria	519
250	Ga0439455_0000109	3300042012	Bacteria	8273
251	Ga0439455_0002132	3300042012	Bacteria	3535
252	Ga0439462_0099628	3300042015	Bacteria	800
253	Ga0450919_000747	3300042121	Bacteria	4128
254	Ga0450920_001278	3300042122	Bacteria	4142
255	Ga0439458_0000986	3300042157	Bacteria	7274
256	Ga0439434_0000613	3300042435	Bacteria	10275
257	Ga0450918_000112	3300042531	Bacteria	17468
258	Ga0466969_0043235	3300044656	Bacteria	2245
259	Ga0466965_0007665	3300044683	Bacteria	4967
260	Ga0466961_0035273	3300044693	Bacteria	3212
261	Ga0466964_0291313	3300044706	Bacteria	819
262	Ga0466971_0014480	3300044719	Bacteria	3470
263	Ga0466968_0547053	3300044735	Bacteria	580
264	Ga0466970_0109859	3300044765	Bacteria	1505
265	Ga0466957_0012531	3300044842	Bacteria	4907
266	Ga0466959_0025936	3300045049	Bacteria	4346
267	Ga0466958_0048515	3300045836	Bacteria	2566
268	Ga0466967_0397222	3300045976	Bacteria	1341
269	Ga0495649_0067405	3300046694	Bacteria	1920
270	Ga0495600_0702251	3300046809	Bacteria	608
271	Ga0495672_0049596	3300047320	Bacteria	2484
272	Ga0495687_079135	3300047443	Bacteria	1293
273	Ga0496100_0239443	3300048903	Bacteria	1338
274	Ga0496100_0606455	3300048903	Unclassified	850
275	Ga0496101_0142088	3300048904	Bacteria	1830
276	Ga0496102_0190585	3300048905	Unclassified	1932
277	Ga0496104_0028131	3300048907	Bacteria	5209
278	Ga0496105_0003497	3300048908	Bacteria	11633
279	Ga0496106_0036929	3300048909	Bacteria	3654
280	Ga0496106_0082739	3300048909	Bacteria	2468
281	Ga0496106_0111003	3300048909	Unclassified	2135
282	Ga0496107_0046940	3300048910	Bacteria	3109
283	Ga0496108_0148847	3300048911	Bacteria	2020
284	Ga0496112_0410358	3300048915	Unclassified	1294
285	Ga0496114_0000500	3300048917	Bacteria	28638
286	Ga0496115_0067553	3300048918	Bacteria	2892
287	Ga0496115_0411597	3300048918	Bacteria	1096
288	Ga0496115_1109556	3300048918	Unclassified	599
289	Ga0496117_0017438	3300048920	Bacteria	5994
290	Ga0496117_0034119	3300048920	Bacteria	3840
291	Ga0496117_0071006	3300048920	Bacteria	2335
292	Ga0496117_0260982	3300048920	Bacteria	939
293	Ga0496118_0000952	3300048921	Bacteria	45278
294	Ga0496118_0003685	3300048921	Bacteria	18985
295	Ga0496119_0000149	3300048922	Bacteria	97430
296	Ga0496120_0000055	3300048923	Bacteria	180856
297	Ga0496121_0000101	3300048924	Bacteria	195984
298	Ga0496121_0007549	3300048924	Bacteria	13105
299	Ga0496121_0035777	3300048924	Bacteria	4440
300	Ga0496121_0055153	3300048924	Bacteria	3313
301	Ga0496121_0233800	3300048924	Bacteria	1285
302	Ga0496121_0275704	3300048924	Unclassified	1153
303	Ga0496122_0232722	3300048925	Bacteria	1046
304	Ga0496123_0169748	3300048926	Bacteria	1152
305	Ga0496124_0000020	3300048927	Bacteria	434107
306	Ga0496124_0431161	3300048927	Bacteria	905
307	Ga0496124_0529029	3300048927	Unclassified	783
308	Ga0496125_0003852	3300048928	Bacteria	17788
309	Ga0496126_0001634	3300048929	Bacteria	33894
310	Ga0496126_0082257	3300048929	Bacteria	2845
311	Ga0496126_0308701	3300048929	Bacteria	1303
312	Ga0501031_0124610	3300049568	Bacteria	1683
313	Ga0501031_0370191	3300049568	Bacteria	927
314	Ga0501032_0041622	3300049569	Bacteria	3119
315	Ga0501033_0027120	3300049570	Bacteria	4309
316	Ga0501033_0187478	3300049570	Bacteria	1481
317	Ga0501033_0673952	3300049570	Bacteria	705
318	Ga0501034_0778815	3300049571	Bacteria	850
319	Ga0501036_0012532	3300049572	Bacteria	7031
320	Ga0501036_0344638	3300049572	Bacteria	1244
321	Ga0501036_0799843	3300049572	Bacteria	776
322	Ga0501037_0119422	3300049573	Bacteria	1896
323	Ga0501038_0082018	3300049574	Bacteria	2716
324	Ga0501038_0310533	3300049574	Bacteria	1236
325	Ga0501043_0033183	3300049579	Bacteria	4060
326	Ga0501043_0072085	3300049579	Bacteria	2713
327	Ga0501043_0149617	3300049579	Bacteria	1827
328	Ga0501043_0330887	3300049579	Bacteria	1160
329	Ga0501046_0083420	3300049580	Bacteria	2467
330	Ga0501047_0002051	3300049581	Bacteria	19259
331	Ga0501047_0069689	3300049581	Bacteria	3386
332	Ga0501047_0094800	3300049581	Bacteria	2863
333	Ga0501047_0755467	3300049581	Bacteria	788
334	Ga0501070_0453249	3300049586	Bacteria	1034
335	Ga0501235_225341	3300049669	Bacteria	516
336	Ga0501239_067394	3300049672	Bacteria	550
337	Ga0501253_182744	3300049683	Bacteria	546
338	Ga0501241_039369	3300049758	Bacteria	912
339	Ga0501035_0010831	3300049822	Bacteria	8445
340	Ga0501035_0017914	3300049822	Bacteria	6532
341	Ga0501035_0113943	3300049822	Bacteria	2368
342	Ga0501044_0033120	3300049823	Bacteria	5430
343	Ga0501044_0135573	3300049823	Bacteria	2453
344	Ga0501044_0154895	3300049823	Bacteria	2271
345	nmdc:mga03683_566077_c1	3300050489	Bacteria	554
346	nmdc:mga03n38_149847_c1	3300050490	Bacteria	1173
347	nmdc:mga03n38_5851_c1	3300050490	Bacteria	4224
348	nmdc:mga0yw44_1320_c1	3300050492	Bacteria	9797
349	nmdc:mga0k408_502045_c1	3300050493	Bacteria	719
350	nmdc:mga0k408_76067_c1	3300050493	Bacteria	1962
351	nmdc:mga06z11_113377_c1	3300050494	Bacteria	1504
352	nmdc:mga06z11_443409_c1	3300050494	Bacteria	784
353	nmdc:mga07m45_134066_c1	3300050496	Bacteria	1433
354	nmdc:mga07m45_266823_c1	3300050496	Bacteria	996
355	nmdc:mga07m45_357273_c1	3300050496	Bacteria	849
356	nmdc:mga05p37_822489_c1	3300050507	Bacteria	1013
357	nmdc:mga08y16_1036201_c1	3300050511	Bacteria	799
358	nmdc:mga0a205_58244_c1	3300050515	Bacteria	3731
359	nmdc:mga0sz30_11620_c1	3300050516	Bacteria	806
360	Ga0500566_0003780	3300053094	Bacteria	9033
361	Ga0500593_280853	3300053117	Bacteria	544
362	Ga0500658_0001085	3300053134	Bacteria	11126
363	Ga0500604_0255728	3300053151	Bacteria	606
364	Ga0466962_0004170	3300061719	Bacteria	6926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300026075	Ga0207708_11223651	Ga0207708_112236512	121
2	3300042010	Ga0439452_136369	Ga0439452_136369_95_499	129
3	3300053151	Ga0500604_0255728	Ga0500604_0255728_163_567	129
4	iso_pu_bacteria	2537561836	2538834979	130
5	iso_pu_bacteria	2643221562	2643828556	130
6	iso_pu_bacteria	2643221577	2643896189	130
7	iso_pu_bacteria	2643221644	2644247778	130
8	iso_pu_bacteria	2643221685	2644478400	130
9	iso_pu_bacteria	2895395659	2895397926	130
10	3300005334	Ga0068869_101532576	Ga0068869_1015325761	133
11	3300005335	Ga0070666_10152228	Ga0070666_101522282	133
12	3300005339	Ga0070660_100880382	Ga0070660_1008803822	133
13	3300005355	Ga0070671_100030999	Ga0070671_1000309993	133
14	3300005356	Ga0070674_100629022	Ga0070674_1006290222	133
15	3300005366	Ga0070659_100254525	Ga0070659_1002545252	133
16	3300005455	Ga0070663_100198417	Ga0070663_1001984172	133
17	3300005457	Ga0070662_100041043	Ga0070662_1000410434	133
18	3300005564	Ga0070664_100586416	Ga0070664_1005864162	133
19	3300006195	Ga0075366_10041128	Ga0075366_100411282	133
20	3300006353	Ga0075370_10104550	Ga0075370_101045502	133
21	3300009094	Ga0111539_10595469	Ga0111539_105954692	133
22	3300009551	Ga0105238_10047850	Ga0105238_100478506	133
23	3300011119	Ga0105246_10123298	Ga0105246_101232983	133
24	3300013100	Ga0157373_10043196	Ga0157373_100431964	133
25	3300025903	Ga0207680_10053509	Ga0207680_100535092	133
26	3300025904	Ga0207647_10095278	Ga0207647_100952783	133
27	3300025904	Ga0207647_10348870	Ga0207647_103488702	133
28	3300025919	Ga0207657_10655062	Ga0207657_106550621	133
29	3300025924	Ga0207694_10156408	Ga0207694_101564083	133
30	3300025931	Ga0207644_10126625	Ga0207644_101266252	133
31	3300025932	Ga0207690_10333309	Ga0207690_103333092	133
32	3300025933	Ga0207706_10036405	Ga0207706_100364057	133
33	3300025933	Ga0207706_10053390	Ga0207706_100533903	133
34	3300025937	Ga0207669_10596036	Ga0207669_105960362	133
35	3300026067	Ga0207678_10429844	Ga0207678_104298442	133
36	3300027907	Ga0207428_10524737	Ga0207428_105247372	133
37	3300041460	Ga0451802_0193982	Ga0451802_0193982_153_560	133
38	3300041486	Ga0451807_1036128	Ga0451807_1036128_199_600	133
39	3300042005	Ga0439448_0003467	Ga0439448_0003467_3843_4244	133
40	3300042005	Ga0439448_0005772	Ga0439448_0005772_314_715	133
41	3300042012	Ga0439455_0000109	Ga0439455_0000109_7259_7660	133
42	3300042012	Ga0439455_0002132	Ga0439455_0002132_2450_2851	133
43	3300042157	Ga0439458_0000986	Ga0439458_0000986_6790_7191	133
44	3300046694	Ga0495649_0067405	Ga0495649_0067405_1109_1510	133
45	3300047443	Ga0495687_079135	Ga0495687_079135_435_836	133
46	3300050493	nmdc:mga0k408_76067_c1	nmdc:mga0k408_76067_c1_236_637	133
47	3300050496	nmdc:mga07m45_266823_c1	nmdc:mga07m45_266823_c1_376_777	133
48	3300050511	nmdc:mga08y16_1036201_c1	nmdc:mga08y16_1036201_c1_169_570	133
49	3300002067	JGI24735J21928_10042753	JGI24735J21928_100427532	134
50	3300002704	JGI25155J39150_1000002	JGI25155J39150_1000002209	134
51	3300002705	JGI25156J39149_1000003	JGI25156J39149_100000397	134
52	3300002738	JGI25154J39366_1000009	JGI25154J39366_1000009209	134
53	3300002741	JGI25157J39369_1000002	JGI25157J39369_1000002209	134
54	3300003203	JGI25406J46586_10031557	JGI25406J46586_100315572	134
55	3300003322	rootL2_10010810	rootL2_100108106	134
56	3300003322	rootL2_10128842	rootL2_101288422	134
57	3300003374	JGI25161J50226_1024474	JGI25161J50226_10244741	134
58	3300003659	JGI25404J52841_10001897	JGI25404J52841_100018974	134
59	3300003771	Ga0055526_1005920	Ga0055526_10059202	134
60	3300003773	Ga0055537_1000008	Ga0055537_1000008113	134
61	3300003775	Ga0055524_1000080	Ga0055524_100008097	134
62	3300003775	Ga0055524_1000083	Ga0055524_100008355	134
63	3300003781	Ga0055536_1007317	Ga0055536_10073173	134
64	3300003781	Ga0055536_1027621	Ga0055536_10276213	134
65	3300003784	Ga0055534_1001365	Ga0055534_100136513	134
66	3300003790	Ga0055528_1000652	Ga0055528_100065211	134
67	3300003792	Ga0055540_1002305	Ga0055540_100230510	134
68	3300003792	Ga0055540_1070908	Ga0055540_10709081	134
69	3300003794	Ga0055531_10000289	Ga0055531_1000028924	134
70	3300003794	Ga0055531_10001904	Ga0055531_100019046	134
71	3300005262	Ga0065165_1001164	Ga0065165_100116426	134
72	3300005262	Ga0065165_1070823	Ga0065165_10708232	134
73	3300005262	Ga0065165_1153594	Ga0065165_11535941	134
74	3300005329	Ga0070683_100123382	Ga0070683_1001233821	134
75	3300005335	Ga0070666_10133569	Ga0070666_101335692	134
76	3300005337	Ga0070682_100028537	Ga0070682_1000285374	134
77	3300005341	Ga0070691_10040237	Ga0070691_100402373	134
78	3300005344	Ga0070661_100069357	Ga0070661_1000693573	134
79	3300005355	Ga0070671_100000961	Ga0070671_1000009619	134
80	3300005367	Ga0070667_100065031	Ga0070667_1000650313	134
81	3300005455	Ga0070663_100025688	Ga0070663_1000256881	134
82	3300005455	Ga0070663_101276804	Ga0070663_1012768041	134
83	3300005458	Ga0070681_10325342	Ga0070681_103253422	134
84	3300005530	Ga0070679_100136786	Ga0070679_1001367862	134
85	3300005544	Ga0070686_100182989	Ga0070686_1001829892	134
86	3300005546	Ga0070696_100119398	Ga0070696_1001193983	134
87	3300005548	Ga0070665_100009118	Ga0070665_1000091183	134
88	3300005548	Ga0070665_100307779	Ga0070665_1003077792	134
89	3300005563	Ga0068855_100026982	Ga0068855_1000269826	134
90	3300005577	Ga0068857_100617091	Ga0068857_1006170912	134
91	3300005578	Ga0068854_100246978	Ga0068854_1002469782	134
92	3300005614	Ga0068856_100000307	Ga0068856_1000003075	134
93	3300005617	Ga0068859_100000863	Ga0068859_10000086319	134
94	3300005841	Ga0068863_100002530	Ga0068863_1000025304	134
95	3300005841	Ga0068863_100154113	Ga0068863_1001541133	134
96	3300005842	Ga0068858_100002069	Ga0068858_1000020697	134
97	3300005843	Ga0068860_100312714	Ga0068860_1003127142	134
98	3300005937	Ga0081455_10472631	Ga0081455_104726312	134
99	3300005983	Ga0081540_1000015	Ga0081540_100001597	134
100	3300005985	Ga0081539_10001361	Ga0081539_100013613	134
101	3300006038	Ga0075365_10011841	Ga0075365_100118413	134
102	3300006048	Ga0075363_100017022	Ga0075363_1000170226	134
103	3300006048	Ga0075363_100064114	Ga0075363_1000641142	134
104	3300006177	Ga0075362_10011334	Ga0075362_100113343	134
105	3300006178	Ga0075367_10131421	Ga0075367_101314212	134
106	3300006178	Ga0075367_10402751	Ga0075367_104027512	134
107	3300006186	Ga0075369_10270331	Ga0075369_102703312	134
108	3300006195	Ga0075366_10311906	Ga0075366_103119062	134
109	3300006353	Ga0075370_10024494	Ga0075370_100244943	134
110	3300006353	Ga0075370_10698133	Ga0075370_106981332	134
111	3300006844	Ga0075428_100428056	Ga0075428_1004280562	134
112	3300006852	Ga0075433_10037932	Ga0075433_100379325	134
113	3300006931	Ga0097620_100000863	Ga0097620_1000008639	134
114	3300006946	Ga0079104_1000017	Ga0079104_1000017231	134
115	3300006946	Ga0079104_1062154	Ga0079104_10621542	134
116	3300007265	Ga0099794_10062589	Ga0099794_100625892	134
117	3300009092	Ga0105250_10018421	Ga0105250_100184212	134
118	3300009093	Ga0105240_10000625	Ga0105240_1000062537	134
119	3300009093	Ga0105240_10065738	Ga0105240_100657385	134
120	3300009093	Ga0105240_11711104	Ga0105240_117111042	134
121	3300009101	Ga0105247_10001207	Ga0105247_100012078	134
122	3300009147	Ga0114129_10874264	Ga0114129_108742642	134
123	3300009174	Ga0105241_10499602	Ga0105241_104996021	134
124	3300009177	Ga0105248_10042167	Ga0105248_100421674	134
125	3300009545	Ga0105237_10000108	Ga0105237_1000010873	134
126	3300009545	Ga0105237_12009924	Ga0105237_120099241	134
127	3300009551	Ga0105238_10054107	Ga0105238_100541074	134
128	3300009551	Ga0105238_10119434	Ga0105238_101194344	134
129	3300009551	Ga0105238_12868075	Ga0105238_128680751	134
130	3300009553	Ga0105249_10750075	Ga0105249_107500752	134
131	3300010159	Ga0099796_10042076	Ga0099796_100420762	134
132	3300010375	Ga0105239_10000054	Ga0105239_1000005427	134
133	3300013100	Ga0157373_10082028	Ga0157373_100820284	134
134	3300013102	Ga0157371_10104123	Ga0157371_101041234	134
135	3300013102	Ga0157371_10111737	Ga0157371_101117374	134
136	3300013102	Ga0157371_10853141	Ga0157371_108531412	134
137	3300013104	Ga0157370_10203503	Ga0157370_102035033	134
138	3300013104	Ga0157370_10759481	Ga0157370_107594811	134
139	3300013104	Ga0157370_11362664	Ga0157370_113626642	134
140	3300013105	Ga0157369_10161037	Ga0157369_101610373	134
141	3300013105	Ga0157369_11191147	Ga0157369_111911472	134
142	3300013296	Ga0157374_11133679	Ga0157374_111336791	134
143	3300013307	Ga0157372_10409949	Ga0157372_104099493	134
144	3300013307	Ga0157372_10433580	Ga0157372_104335802	134
145	3300013307	Ga0157372_11176325	Ga0157372_111763252	134
146	3300014325	Ga0163163_10022313	Ga0163163_100223135	134
147	3300014497	Ga0182008_10123171	Ga0182008_101231713	134
148	3300015261	Ga0182006_1068639	Ga0182006_10686393	134
149	3300020069	Ga0197907_10395020	Ga0197907_103950202	134
150	3300020070	Ga0206356_10766623	Ga0206356_107666233	134
151	3300020078	Ga0206352_10750473	Ga0206352_107504733	134
152	3300020080	Ga0206350_11039141	Ga0206350_110391411	134
153	3300020081	Ga0206354_10386948	Ga0206354_103869483	134
154	3300020081	Ga0206354_10759292	Ga0206354_107592922	134
155	3300020082	Ga0206353_10630617	Ga0206353_106306173	134
156	3300020082	Ga0206353_11131310	Ga0206353_111313103	134
157	3300020610	Ga0154015_1144485	Ga0154015_11444852	134
158	3300021361	Ga0213872_10065724	Ga0213872_100657242	134
159	3300022467	Ga0224712_10022282	Ga0224712_100222823	134
160	3300025206	Ga0209435_100001	Ga0209435_100001508	134
161	3300025246	Ga0209646_1000001	Ga0209646_1000001877	134
162	3300025246	Ga0209646_1006696	Ga0209646_10066963	134
163	3300025250	Ga0209026_1000003	Ga0209026_1000003508	134
164	3300025250	Ga0209026_1000061	Ga0209026_100006153	134
165	3300025256	Ga0209759_1000001	Ga0209759_1000001508	134
166	3300025256	Ga0209759_1004850	Ga0209759_10048504	134
167	3300025256	Ga0209759_1027330	Ga0209759_10273303	134
168	3300025263	Ga0209565_1000004	Ga0209565_1000004699	134
169	3300025263	Ga0209565_1007674	Ga0209565_10076742	134
170	3300025272	Ga0209455_1000111	Ga0209455_100011150	134
171	3300025273	Ga0209673_1000074	Ga0209673_100007483	134
172	3300025273	Ga0209673_1017541	Ga0209673_10175414	134
173	3300025273	Ga0209673_1046248	Ga0209673_10462482	134
174	3300025284	Ga0209130_1003325	Ga0209130_100332510	134
175	3300025291	Ga0209675_1000044	Ga0209675_1000044122	134
176	3300025291	Ga0209675_1002215	Ga0209675_100221511	134
177	3300025291	Ga0209675_1005124	Ga0209675_10051241	134
178	3300025292	Ga0209676_1005983	Ga0209676_10059836	134
179	3300025295	Ga0209564_1000470	Ga0209564_100047017	134
180	3300025295	Ga0209564_1056389	Ga0209564_10563892	134
181	3300025298	Ga0209050_1000102	Ga0209050_1000102191	134
182	3300025298	Ga0209050_1052673	Ga0209050_10526732	134
183	3300025299	Ga0209256_1000001	Ga0209256_1000001268	134
184	3300025299	Ga0209256_1000011	Ga0209256_1000011664	134
185	3300025303	Ga0209051_1000196	Ga0209051_100019613	134
186	3300025303	Ga0209051_1015704	Ga0209051_10157046	134
187	3300025304	Ga0209257_1000112	Ga0209257_1000112191	134
188	3300025304	Ga0209257_1000305	Ga0209257_1000305106	134
189	3300025304	Ga0209257_1011714	Ga0209257_10117146	134
190	3300025711	Ga0207696_1091769	Ga0207696_10917691	134
191	3300025900	Ga0207710_10000643	Ga0207710_100006438	134
192	3300025903	Ga0207680_10218027	Ga0207680_102180271	134
193	3300025904	Ga0207647_10068464	Ga0207647_100684643	134
194	3300025912	Ga0207707_10003398	Ga0207707_100033982	134
195	3300025912	Ga0207707_10709280	Ga0207707_107092802	134
196	3300025913	Ga0207695_10000884	Ga0207695_1000088427	134
197	3300025913	Ga0207695_10002215	Ga0207695_1000221533	134
198	3300025913	Ga0207695_11196457	Ga0207695_111964572	134
199	3300025914	Ga0207671_10000151	Ga0207671_1000015147	134
200	3300025920	Ga0207649_10431111	Ga0207649_104311112	134
201	3300025924	Ga0207694_10013696	Ga0207694_100136966	134
202	3300025924	Ga0207694_10498523	Ga0207694_104985233	134
203	3300025931	Ga0207644_10002059	Ga0207644_100020598	134
204	3300025941	Ga0207711_10052786	Ga0207711_100527864	134
205	3300025944	Ga0207661_10290199	Ga0207661_102901993	134
206	3300025949	Ga0207667_10704743	Ga0207667_107047432	134
207	3300025961	Ga0207712_10048458	Ga0207712_100484582	134
208	3300025986	Ga0207658_10004404	Ga0207658_100044044	134
209	3300026035	Ga0207703_10002203	Ga0207703_100022038	134
210	3300026067	Ga0207678_10005803	Ga0207678_100058033	134
211	3300026067	Ga0207678_10168485	Ga0207678_101684853	134
212	3300026078	Ga0207702_10000068	Ga0207702_1000006878	134
213	3300026078	Ga0207702_11737310	Ga0207702_117373101	134
214	3300026088	Ga0207641_10004359	Ga0207641_100043595	134
215	3300026089	Ga0207648_10440048	Ga0207648_104400482	134
216	3300026116	Ga0207674_10444458	Ga0207674_104444582	134
217	3300026116	Ga0207674_11258386	Ga0207674_112583862	134
218	3300027111	Ga0209281_1000042	Ga0209281_1000042118	134
219	3300027111	Ga0209281_1039380	Ga0209281_10393802	134
220	3300027512	Ga0209179_1017091	Ga0209179_10170912	134
221	3300028379	Ga0268266_10033572	Ga0268266_100335723	134
222	3300028379	Ga0268266_10333793	Ga0268266_103337931	134
223	3300028381	Ga0268264_10018933	Ga0268264_100189333	134
224	3300028794	Ga0307515_10012474	Ga0307515_100124743	134
225	3300028794	Ga0307515_10202158	Ga0307515_102021582	134
226	3300030731	Ga0316177_1200559	Ga0316177_12005592	134
227	3300030742	Ga0316183_1042014	Ga0316183_10420141	134
228	3300030745	Ga0316182_1195901	Ga0316182_11959012	134
229	3300031456	Ga0307513_10355737	Ga0307513_103557372	134
230	3300031616	Ga0307508_10000466	Ga0307508_1000046613	134
231	3300031649	Ga0307514_10008972	Ga0307514_100089724	134
232	3300032002	Ga0307416_101513939	Ga0307416_1015139392	134
233	3300032005	Ga0307411_12099988	Ga0307411_120999881	134
234	3300033179	Ga0307507_10096556	Ga0307507_100965562	134
235	3300037312	Ga0395899_0034025	Ga0395899_0034025_2306_2716	134
236	3300037312	Ga0395899_0046221	Ga0395899_0046221_1774_2178	134
237	3300037312	Ga0395899_0100388	Ga0395899_0100388_290_694	134
238	3300037418	Ga0395900_0086054	Ga0395900_0086054_519_923	134
239	3300037418	Ga0395900_0106573	Ga0395900_0106573_1888_2292	134
240	3300037466	Ga0395898_0040616	Ga0395898_0040616_751_1155	134
241	3300037466	Ga0395898_0065949	Ga0395898_0065949_1717_2121	134
242	3300037466	Ga0395898_0091377	Ga0395898_0091377_1812_2216	134
243	3300037466	Ga0395898_0161148	Ga0395898_0161148_1379_1789	134
244	3300038443	Ga0395901_0002882	Ga0395901_0002882_6339_6743	134
245	3300038443	Ga0395901_0024620	Ga0395901_0024620_4624_5034	134
246	3300038443	Ga0395901_0038124	Ga0395901_0038124_975_1379	134
247	3300038443	Ga0395901_0204392	Ga0395901_0204392_1424_1828	134
248	3300038443	Ga0395901_0321342	Ga0395901_0321342_992_1396	134
249	3300039437	Ga0436365_1202084	Ga0436365_1202084_176_580	134
250	3300039438	Ga0436360_1201576	Ga0436360_1201576_95_499	134
251	3300039447	Ga0436361_0335269	Ga0436361_0335269_137_541	134
252	3300039447	Ga0436361_0778766	Ga0436361_0778766_3102_3506	134
253	3300041404	Ga0439436_0008284	Ga0439436_0008284_477_881	134
254	3300041404	Ga0439436_0043963	Ga0439436_0043963_106_510	134
255	3300041406	Ga0439439_0189951	Ga0439439_0189951_79_483	134
256	3300041410	Ga0439461_0002027	Ga0439461_0002027_2308_2712	134
257	3300041413	Ga0439465_0000667	Ga0439465_0000667_3411_3815	134
258	3300041460	Ga0451802_2084435	Ga0451802_2084435_93_497	134
259	3300041486	Ga0451807_0773450	Ga0451807_0773450_69_473	134
260	3300041997	Ga0439431_0000187	Ga0439431_0000187_4875_5279	134
261	3300042004	Ga0439445_0000562	Ga0439445_0000562_1981_2385	134
262	3300042004	Ga0439445_0016074	Ga0439445_0016074_1125_1529	134
263	3300042006	Ga0439432_104868	Ga0439432_104868_361_765	134
264	3300042007	Ga0439449_0000666	Ga0439449_0000666_6673_7077	134
265	3300042015	Ga0439462_0099628	Ga0439462_0099628_229_633	134
266	3300042121	Ga0450919_000747	Ga0450919_000747_1641_2045	134
267	3300042122	Ga0450920_001278	Ga0450920_001278_2451_2855	134
268	3300042435	Ga0439434_0000613	Ga0439434_0000613_5037_5441	134
269	3300042531	Ga0450918_000112	Ga0450918_000112_9894_10298	134
270	3300044656	Ga0466969_0043235	Ga0466969_0043235_1243_1647	134
271	3300044683	Ga0466965_0007665	Ga0466965_0007665_1957_2361	134
272	3300044693	Ga0466961_0035273	Ga0466961_0035273_385_789	134
273	3300044706	Ga0466964_0291313	Ga0466964_0291313_153_557	134
274	3300044719	Ga0466971_0014480	Ga0466971_0014480_1507_1911	134
275	3300044735	Ga0466968_0547053	Ga0466968_0547053_111_515	134
276	3300044765	Ga0466970_0109859	Ga0466970_0109859_431_835	134
277	3300044842	Ga0466957_0012531	Ga0466957_0012531_2835_3239	134
278	3300045049	Ga0466959_0025936	Ga0466959_0025936_1379_1783	134
279	3300045836	Ga0466958_0048515	Ga0466958_0048515_1260_1664	134
280	3300045976	Ga0466967_0397222	Ga0466967_0397222_458_862	134
281	3300046809	Ga0495600_0702251	Ga0495600_0702251_116_577	134
282	3300047320	Ga0495672_0049596	Ga0495672_0049596_408_956	134
283	3300048903	Ga0496100_0239443	Ga0496100_0239443_821_1225	134
284	3300048903	Ga0496100_0606455	Ga0496100_0606455_392_796	134
285	3300048904	Ga0496101_0142088	Ga0496101_0142088_513_917	134
286	3300048905	Ga0496102_0190585	Ga0496102_0190585_1454_1858	134
287	3300048907	Ga0496104_0028131	Ga0496104_0028131_3969_4373	134
288	3300048908	Ga0496105_0003497	Ga0496105_0003497_8003_8407	134
289	3300048909	Ga0496106_0036929	Ga0496106_0036929_2251_2655	134
290	3300048909	Ga0496106_0082739	Ga0496106_0082739_175_579	134
291	3300048909	Ga0496106_0111003	Ga0496106_0111003_875_1279	134
292	3300048910	Ga0496107_0046940	Ga0496107_0046940_977_1381	134
293	3300048911	Ga0496108_0148847	Ga0496108_0148847_658_1062	134
294	3300048915	Ga0496112_0410358	Ga0496112_0410358_771_1175	134
295	3300048917	Ga0496114_0000500	Ga0496114_0000500_335_739	134
296	3300048918	Ga0496115_0067553	Ga0496115_0067553_981_1385	134
297	3300048918	Ga0496115_0411597	Ga0496115_0411597_235_639	134
298	3300048918	Ga0496115_1109556	Ga0496115_1109556_128_532	134
299	3300048920	Ga0496117_0017438	Ga0496117_0017438_2624_3028	134
300	3300048920	Ga0496117_0034119	Ga0496117_0034119_749_1153	134
301	3300048920	Ga0496117_0071006	Ga0496117_0071006_285_689	134
302	3300048920	Ga0496117_0260982	Ga0496117_0260982_271_675	134
303	3300048921	Ga0496118_0000952	Ga0496118_0000952_30615_31019	134
304	3300048921	Ga0496118_0003685	Ga0496118_0003685_2967_3371	134
305	3300048922	Ga0496119_0000149	Ga0496119_0000149_27280_27684	134
306	3300048923	Ga0496120_0000055	Ga0496120_0000055_157066_157470	134
307	3300048924	Ga0496121_0000101	Ga0496121_0000101_34577_34981	134
308	3300048924	Ga0496121_0007549	Ga0496121_0007549_2417_2821	134
309	3300048924	Ga0496121_0035777	Ga0496121_0035777_1939_2343	134
310	3300048924	Ga0496121_0055153	Ga0496121_0055153_2055_2459	134
311	3300048924	Ga0496121_0233800	Ga0496121_0233800_440_844	134
312	3300048924	Ga0496121_0275704	Ga0496121_0275704_689_1093	134
313	3300048925	Ga0496122_0232722	Ga0496122_0232722_393_797	134
314	3300048926	Ga0496123_0169748	Ga0496123_0169748_687_1091	134
315	3300048927	Ga0496124_0000020	Ga0496124_0000020_64410_64817	134
316	3300048927	Ga0496124_0431161	Ga0496124_0431161_398_802	134
317	3300048927	Ga0496124_0529029	Ga0496124_0529029_316_720	134
318	3300048928	Ga0496125_0003852	Ga0496125_0003852_2654_3058	134
319	3300048929	Ga0496126_0001634	Ga0496126_0001634_2841_3245	134
320	3300048929	Ga0496126_0082257	Ga0496126_0082257_2384_2788	134
321	3300048929	Ga0496126_0308701	Ga0496126_0308701_245_709	134
322	3300049568	Ga0501031_0124610	Ga0501031_0124610_636_1043	134
323	3300049568	Ga0501031_0370191	Ga0501031_0370191_464_868	134
324	3300049569	Ga0501032_0041622	Ga0501032_0041622_967_1374	134
325	3300049570	Ga0501033_0027120	Ga0501033_0027120_3260_3667	134
326	3300049570	Ga0501033_0187478	Ga0501033_0187478_341_748	134
327	3300049570	Ga0501033_0673952	Ga0501033_0673952_227_631	134
328	3300049571	Ga0501034_0778815	Ga0501034_0778815_11_418	134
329	3300049572	Ga0501036_0012532	Ga0501036_0012532_6117_6524	134
330	3300049572	Ga0501036_0344638	Ga0501036_0344638_820_1224	134
331	3300049572	Ga0501036_0799843	Ga0501036_0799843_193_597	134
332	3300049573	Ga0501037_0119422	Ga0501037_0119422_791_1198	134
333	3300049574	Ga0501038_0082018	Ga0501038_0082018_1928_2335	134
334	3300049574	Ga0501038_0310533	Ga0501038_0310533_741_1145	134
335	3300049579	Ga0501043_0033183	Ga0501043_0033183_2870_3277	134
336	3300049579	Ga0501043_0072085	Ga0501043_0072085_1439_1846	134
337	3300049579	Ga0501043_0149617	Ga0501043_0149617_1370_1774	134
338	3300049579	Ga0501043_0330887	Ga0501043_0330887_449_853	134
339	3300049580	Ga0501046_0083420	Ga0501046_0083420_907_1311	134
340	3300049581	Ga0501047_0002051	Ga0501047_0002051_9492_9896	134
341	3300049581	Ga0501047_0069689	Ga0501047_0069689_567_974	134
342	3300049581	Ga0501047_0094800	Ga0501047_0094800_1607_2014	134
343	3300049581	Ga0501047_0755467	Ga0501047_0755467_85_489	134
344	3300049586	Ga0501070_0453249	Ga0501070_0453249_399_806	134
345	3300049669	Ga0501235_225341	Ga0501235_225341_41_445	134
346	3300049672	Ga0501239_067394	Ga0501239_067394_103_507	134
347	3300049683	Ga0501253_182744	Ga0501253_182744_38_442	134
348	3300049758	Ga0501241_039369	Ga0501241_039369_472_876	134
349	3300049822	Ga0501035_0010831	Ga0501035_0010831_1110_1514	134
350	3300049822	Ga0501035_0017914	Ga0501035_0017914_5069_5476	134
351	3300049822	Ga0501035_0113943	Ga0501035_0113943_881_1288	134
352	3300049823	Ga0501044_0033120	Ga0501044_0033120_3524_3931	134
353	3300049823	Ga0501044_0135573	Ga0501044_0135573_812_1216	134
354	3300049823	Ga0501044_0154895	Ga0501044_0154895_11_418	134
355	3300050489	nmdc:mga03683_566077_c1	nmdc:mga03683_566077_c1_61_465	134
356	3300050490	nmdc:mga03n38_149847_c1	nmdc:mga03n38_149847_c1_362_766	134
357	3300050490	nmdc:mga03n38_5851_c1	nmdc:mga03n38_5851_c1_2448_2852	134
358	3300050492	nmdc:mga0yw44_1320_c1	nmdc:mga0yw44_1320_c1_3809_4213	134
359	3300050493	nmdc:mga0k408_502045_c1	nmdc:mga0k408_502045_c1_89_493	134
360	3300050494	nmdc:mga06z11_113377_c1	nmdc:mga06z11_113377_c1_715_1119	134
361	3300050494	nmdc:mga06z11_443409_c1	nmdc:mga06z11_443409_c1_67_471	134
362	3300050496	nmdc:mga07m45_134066_c1	nmdc:mga07m45_134066_c1_880_1284	134
363	3300050496	nmdc:mga07m45_357273_c1	nmdc:mga07m45_357273_c1_355_759	134
364	3300050507	nmdc:mga05p37_822489_c1	nmdc:mga05p37_822489_c1_275_694	134
365	3300050515	nmdc:mga0a205_58244_c1	nmdc:mga0a205_58244_c1_354_758	134
366	3300050516	nmdc:mga0sz30_11620_c1	nmdc:mga0sz30_11620_c1_226_630	134
367	3300053094	Ga0500566_0003780	Ga0500566_0003780_4471_4875	134
368	3300053117	Ga0500593_280853	Ga0500593_280853_81_485	134
369	3300053134	Ga0500658_0001085	Ga0500658_0001085_9849_10253	134
370	3300061719	Ga0466962_0004170	Ga0466962_0004170_6485_6889	134

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3fac-assembly8.cif.gz_H	crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83.	0.8395	6	113
3fac-assembly8.cif.gz_H	crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83.	0.8185	6	113
8ajq-assembly3.cif.gz_E	crystal structure of pa2722 from pseudomonas aeruginosa pao1	0.7232	1	131
8p1x-assembly1.cif.gz_AAA	tarm(se)_g117r-udp-glucose	0.7128	56	87
1vzy-assembly1.cif.gz_A	crystal structure of the bacillus subtilis hsp33	0.663	1	19

ID	Description	Score	Start	End	Superfamily
af_Q54VC9_11_133_2.170.150.70	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.9363	7	124	2.170.150.70
af_Q54X87_13_141_2.170.150.70	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.9125	6	119	2.170.150.70
af_Q54VC9_11_133_2.170.150.70	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.8929	7	124	2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.8883	5	105	2.170.150.70
af_K7MPT9_9_124_2.170.150.70	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.8844	7	120	2.170.150.70

ID	Description	Score	Start	End	GO Terms
AF-A0A536XBG2-F1-model_v4	GFA family protein	0.9847	1	82	GO:0016846 GO:0046872
AF-F4PZG8-F1-model_v4	Glutathione-dependent formaldehyde-activating	0.9769	2	134	GO:0016846 GO:0046872
AF-A0A4R3GTC8-F1-model_v4	CENP-V/GFA domain-containing protein	0.9768	1	134	GO:0016846 GO:0046872
AF-A0A1H7PWJ0-F1-model_v4	Uncharacterized conserved protein	0.9754	1	134	GO:0016846 GO:0046872
AF-A0A6M5XV74-F1-model_v4	deleted	0.9746	1	63

Feature Viewer

pLDDT	pTM	Quality
94.43	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F425578

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map