F425284

General Info

Members Datasets Scaffolds Average Seq Length
370 229 741 98

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100704300|Ga0070668_1007043002
Length 105
Sequence LKGTAVILEIADIRVQSGQAAEFEAAIRRGVETVIRRAQGFRGYEVRRGIESPDRFILLIQWETLEDHTVAFRGGPLFAEWRAIVGPYFASPPSVEHFTRVAGSA

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
157 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
168 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
218 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
224 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
225 2738541337 Pelomonas sp. BT06 Isolate Unclassified
226 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
227 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
228 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
229 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 0
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 0.54
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 12.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100704300 3300005347 Bacteria 891
2 SwRhRL2b_contig_1974971 2162886007 Bacteria 2596
3 JGI24736J21556_1006329 3300001904 Bacteria 1992
4 JGI24735J21928_10062043 3300002067 Bacteria 1073
5 rootH1_10022889 3300003316 Bacteria 9090
6 rootH1_10073653 3300003316 Bacteria 1435
7 rootL2_10034995 3300003322 Bacteria 10390
8 rootL2_10034996 3300003322 Bacteria 5963
9 rootH1_10054548 3300003316 Bacteria 3950
10 rootH1_10054548 3300003323 Bacteria 4456
11 Ga0055530_10053536 3300003791 Bacteria 926
12 Ga0055531_10000010 3300003794 Bacteria 206117
13 Ga0065704_10080464 3300005289 Bacteria 3935
14 Ga0065715_10073878 3300005293 Bacteria 591
15 Ga0065707_10631711 3300005295 Bacteria 673
16 Ga0070658_10065452 3300005327 Bacteria 2966
17 Ga0070658_10494879 3300005327 Bacteria 1056
18 Ga0070676_10034084 3300005328 Bacteria 2922
19 Ga0070676_10245474 3300005328 Unclassified 1193
20 Ga0070676_10608996 3300005328 Bacteria 788
21 Ga0070683_100301825 3300005329 Unclassified 1523
22 Ga0070670_100014228 3300005331 Bacteria 6825
23 Ga0070670_100212393 3300005331 Bacteria 1682
24 Ga0070670_100877132 3300005331 Bacteria 813
25 Ga0070677_10023476 3300005333 Bacteria 2284
26 Ga0070666_10020904 3300005335 Bacteria 4236
27 Ga0070666_10137999 3300005335 Bacteria 1697
28 Ga0070666_11498840 3300005335 Bacteria 504
29 Ga0070682_100433807 3300005337 Bacteria 1002
30 Ga0068868_100144134 3300005338 Bacteria 1958
31 Ga0068868_101017832 3300005338 Unclassified 758
32 Ga0068868_101806621 3300005338 Bacteria 578
33 Ga0068868_102277165 3300005338 Unclassified 517
34 Ga0070660_100541054 3300005339 Unclassified 971
35 Ga0070691_10699863 3300005341 Unclassified 608
36 Ga0070687_101202644 3300005343 Bacteria 559
37 Ga0070661_101655719 3300005344 Bacteria 542
38 Ga0070668_100079015 3300005347 Bacteria 2575
39 Ga0070669_100003731 3300005353 Bacteria 11003
40 Ga0070675_100003007 3300005354 Bacteria 12725
41 Ga0070675_101336852 3300005354 Bacteria 660
42 Ga0070671_100008356 3300005355 Bacteria 8291
43 Ga0070671_100026413 3300005355 Bacteria 4771
44 Ga0070671_100117499 3300005355 Bacteria 2236
45 Ga0070671_100202887 3300005355 Unclassified 1682
46 Ga0070671_100597071 3300005355 Bacteria 954
47 Ga0070671_101530327 3300005355 Bacteria 591
48 Ga0070674_100073573 3300005356 Bacteria 2422
49 Ga0070674_100316593 3300005356 Bacteria 1249
50 Ga0070673_101185548 3300005364 Bacteria 715
51 Ga0070673_101604914 3300005364 Bacteria 615
52 Ga0070673_102314979 3300005364 Bacteria 511
53 Ga0070688_100754140 3300005365 Bacteria 758
54 Ga0070667_100140249 3300005367 Bacteria 2116
55 Ga0070667_100155278 3300005367 Bacteria 2012
56 Ga0070711_100071806 3300005439 Bacteria 2441
57 Ga0070663_101818800 3300005455 Unclassified 546
58 Ga0070678_100042282 3300005456 Bacteria 3238
59 Ga0070678_100643057 3300005456 Bacteria 951
60 Ga0070678_102203361 3300005456 Bacteria 523
61 Ga0070681_10351306 3300005458 Unclassified 1385
62 Ga0068867_100012492 3300005459 Bacteria 6010
63 Ga0068867_100035413 3300005459 Bacteria 3620
64 Ga0068867_100546680 3300005459 Bacteria 1002
65 Ga0070685_10354627 3300005466 Bacteria 1004
66 Ga0070679_100195614 3300005530 Bacteria 1989
67 Ga0068853_100516727 3300005539 Bacteria 1129
68 Ga0068853_101634452 3300005539 Unclassified 624
69 Ga0068853_101865725 3300005539 Bacteria 583
70 Ga0070672_100001326 3300005543 Bacteria 15251
71 Ga0070686_100235354 3300005544 Bacteria 1331
72 Ga0070665_100048266 3300005548 Bacteria 4275
73 Ga0070665_100387294 3300005548 Bacteria 1405
74 Ga0070665_100590397 3300005548 Bacteria 1124
75 Ga0070665_100769909 3300005548 Bacteria 975
76 Ga0070665_101117224 3300005548 Bacteria 800
77 Ga0068855_100447605 3300005563 Bacteria 1410
78 Ga0070664_100932353 3300005564 Bacteria 815
79 Ga0070664_101605463 3300005564 Bacteria 616
80 Ga0068857_100282249 3300005577 Bacteria 1528
81 Ga0068857_102221000 3300005577 Unclassified 539
82 Ga0068854_100988386 3300005578 Unclassified 744
83 Ga0070702_100568209 3300005615 Bacteria 845
84 Ga0068852_100158548 3300005616 Bacteria 2110
85 Ga0068859_100617537 3300005617 Bacteria 1177
86 Ga0068864_100366401 3300005618 Bacteria 1363
87 Ga0068864_100558168 3300005618 Bacteria 1108
88 Ga0068861_100806931 3300005719 Bacteria 881
89 Ga0068861_102395043 3300005719 Bacteria 531
90 Ga0068870_10043961 3300005840 Bacteria 2332
91 Ga0068870_10344980 3300005840 Bacteria 954
92 Ga0068870_10941699 3300005840 Bacteria 613
93 Ga0068863_100887208 3300005841 Bacteria 892
94 Ga0068863_102306964 3300005841 Unclassified 548
95 Ga0068858_101118311 3300005842 Bacteria 773
96 Ga0068860_101226137 3300005843 Unclassified 770
97 Ga0070716_101282613 3300006173 Bacteria 591
98 Ga0097621_100164656 3300006237 Bacteria 1908
99 Ga0097621_100386688 3300006237 Bacteria 1250
100 Ga0097621_101601118 3300006237 Bacteria 619
101 Ga0068871_100010874 3300006358 Bacteria 6663
102 Ga0068871_100055341 3300006358 Bacteria 3221
103 Ga0068871_102080868 3300006358 Bacteria 541
104 Ga0097620_100617594 3300006931 Bacteria 1177
105 Ga0105245_10618182 3300009098 Bacteria 1111
106 Ga0105245_11489236 3300009098 Bacteria 727
107 Ga0105245_13224763 3300009098 Unclassified 505
108 Ga0105247_10315633 3300009101 Bacteria 1089
109 Ga0105243_10000008 3300009148 Bacteria 390270
110 Ga0105243_10574251 3300009148 Bacteria 1081
111 Ga0105243_11809756 3300009148 Bacteria 642
112 Ga0105241_10174080 3300009174 Unclassified 1780
113 Ga0105241_10793226 3300009174 Bacteria 872
114 Ga0105248_10385640 3300009177 Bacteria 1578
115 Ga0105248_11335149 3300009177 Unclassified 811
116 Ga0105237_10210757 3300009545 Bacteria 1943
117 Ga0105238_10493542 3300009551 Bacteria 1224
118 Ga0105238_10758723 3300009551 Bacteria 984
119 Ga0105239_10466166 3300010375 Bacteria 1434
120 Ga0105239_11902305 3300010375 Bacteria 690
121 Ga0105246_10303920 3300011119 Unclassified 1289
122 Ga0105246_11985725 3300011119 Unclassified 561
123 Ga0157373_10090034 3300013100 Bacteria 2161
124 Ga0157371_10000135 3300013102 Bacteria 107607
125 Ga0157371_10225918 3300013102 Bacteria 1345
126 Ga0157371_10982814 3300013102 Unclassified 643
127 Ga0157370_10038640 3300013104 Bacteria 4617
128 Ga0157370_10386976 3300013104 Bacteria 1288
129 Ga0157369_10610140 3300013105 Bacteria 1126
130 Ga0157374_10367684 3300013296 Unclassified 1431
131 Ga0157374_10451022 3300013296 Bacteria 1288
132 Ga0157378_10038797 3300013297 Bacteria 4223
133 Ga0157378_10798198 3300013297 Bacteria 969
134 Ga0163162_10082938 3300013306 Bacteria 3279
135 Ga0157372_10000061 3300013307 Bacteria 119814
136 Ga0157372_10732763 3300013307 Bacteria 1150
137 Ga0157372_12069281 3300013307 Unclassified 654
138 Ga0157375_10056945 3300013308 Bacteria 3862
139 Ga0157375_13294043 3300013308 Unclassified 538
140 Ga0163163_10586536 3300014325 Bacteria 1178
141 Ga0182008_10567842 3300014497 Bacteria 632
142 Ga0157377_11109977 3300014745 Bacteria 606
143 Ga0157379_10014672 3300014968 Bacteria 6873
144 Ga0157376_10221151 3300014969 Bacteria 1754
145 Ga0182007_10225444 3300015262 Unclassified 664
146 Ga0182007_10342690 3300015262 Bacteria 559
147 Ga0163161_10030460 3300017792 Bacteria 3841
148 Ga0213872_10000033 3300021361 Bacteria 135667
149 Ga0213872_10000258 3300021361 Bacteria 46050
150 Ga0213872_10052519 3300021361 Bacteria 1849
151 Ga0209233_1001263 3300025261 Bacteria 10155
152 Ga0209758_1083377 3300025297 Unclassified 959
153 Ga0209050_1002448 3300025298 Bacteria 15910
154 Ga0209256_1111200 3300025299 Bacteria 551
155 Ga0209257_1000605 3300025304 Bacteria 58901
156 Ga0207697_10043221 3300025315 Bacteria 1853
157 Ga0207682_10001010 3300025893 Bacteria 13055
158 Ga0207680_10046219 3300025903 Bacteria 2572
159 Ga0207680_10115864 3300025903 Bacteria 1746
160 Ga0207645_10054825 3300025907 Bacteria 2546
161 Ga0207645_10501415 3300025907 Bacteria 822
162 Ga0207643_10087027 3300025908 Bacteria 1816
163 Ga0207705_10303876 3300025909 Bacteria 1224
164 Ga0207654_10364570 3300025911 Unclassified 998
165 Ga0207707_10804015 3300025912 Unclassified 783
166 Ga0207707_11558723 3300025912 Unclassified 521
167 Ga0207660_11459572 3300025917 Unclassified 553
168 Ga0207662_10824299 3300025918 Bacteria 655
169 Ga0207657_10030665 3300025919 Bacteria 4878
170 Ga0207657_10510901 3300025919 Bacteria 941
171 Ga0207649_10172773 3300025920 Unclassified 1507
172 Ga0207649_11540531 3300025920 Bacteria 526
173 Ga0207652_10042500 3300025921 Bacteria 3869
174 Ga0207652_11600195 3300025921 Unclassified 556
175 Ga0207681_10035575 3300025923 Bacteria 3282
176 Ga0207694_10341115 3300025924 Unclassified 1239
177 Ga0207650_10001001 3300025925 Bacteria 21241
178 Ga0207659_10005935 3300025926 Bacteria 7454
179 Ga0207687_10515758 3300025927 Bacteria 999
180 Ga0207687_10623782 3300025927 Bacteria 910
181 Ga0207644_10017854 3300025931 Bacteria 4798
182 Ga0207644_10173906 3300025931 Bacteria 1683
183 Ga0207690_10010001 3300025932 Bacteria 5634
184 Ga0207709_10000006 3300025935 Bacteria 800946
185 Ga0207709_10351026 3300025935 Bacteria 1113
186 Ga0207669_10005399 3300025937 Bacteria 5731
187 Ga0207669_10687977 3300025937 Bacteria 839
188 Ga0207704_11080644 3300025938 Bacteria 681
189 Ga0207691_10003644 3300025940 Bacteria 14938
190 Ga0207711_11382741 3300025941 Bacteria 646
191 Ga0207679_10670960 3300025945 Unclassified 939
192 Ga0207667_10308661 3300025949 Bacteria 1616
193 Ga0207651_10165264 3300025960 Bacteria 1739
194 Ga0207651_12124223 3300025960 Bacteria 504
195 Ga0207668_10048985 3300025972 Bacteria 2902
196 Ga0207640_11956534 3300025981 Unclassified 531
197 Ga0207677_10059532 3300026023 Unclassified 2634
198 Ga0207677_10281447 3300026023 Bacteria 1365
199 Ga0207677_11723927 3300026023 Bacteria 581
200 Ga0207703_10670101 3300026035 Bacteria 985
201 Ga0207639_10743654 3300026041 Unclassified 912
202 Ga0207639_10865875 3300026041 Bacteria 844
203 Ga0207639_10999005 3300026041 Bacteria 784
204 Ga0207639_11076481 3300026041 Bacteria 754
205 Ga0207678_10672414 3300026067 Unclassified 910
206 Ga0207641_10082872 3300026088 Bacteria 2787
207 Ga0207648_10049163 3300026089 Bacteria 3691
208 Ga0207648_10404633 3300026089 Bacteria 1237
209 Ga0207648_10805434 3300026089 Bacteria 875
210 Ga0207676_10291885 3300026095 Bacteria 1485
211 Ga0207676_10458334 3300026095 Bacteria 1203
212 Ga0207676_10531052 3300026095 Bacteria 1121
213 Ga0207674_10647679 3300026116 Bacteria 1020
214 Ga0207674_10957125 3300026116 Bacteria 825
215 Ga0207675_100831829 3300026118 Bacteria 937
216 Ga0207675_102169639 3300026118 Bacteria 571
217 Ga0207683_10171659 3300026121 Bacteria 1964
218 Ga0207683_10217736 3300026121 Bacteria 1739
219 Ga0207683_10701470 3300026121 Bacteria 938
220 Ga0207683_11095552 3300026121 Bacteria 739
221 Ga0207698_11076875 3300026142 Bacteria 816
222 Ga0268266_10004026 3300028379 Bacteria 14205
223 Ga0268266_10177149 3300028379 Bacteria 1939
224 Ga0268266_10927628 3300028379 Bacteria 842
225 Ga0268265_10191965 3300028380 Bacteria 1765
226 Ga0268264_11174422 3300028381 Bacteria 777
227 Ga0307515_10023029 3300028794 Bacteria 10946
228 Ga0265338_10166985 3300028800 Bacteria 1693
229 Ga0316183_1099094 3300030742 Bacteria 72835
230 Ga0265330_10089961 3300031235 Bacteria 1318
231 Ga0265339_10053659 3300031249 Bacteria 2192
232 Ga0307513_10076082 3300031456 Bacteria 3483
233 Ga0307408_100000006 3300031548 Bacteria 472824
234 Ga0307408_100001557 3300031548 Bacteria 16949
235 Ga0307408_100041775 3300031548 Bacteria 3253
236 Ga0307408_101481944 3300031548 Bacteria 641
237 Ga0265313_10072744 3300031595 Bacteria 1579
238 Ga0265314_10244543 3300031711 Bacteria 1033
239 Ga0265342_10371536 3300031712 Bacteria 742
240 Ga0307405_10007288 3300031731 Bacteria 5515
241 Ga0307405_10646449 3300031731 Bacteria 869
242 Ga0307405_10798873 3300031731 Bacteria 790
243 Ga0307413_10004977 3300031824 Bacteria 5862
244 Ga0307413_10541858 3300031824 Bacteria 942
245 Ga0307413_10691907 3300031824 Bacteria 846
246 Ga0307410_10031218 3300031852 Bacteria 3416
247 Ga0307410_10512501 3300031852 Bacteria 989
248 Ga0307406_10103600 3300031901 Bacteria 1943
249 Ga0307407_10047608 3300031903 Bacteria 2435
250 Ga0307407_10554980 3300031903 Bacteria 850
251 Ga0307412_10001574 3300031911 Bacteria 12574
252 Ga0307412_10007395 3300031911 Bacteria 6230
253 Ga0307412_10102573 3300031911 Bacteria 2026
254 Ga0307409_100027807 3300031995 Bacteria 4016
255 Ga0307409_101121833 3300031995 Bacteria 808
256 Ga0307409_102107446 3300031995 Bacteria 594
257 Ga0307416_100509333 3300032002 Bacteria 1269
258 Ga0307416_101051421 3300032002 Bacteria 918
259 Ga0307416_101373323 3300032002 Bacteria 812
260 Ga0307414_10315878 3300032004 Bacteria 1328
261 Ga0307414_11302071 3300032004 Bacteria 674
262 Ga0307411_10009719 3300032005 Bacteria 5079
263 Ga0307411_10019962 3300032005 Bacteria 3885
264 Ga0307411_12013824 3300032005 Bacteria 539
265 Ga0307415_100028179 3300032126 Bacteria 3569
266 Ga0373948_0062608 3300034817 Bacteria 819
267 Ga0373950_0007967 3300034818 Bacteria 1655
268 Ga0373950_0152001 3300034818 Bacteria 530
269 Ga0373939_0000014 3300035114 Bacteria 66133
270 Ga0373960_0004729 3300035121 Bacteria 3132
271 Ga0373961_0010684 3300035241 Bacteria 2266
272 Ga0373931_0000245 3300035691 Bacteria 23027
273 Ga0373937_0234365 3300036401 Bacteria 1729
274 Ga0395905_0003524 3300037471 Bacteria 16689
275 Ga0436365_0507751 3300039437 Bacteria 725
276 Ga0436360_0638088 3300039438 Unclassified 874
277 Ga0436361_0321559 3300039447 Bacteria 34731
278 Ga0436361_0421201 3300039447 Bacteria 10493
279 Ga0436361_0453247 3300039447 Bacteria 42325
280 Ga0436361_0474141 3300039447 Bacteria 1885
281 Ga0436361_1112816 3300039447 Bacteria 29383
282 Ga0451793_1373613 3300041452 Bacteria 662
283 Ga0451851_1137504 3300041507 Bacteria 544
284 Ga0439457_004329 3300042014 Bacteria 3723
285 Ga0451577_0023790 3300042876 Bacteria 5580
286 Ga0453683_0001844 3300044673 Bacteria 17410
287 Ga0453684_0162329 3300044712 Bacteria 2641
288 Ga0453684_0307106 3300044712 Bacteria 1801
289 Ga0453684_0800034 3300044712 Bacteria 1017
290 Ga0466960_0368022 3300044901 Bacteria 823
291 Ga0466959_0224235 3300045049 Bacteria 1303
292 Ga0451576_0009055 3300045051 Bacteria 11591
293 Ga0451576_0087371 3300045051 Bacteria 3243
294 Ga0495594_0446949 3300046499 Bacteria 735
295 Ga0495607_0389145 3300046501 Bacteria 636
296 Ga0495663_0183715 3300046525 Bacteria 725
297 Ga0495587_0410965 3300046536 Bacteria 752
298 Ga0495622_0006000 3300046557 Bacteria 5644
299 Ga0495611_0468398 3300046648 Unclassified 573
300 Ga0495615_0020668 3300048090 Bacteria 1478
301 Ga0496102_0008025 3300048905 Bacteria 9024
302 Ga0496116_0006036 3300048919 Bacteria 11088
303 Ga0496117_0003552 3300048920 Bacteria 17994
304 Ga0496118_0106839 3300048921 Bacteria 1871
305 Ga0496122_0025245 3300048925 Bacteria 5167
306 Ga0496123_0093032 3300048926 Bacteria 1782
307 Ga0501031_0020308 3300049568 Bacteria 4331
308 Ga0501032_0007111 3300049569 Bacteria 8195
309 Ga0501032_0453586 3300049569 Bacteria 821
310 Ga0501033_0114966 3300049570 Bacteria 1955
311 Ga0501033_0169331 3300049570 Bacteria 1569
312 Ga0501033_0182017 3300049570 Bacteria 1506
313 Ga0501033_0366629 3300049570 Bacteria 1007
314 Ga0501033_0404197 3300049570 Bacteria 952
315 Ga0501034_0024429 3300049571 Bacteria 6148
316 Ga0501034_0036972 3300049571 Bacteria 4944
317 Ga0501036_0008585 3300049572 Bacteria 8381
318 Ga0501036_1052566 3300049572 Unclassified 665
319 Ga0501038_0007837 3300049574 Bacteria 9843
320 Ga0501038_0153653 3300049574 Bacteria 1875
321 Ga0501038_0176540 3300049574 Bacteria 1726
322 Ga0501039_0038626 3300049575 Bacteria 3686
323 Ga0501040_0513454 3300049576 Unclassified 864
324 Ga0501042_0027392 3300049578 Bacteria 4007
325 Ga0501043_0912158 3300049579 Unclassified 629
326 Ga0501046_0001854 3300049580 Bacteria 20127
327 Ga0501047_0024527 3300049581 Bacteria 5788
328 Ga0501047_0477096 3300049581 Bacteria 1075
329 Ga0501047_0485225 3300049581 Bacteria 1063
330 Ga0501047_0494421 3300049581 Bacteria 1050
331 Ga0501047_1046266 3300049581 Unclassified 629
332 Ga0501048_0044131 3300049582 Bacteria 3189
333 Ga0501067_0001589 3300049583 Bacteria 12437
334 Ga0501068_0011937 3300049584 Bacteria 4913
335 Ga0501069_0060165 3300049585 Bacteria 2120
336 Ga0501070_0037876 3300049586 Bacteria 4024
337 Ga0501070_0091478 3300049586 Bacteria 2518
338 Ga0501070_0205659 3300049586 Bacteria 1616
339 Ga0501072_0098301 3300049588 Bacteria 2327
340 Ga0501073_0017682 3300049589 Bacteria 5161
341 Ga0501074_0011061 3300049590 Bacteria 6551
342 Ga0501077_0848862 3300049593 Unclassified 587
343 Ga0501079_0013955 3300049741 Bacteria 6127
344 Ga0501080_0035208 3300049742 Bacteria 4673
345 Ga0501080_0534616 3300049742 Bacteria 1045
346 Ga0501083_0205765 3300049744 Bacteria 1283
347 Ga0501035_0021128 3300049822 Bacteria 5983
348 Ga0501035_0062838 3300049822 Bacteria 3303
349 Ga0501035_0110123 3300049822 Bacteria 2413
350 Ga0501035_0342874 3300049822 Bacteria 1251
351 Ga0501035_0375630 3300049822 Bacteria 1186
352 Ga0501044_0016340 3300049823 Bacteria 7968
353 Ga0501044_0616991 3300049823 Bacteria 976
354 Ga0501044_0879538 3300049823 Unclassified 771
355 Ga0501045_0135176 3300049824 Bacteria 1833
356 nmdc:mga00v17_98052_c1 3300050491 Bacteria 1848
357 Ga0500635_0104455 3300053080 Bacteria 1046
358 Ga0500646_0011099 3300053090 Bacteria 2314
359 Ga0500559_0061557 3300053136 Bacteria 1674
360 Ga0500559_0255612 3300053136 Bacteria 825
361 Ga0500588_0221941 3300053146 Bacteria 705
362 Ga0501084_0012232 3300054114 Bacteria 7104
363 Ga0501082_0009438 3300060353 Bacteria 8398
364 Ga0501082_1466399 3300060353 Bacteria 596
365 2553007109 2551306416 Bacteria 6152985
366 2722728575 2721755487 Bacteria 6357185
367 2739054632 2738541337 Bacteria 6183410
368 2881102334 2881101125 Bacteria 4590519
369 2904784396 2904780799 Bacteria 5840761
370 2919178980 2919177583 Bacteria 5641607
371 2928120008 2928115317 Bacteria 6477646
372 Ga0070668_100704300
373 SwRhRL2b_contig_1974971
374 JGI24736J21556_1006329
375 JGI24735J21928_10062043
376 rootH1_10022889
377 rootH1_10073653
378 rootL2_10034995
379 rootL2_10034996
380 rootH1_10054548
381 Ga0055530_10053536
382 Ga0055531_10000010
383 Ga0065704_10080464
384 Ga0065715_10073878
385 Ga0065707_10631711
386 Ga0070658_10065452
387 Ga0070658_10494879
388 Ga0070676_10034084
389 Ga0070676_10245474
390 Ga0070676_10608996
391 Ga0070683_100301825
392 Ga0070670_100014228
393 Ga0070670_100212393
394 Ga0070670_100877132
395 Ga0070677_10023476
396 Ga0070666_10020904
397 Ga0070666_10137999
398 Ga0070666_11498840
399 Ga0070682_100433807
400 Ga0068868_100144134
401 Ga0068868_101017832
402 Ga0068868_101806621
403 Ga0068868_102277165
404 Ga0070660_100541054
405 Ga0070691_10699863
406 Ga0070687_101202644
407 Ga0070661_101655719
408 Ga0070668_100079015
409 Ga0070669_100003731
410 Ga0070675_100003007
411 Ga0070675_101336852
412 Ga0070671_100008356
413 Ga0070671_100026413
414 Ga0070671_100117499
415 Ga0070671_100202887
416 Ga0070671_100597071
417 Ga0070671_101530327
418 Ga0070674_100073573
419 Ga0070674_100316593
420 Ga0070673_101185548
421 Ga0070673_101604914
422 Ga0070673_102314979
423 Ga0070688_100754140
424 Ga0070667_100140249
425 Ga0070667_100155278
426 Ga0070711_100071806
427 Ga0070663_101818800
428 Ga0070678_100042282
429 Ga0070678_100643057
430 Ga0070678_102203361
431 Ga0070681_10351306
432 Ga0068867_100012492
433 Ga0068867_100035413
434 Ga0068867_100546680
435 Ga0070685_10354627
436 Ga0070679_100195614
437 Ga0068853_100516727
438 Ga0068853_101634452
439 Ga0068853_101865725
440 Ga0070672_100001326
441 Ga0070686_100235354
442 Ga0070665_100048266
443 Ga0070665_100387294
444 Ga0070665_100590397
445 Ga0070665_100769909
446 Ga0070665_101117224
447 Ga0068855_100447605
448 Ga0070664_100932353
449 Ga0070664_101605463
450 Ga0068857_100282249
451 Ga0068857_102221000
452 Ga0068854_100988386
453 Ga0070702_100568209
454 Ga0068852_100158548
455 Ga0068859_100617537
456 Ga0068864_100366401
457 Ga0068864_100558168
458 Ga0068861_100806931
459 Ga0068861_102395043
460 Ga0068870_10043961
461 Ga0068870_10344980
462 Ga0068870_10941699
463 Ga0068863_100887208
464 Ga0068863_102306964
465 Ga0068858_101118311
466 Ga0068860_101226137
467 Ga0070716_101282613
468 Ga0097621_100164656
469 Ga0097621_100386688
470 Ga0097621_101601118
471 Ga0068871_100010874
472 Ga0068871_100055341
473 Ga0068871_102080868
474 Ga0097620_100617594
475 Ga0105245_10618182
476 Ga0105245_11489236
477 Ga0105245_13224763
478 Ga0105247_10315633
479 Ga0105243_10000008
480 Ga0105243_10574251
481 Ga0105243_11809756
482 Ga0105241_10174080
483 Ga0105241_10793226
484 Ga0105248_10385640
485 Ga0105248_11335149
486 Ga0105237_10210757
487 Ga0105238_10493542
488 Ga0105238_10758723
489 Ga0105239_10466166
490 Ga0105239_11902305
491 Ga0105246_10303920
492 Ga0105246_11985725
493 Ga0157373_10090034
494 Ga0157371_10000135
495 Ga0157371_10225918
496 Ga0157371_10982814
497 Ga0157370_10038640
498 Ga0157370_10386976
499 Ga0157369_10610140
500 Ga0157374_10367684
501 Ga0157374_10451022
502 Ga0157378_10038797
503 Ga0157378_10798198
504 Ga0163162_10082938
505 Ga0157372_10000061
506 Ga0157372_10732763
507 Ga0157372_12069281
508 Ga0157375_10056945
509 Ga0157375_13294043
510 Ga0163163_10586536
511 Ga0182008_10567842
512 Ga0157377_11109977
513 Ga0157379_10014672
514 Ga0157376_10221151
515 Ga0182007_10225444
516 Ga0182007_10342690
517 Ga0163161_10030460
518 Ga0213872_10000033
519 Ga0213872_10000258
520 Ga0213872_10052519
521 Ga0209233_1001263
522 Ga0209758_1083377
523 Ga0209050_1002448
524 Ga0209256_1111200
525 Ga0209257_1000605
526 Ga0207697_10043221
527 Ga0207682_10001010
528 Ga0207680_10046219
529 Ga0207680_10115864
530 Ga0207645_10054825
531 Ga0207645_10501415
532 Ga0207643_10087027
533 Ga0207705_10303876
534 Ga0207654_10364570
535 Ga0207707_10804015
536 Ga0207707_11558723
537 Ga0207660_11459572
538 Ga0207662_10824299
539 Ga0207657_10030665
540 Ga0207657_10510901
541 Ga0207649_10172773
542 Ga0207649_11540531
543 Ga0207652_10042500
544 Ga0207652_11600195
545 Ga0207681_10035575
546 Ga0207694_10341115
547 Ga0207650_10001001
548 Ga0207659_10005935
549 Ga0207687_10515758
550 Ga0207687_10623782
551 Ga0207644_10017854
552 Ga0207644_10173906
553 Ga0207690_10010001
554 Ga0207709_10000006
555 Ga0207709_10351026
556 Ga0207669_10005399
557 Ga0207669_10687977
558 Ga0207704_11080644
559 Ga0207691_10003644
560 Ga0207711_11382741
561 Ga0207679_10670960
562 Ga0207667_10308661
563 Ga0207651_10165264
564 Ga0207651_12124223
565 Ga0207668_10048985
566 Ga0207640_11956534
567 Ga0207677_10059532
568 Ga0207677_10281447
569 Ga0207677_11723927
570 Ga0207703_10670101
571 Ga0207639_10743654
572 Ga0207639_10865875
573 Ga0207639_10999005
574 Ga0207639_11076481
575 Ga0207678_10672414
576 Ga0207641_10082872
577 Ga0207648_10049163
578 Ga0207648_10404633
579 Ga0207648_10805434
580 Ga0207676_10291885
581 Ga0207676_10458334
582 Ga0207676_10531052
583 Ga0207674_10647679
584 Ga0207674_10957125
585 Ga0207675_100831829
586 Ga0207675_102169639
587 Ga0207683_10171659
588 Ga0207683_10217736
589 Ga0207683_10701470
590 Ga0207683_11095552
591 Ga0207698_11076875
592 Ga0268266_10004026
593 Ga0268266_10177149
594 Ga0268266_10927628
595 Ga0268265_10191965
596 Ga0268264_11174422
597 Ga0307515_10023029
598 Ga0265338_10166985
599 Ga0316183_1099094
600 Ga0265330_10089961
601 Ga0265339_10053659
602 Ga0307513_10076082
603 Ga0307408_100000006
604 Ga0307408_100001557
605 Ga0307408_100041775
606 Ga0307408_101481944
607 Ga0265313_10072744
608 Ga0265314_10244543
609 Ga0265342_10371536
610 Ga0307405_10007288
611 Ga0307405_10646449
612 Ga0307405_10798873
613 Ga0307413_10004977
614 Ga0307413_10541858
615 Ga0307413_10691907
616 Ga0307410_10031218
617 Ga0307410_10512501
618 Ga0307406_10103600
619 Ga0307407_10047608
620 Ga0307407_10554980
621 Ga0307412_10001574
622 Ga0307412_10007395
623 Ga0307412_10102573
624 Ga0307409_100027807
625 Ga0307409_101121833
626 Ga0307409_102107446
627 Ga0307416_100509333
628 Ga0307416_101051421
629 Ga0307416_101373323
630 Ga0307414_10315878
631 Ga0307414_11302071
632 Ga0307411_10009719
633 Ga0307411_10019962
634 Ga0307411_12013824
635 Ga0307415_100028179
636 Ga0373948_0062608
637 Ga0373950_0007967
638 Ga0373950_0152001
639 Ga0373939_0000014
640 Ga0373960_0004729
641 Ga0373961_0010684
642 Ga0373931_0000245
643 Ga0373937_0234365
644 Ga0395905_0003524
645 Ga0436365_0507751
646 Ga0436360_0638088
647 Ga0436361_0321559
648 Ga0436361_0421201
649 Ga0436361_0453247
650 Ga0436361_0474141
651 Ga0436361_1112816
652 Ga0451793_1373613
653 Ga0451851_1137504
654 Ga0439457_004329
655 Ga0451577_0023790
656 Ga0453683_0001844
657 Ga0453684_0162329
658 Ga0453684_0307106
659 Ga0453684_0800034
660 Ga0466960_0368022
661 Ga0466959_0224235
662 Ga0451576_0009055
663 Ga0451576_0087371
664 Ga0495594_0446949
665 Ga0495607_0389145
666 Ga0495663_0183715
667 Ga0495587_0410965
668 Ga0495622_0006000
669 Ga0495611_0468398
670 Ga0495615_0020668
671 Ga0496102_0008025
672 Ga0496116_0006036
673 Ga0496117_0003552
674 Ga0496118_0106839
675 Ga0496122_0025245
676 Ga0496123_0093032
677 Ga0501031_0020308
678 Ga0501032_0007111
679 Ga0501032_0453586
680 Ga0501033_0114966
681 Ga0501033_0169331
682 Ga0501033_0182017
683 Ga0501033_0366629
684 Ga0501033_0404197
685 Ga0501034_0024429
686 Ga0501034_0036972
687 Ga0501036_0008585
688 Ga0501036_1052566
689 Ga0501038_0007837
690 Ga0501038_0153653
691 Ga0501038_0176540
692 Ga0501039_0038626
693 Ga0501040_0513454
694 Ga0501042_0027392
695 Ga0501043_0912158
696 Ga0501046_0001854
697 Ga0501047_0024527
698 Ga0501047_0477096
699 Ga0501047_0485225
700 Ga0501047_0494421
701 Ga0501047_1046266
702 Ga0501048_0044131
703 Ga0501067_0001589
704 Ga0501068_0011937
705 Ga0501069_0060165
706 Ga0501070_0037876
707 Ga0501070_0091478
708 Ga0501070_0205659
709 Ga0501072_0098301
710 Ga0501073_0017682
711 Ga0501074_0011061
712 Ga0501077_0848862
713 Ga0501079_0013955
714 Ga0501080_0035208
715 Ga0501080_0534616
716 Ga0501083_0205765
717 Ga0501035_0021128
718 Ga0501035_0062838
719 Ga0501035_0110123
720 Ga0501035_0342874
721 Ga0501035_0375630
722 Ga0501044_0016340
723 Ga0501044_0616991
724 Ga0501044_0879538
725 Ga0501045_0135176
726 nmdc:mga00v17_98052_c1
727 Ga0500635_0104455
728 Ga0500646_0011099
729 Ga0500559_0061557
730 Ga0500559_0255612
731 Ga0500588_0221941
732 Ga0501084_0012232
733 Ga0501082_0009438
734 Ga0501082_1466399
735 2553007109
736 2722728575
737 2739054632
738 2881102334
739 2904784396
740 2919178980
741 2928120008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

6

84

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.9606 2 96
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.9414 2 96
7bio-assembly1.cif.gz_A crystal structure of monooxygenase rslo4 from streptomyces bottropensis 0.8999 1 96
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.8881 2 96
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8865 2 95
ID Description Score Start End Superfamily
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9523 2 96 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9236 2 96 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8881 2 96 3.30.70.100
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8772 1 96 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8724 1 91 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A317EVN8-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.004 2 92 GO:0004497
AF-A0A520J357-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.002 1 95 GO:0004497
AF-A0A0Q9D3P8-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.002 1 96 GO:0004497
AF-A0A561CT15-F1-model_v4 deleted 1.002 1 95
AF-A0A2D6MZI6-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.002 1 95 GO:0004497

Map