F425181

General Info

Members Datasets Scaffolds Average Seq Length
369 207 738 193

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0005293|Ga0496114_0005293_7440_7985
Length 181
Sequence MTTQTLAPFDPLADAIADVDGWPETDDIDAIFAPEPLPVVEELPAAAKDFLIIDYSGDLEKVWATMILASTSAAMGVKTRVFVTFWGLQVFVKDSKRITGQNWMQKMMSAMQRPGVSHRKLSKMNFLGMGPWMMGVEFLPCQMTMDMFGLKPDDMIEGMGEPVGAATVIELMTTNSVPLFI

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
132 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
133 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
134 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 3.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.76
Rhizosphere 89.43
Stem 0
Stem Tuber 0
Unclassified 30.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0005293 3300048917 Bacteria 10082
2 rootL2_10198934 3300003322 Bacteria 1772
3 Ga0070683_100469364 3300005329 Unclassified 1201
4 Ga0070690_100186865 3300005330 Unclassified 1434
5 Ga0070690_100681100 3300005330 Bacteria 788
6 Ga0070682_100145823 3300005337 Bacteria 1619
7 Ga0070682_100685151 3300005337 Unclassified 820
8 Ga0070689_100222232 3300005340 Unclassified 1549
9 Ga0070692_10076684 3300005345 Unclassified 1792
10 Ga0070692_10134084 3300005345 Unclassified 1395
11 Ga0070675_100791475 3300005354 Bacteria 866
12 Ga0070671_100527802 3300005355 Bacteria 1017
13 Ga0070674_100110206 3300005356 Archaea 2020
14 Ga0070673_100190780 3300005364 Bacteria 1760
15 Ga0070688_100213034 3300005365 Bacteria 1357
16 Ga0070714_100287512 3300005435 Bacteria 1529
17 Ga0070701_10407984 3300005438 Bacteria 862
18 Ga0070700_100191082 3300005441 Bacteria 1432
19 Ga0070708_100014992 3300005445 Bacteria 6391
20 Ga0070663_100759315 3300005455 Bacteria 829
21 Ga0070681_10091928 3300005458 Bacteria 2984
22 Ga0070685_10069477 3300005466 Bacteria 2083
23 Ga0070685_10143969 3300005466 Bacteria 1504
24 Ga0070707_100046795 3300005468 Unclassified 4140
25 Ga0070698_100038976 3300005471 Bacteria 4895
26 Ga0070698_100448988 3300005471 Bacteria 1225
27 Ga0070699_100013137 3300005518 Bacteria 7140
28 Ga0070684_100939809 3300005535 Bacteria 811
29 Ga0070686_100010945 3300005544 Bacteria 5135
30 Ga0070693_100392803 3300005547 Bacteria 960
31 Ga0070704_101175480 3300005549 Bacteria 699
32 Ga0070664_100353324 3300005564 Unclassified 1337
33 Ga0068857_100062594 3300005577 Bacteria 3308
34 Ga0068857_100559076 3300005577 Unclassified 1078
35 Ga0068857_101558042 3300005577 Bacteria 644
36 Ga0068854_100469755 3300005578 Bacteria 1054
37 Ga0068864_100035416 3300005618 Bacteria 4249
38 Ga0068864_100649880 3300005618 Bacteria 1027
39 Ga0068860_100527866 3300005843 Bacteria 1181
40 Ga0075431_100582624 3300006847 Bacteria 1104
41 Ga0075433_10051692 3300006852 Bacteria 3579
42 Ga0075433_10107013 3300006852 Bacteria 2479
43 Ga0075434_100086236 3300006871 Bacteria 3140
44 Ga0075434_100336900 3300006871 Bacteria 1529
45 Ga0075429_100168680 3300006880 Bacteria 1917
46 Ga0068865_100178732 3300006881 Bacteria 1633
47 Ga0075435_100032533 3300007076 Unclassified 4120
48 Ga0075435_100263803 3300007076 Archaea 1468
49 Ga0111539_10015824 3300009094 Bacteria 9369
50 Ga0105245_10665574 3300009098 Bacteria 1072
51 Ga0114129_10000286 3300009147 Bacteria 58249
52 Ga0105243_10016596 3300009148 Bacteria 5568
53 Ga0105243_10018123 3300009148 Bacteria 5328
54 Ga0105243_10136985 3300009148 Bacteria 2084
55 Ga0105241_10403062 3300009174 Unclassified 1200
56 Ga0105248_10705080 3300009177 Unclassified 1139
57 Ga0105248_10959913 3300009177 Bacteria 965
58 Ga0105249_10026689 3300009553 Bacteria 5207
59 Ga0105249_10445468 3300009553 Unclassified 1333
60 Ga0105239_10324028 3300010375 Unclassified 1738
61 Ga0105239_10327314 3300010375 Bacteria 1728
62 Ga0105246_10023349 3300011119 Bacteria 4001
63 Ga0105246_10025408 3300011119 Bacteria 3860
64 Ga0105246_10851467 3300011119 Bacteria 813
65 Ga0157378_10199257 3300013297 Bacteria 1893
66 Ga0157378_10641560 3300013297 Unclassified 1077
67 Ga0163162_10361457 3300013306 Bacteria 1585
68 Ga0157375_10015545 3300013308 Bacteria 6816
69 Ga0157375_10431628 3300013308 Bacteria 1483
70 Ga0163163_10391920 3300014325 Bacteria 1447
71 Ga0163163_10447307 3300014325 Bacteria 1352
72 Ga0163163_10662666 3300014325 Bacteria 1107
73 Ga0157380_10467636 3300014326 Bacteria 1216
74 Ga0157377_10106218 3300014745 Unclassified 1681
75 Ga0157379_10113749 3300014968 Bacteria 2432
76 Ga0157376_10648877 3300014969 Bacteria 1056
77 Ga0163161_10106319 3300017792 Unclassified 2094
78 Ga0207710_10320919 3300025900 Bacteria 785
79 Ga0207643_10026166 3300025908 Unclassified 3228
80 Ga0207684_10065853 3300025910 Bacteria 3077
81 Ga0207684_10478407 3300025910 Bacteria 1068
82 Ga0207662_10540456 3300025918 Bacteria 806
83 Ga0207646_10013021 3300025922 Bacteria 7967
84 Ga0207659_10612069 3300025926 Unclassified 929
85 Ga0207687_10136072 3300025927 Bacteria 1858
86 Ga0207687_10458336 3300025927 Bacteria 1058
87 Ga0207644_10482435 3300025931 Bacteria 1021
88 Ga0207644_10790090 3300025931 Bacteria 794
89 Ga0207686_10096360 3300025934 Bacteria 1966
90 Ga0207669_10063804 3300025937 Archaea 2276
91 Ga0207669_10068893 3300025937 Bacteria 2212
92 Ga0207704_10516005 3300025938 Bacteria 966
93 Ga0207691_10261459 3300025940 Unclassified 1492
94 Ga0207711_10969970 3300025941 Bacteria 789
95 Ga0207661_10162152 3300025944 Unclassified 1941
96 Ga0207661_10287517 3300025944 Unclassified 1471
97 Ga0207679_10042742 3300025945 Bacteria 3259
98 Ga0207712_10118924 3300025961 Unclassified 1996
99 Ga0207677_10435035 3300026023 Unclassified 1121
100 Ga0207703_10581145 3300026035 Bacteria 1058
101 Ga0207639_10129952 3300026041 Unclassified 2083
102 Ga0207641_10106456 3300026088 Bacteria 2479
103 Ga0207676_10132470 3300026095 Bacteria 2122
104 Ga0207676_11329823 3300026095 Bacteria 714
105 Ga0207674_10062328 3300026116 Bacteria 3766
106 Ga0207674_10620044 3300026116 Unclassified 1045
107 Ga0207675_101121074 3300026118 Bacteria 807
108 Ga0207698_10213543 3300026142 Unclassified 1738
109 Ga0207698_11266104 3300026142 Bacteria 752
110 Ga0209971_1002642 3300027682 Bacteria 4291
111 Ga0209974_10013814 3300027876 Unclassified 2690
112 Ga0207428_10070341 3300027907 Bacteria 2750
113 Ga0265326_10011362 3300028558 Unclassified 2626
114 Ga0265326_10110896 3300028558 Bacteria 779
115 Ga0265319_1001557 3300028563 Bacteria 13503
116 Ga0265334_10009016 3300028573 Bacteria 4230
117 Ga0265334_10031261 3300028573 Unclassified 2128
118 Ga0265334_10031842 3300028573 Bacteria 2106
119 Ga0265318_10011724 3300028577 Bacteria 3759
120 Ga0265318_10019556 3300028577 Bacteria 2745
121 Ga0265318_10034376 3300028577 Bacteria 1954
122 Ga0265318_10038682 3300028577 Unclassified 1822
123 Ga0265322_10009410 3300028654 Bacteria 2837
124 Ga0265336_10018768 3300028666 Bacteria 2237
125 Ga0265336_10104673 3300028666 Bacteria 843
126 Ga0265338_10109029 3300028800 Bacteria 2235
127 Ga0265338_10110437 3300028800 Bacteria 2216
128 Ga0265338_10221827 3300028800 Unclassified 1412
129 Ga0265330_10047851 3300031235 Bacteria 1881
130 Ga0265332_10009447 3300031238 Bacteria 4354
131 Ga0265320_10016150 3300031240 Bacteria 4194
132 Ga0265320_10020855 3300031240 Bacteria 3540
133 Ga0265320_10043923 3300031240 Unclassified 2205
134 Ga0265325_10029964 3300031241 Bacteria 2921
135 Ga0265325_10056488 3300031241 Bacteria 2005
136 Ga0265325_10113822 3300031241 Unclassified 1312
137 Ga0265329_10002514 3300031242 Bacteria 8278
138 Ga0265329_10005869 3300031242 Bacteria 4922
139 Ga0265340_10011524 3300031247 Bacteria 4697
140 Ga0265340_10013761 3300031247 Bacteria 4243
141 Ga0265339_10148297 3300031249 Bacteria 1188
142 Ga0265331_10023966 3300031250 Bacteria 3093
143 Ga0265331_10161435 3300031250 Bacteria 1016
144 Ga0265316_10059121 3300031344 Bacteria 2982
145 Ga0265316_10072592 3300031344 Unclassified 2651
146 Ga0265316_10082574 3300031344 Bacteria 2462
147 Ga0307408_100250216 3300031548 Bacteria 1461
148 Ga0265313_10037237 3300031595 Unclassified 2434
149 Ga0265313_10129883 3300031595 Bacteria 1093
150 Ga0316575_10018399 3300031665 Bacteria 2663
151 Ga0265314_10004439 3300031711 Bacteria 13024
152 Ga0265314_10020911 3300031711 Bacteria 5044
153 Ga0265314_10021387 3300031711 Bacteria 4974
154 Ga0265342_10028561 3300031712 Bacteria 3473
155 Ga0265342_10036239 3300031712 Bacteria 3015
156 Ga0265342_10046397 3300031712 Bacteria 2612
157 Ga0316578_10037877 3300031728 Unclassified 2779
158 Ga0307405_10144741 3300031731 Bacteria 1663
159 Ga0307413_10235558 3300031824 Bacteria 1348
160 Ga0307413_10454425 3300031824 Unclassified 1018
161 Ga0307409_100322491 3300031995 Bacteria 1446
162 Ga0307409_101321391 3300031995 Unclassified 746
163 Ga0307416_100009750 3300032002 Bacteria 6309
164 Ga0307416_100318507 3300032002 Bacteria 1556
165 Ga0307411_10116737 3300032005 Bacteria 1922
166 Ga0307411_10397277 3300032005 Bacteria 1139
167 Ga0307415_100049572 3300032126 Unclassified 2840
168 Ga0307415_100194555 3300032126 Bacteria 1603
169 Ga0316583_10005396 3300032133 Unclassified 4589
170 Ga0316593_10006625 3300032168 Unclassified 3138
171 Ga0316593_10007619 3300032168 Unclassified 2979
172 Ga0316593_10029349 3300032168 Bacteria 1779
173 Ga0316593_10035770 3300032168 Bacteria 1635
174 Ga0316593_10047480 3300032168 Bacteria 1444
175 Ga0316592_1002554 3300033524 Bacteria 3161
176 Ga0316592_1003672 3300033524 Bacteria 2789
177 Ga0316586_1005815 3300033527 Unclassified 1750
178 Ga0316596_1003816 3300033541 Bacteria 3334
179 Ga0316596_1005564 3300033541 Unclassified 2883
180 Ga0316596_1014083 3300033541 Bacteria 1980
181 Ga0316596_1016396 3300033541 Bacteria 1856
182 Ga0373928_0086598 3300035084 Bacteria 798
183 Ga0373944_0171258 3300035089 Bacteria 775
184 Ga0373960_0204234 3300035121 Bacteria 700
185 Ga0373943_0049010 3300035170 Bacteria 2072
186 Ga0373943_0459265 3300035170 Bacteria 741
187 Ga0373946_0257058 3300035171 Bacteria 854
188 Ga0373955_0353648 3300035172 Bacteria 890
189 Ga0373955_0625068 3300035172 Unclassified 660
190 Ga0373962_0074924 3300035242 Unclassified 1018
191 Ga0316574_0076384 3300035398 Bacteria 2122
192 Ga0316574_0114081 3300035398 Unclassified 1733
193 Ga0316574_0407593 3300035398 Unclassified 855
194 Ga0373933_0413441 3300035724 Unclassified 881
195 Ga0373947_0132589 3300035725 Bacteria 1592
196 Ga0373937_0401014 3300036401 Unclassified 1301
197 Ga0373937_0843864 3300036401 Bacteria 864
198 Ga0316582_0080901 3300036647 Unclassified 2121
199 Ga0439465_0109962 3300041413 Unclassified 958
200 Ga0451839_0346456 3300041496 Bacteria 1050
201 Ga0451853_3340028 3300041512 Bacteria 1456
202 Ga0439454_022476 3300042011 Bacteria 940
203 Ga0450920_011506 3300042122 Bacteria 1650
204 Ga0450906_019714 3300042145 Bacteria 1208
205 Ga0439435_0010981 3300042436 Bacteria 2164
206 Ga0439435_0067058 3300042436 Unclassified 1056
207 Ga0451577_0014643 3300042876 Bacteria 7308
208 Ga0451577_0183675 3300042876 Bacteria 1886
209 Ga0451577_0745767 3300042876 Unclassified 886
210 Ga0453683_0045268 3300044673 Bacteria 2759
211 Ga0453684_0222250 3300044712 Bacteria 2187
212 Ga0451576_0071187 3300045051 Bacteria 3619
213 Ga0451576_0761997 3300045051 Unclassified 1017
214 Ga0495592_0284450 3300046454 Bacteria 1080
215 Ga0495653_0205626 3300046463 Bacteria 1333
216 Ga0495582_0444362 3300046473 Bacteria 749
217 Ga0495662_0068237 3300046476 Bacteria 1722
218 Ga0495608_0473066 3300046511 Unclassified 761
219 Ga0495628_0244354 3300046516 Unclassified 1342
220 Ga0495628_0290582 3300046516 Bacteria 1212
221 Ga0495652_0300420 3300046529 Bacteria 1167
222 Ga0495640_0247555 3300046533 Bacteria 1117
223 Ga0495640_0349427 3300046533 Bacteria 913
224 Ga0495645_0221258 3300046543 Bacteria 1273
225 Ga0495667_0034977 3300046559 Bacteria 3359
226 Ga0495656_0034059 3300046615 Unclassified 2083
227 Ga0495656_0404695 3300046615 Bacteria 714
228 Ga0495634_0104509 3300046642 Unclassified 1827
229 Ga0495658_0156507 3300046683 Bacteria 1403
230 Ga0495658_0308695 3300046683 Bacteria 1001
231 Ga0495624_0233143 3300046690 Bacteria 1115
232 Ga0495600_0097077 3300046809 Bacteria 1921
233 Ga0495674_0272576 3300047319 Unclassified 1388
234 Ga0495674_0549299 3300047319 Bacteria 920
235 Ga0495680_0174420 3300047322 Bacteria 1555
236 Ga0496100_0299646 3300048903 Unclassified 1203
237 Ga0496100_0455462 3300048903 Bacteria 981
238 Ga0496102_0329695 3300048905 Bacteria 1438
239 Ga0496104_0003658 3300048907 Bacteria 13274
240 Ga0496104_0009378 3300048907 Bacteria 8705
241 Ga0496104_0019665 3300048907 Bacteria 6184
242 Ga0496104_0073010 3300048907 Bacteria 3264
243 Ga0496104_0274281 3300048907 Unclassified 1599
244 Ga0496105_0028741 3300048908 Bacteria 4549
245 Ga0496105_0050162 3300048908 Bacteria 3447
246 Ga0496105_0216809 3300048908 Unclassified 1559
247 Ga0496106_0153546 3300048909 Unclassified 1817
248 Ga0496106_0840295 3300048909 Bacteria 727
249 Ga0496107_0154625 3300048910 Bacteria 1698
250 Ga0496107_0205788 3300048910 Bacteria 1463
251 Ga0496108_0014798 3300048911 Bacteria 6367
252 Ga0496108_0261472 3300048911 Bacteria 1506
253 Ga0496108_0276771 3300048911 Bacteria 1461
254 Ga0496109_0002307 3300048912 Bacteria 15879
255 Ga0496109_0014248 3300048912 Bacteria 6917
256 Ga0496109_0015894 3300048912 Bacteria 6572
257 Ga0496109_0234127 3300048912 Bacteria 1728
258 Ga0496109_0251559 3300048912 Unclassified 1664
259 Ga0496110_0035729 3300048913 Bacteria 4313
260 Ga0496111_0049409 3300048914 Unclassified 3033
261 Ga0496112_0000012 3300048915 Bacteria 243643
262 Ga0496112_0056967 3300048915 Bacteria 3847
263 Ga0496112_0442901 3300048915 Bacteria 1237
264 Ga0496112_0926142 3300048915 Unclassified 793
265 Ga0496113_0131064 3300048916 Unclassified 1967
266 Ga0496113_0143658 3300048916 Unclassified 1879
267 Ga0496113_0739366 3300048916 Bacteria 784
268 Ga0496113_0877891 3300048916 Bacteria 710
269 Ga0496114_0152916 3300048917 Bacteria 2002
270 Ga0496114_0370273 3300048917 Unclassified 1268
271 Ga0501031_0110220 3300049568 Bacteria 1797
272 Ga0501031_0211958 3300049568 Unclassified 1262
273 Ga0501033_0378663 3300049570 Unclassified 989
274 Ga0501036_0075284 3300049572 Bacteria 2855
275 Ga0501036_0078835 3300049572 Bacteria 2786
276 Ga0501037_0058493 3300049573 Bacteria 2813
277 Ga0501038_0136775 3300049574 Archaea 2007
278 Ga0501038_0160233 3300049574 Unclassified 1829
279 Ga0501039_0022486 3300049575 Bacteria 4840
280 Ga0501039_0047952 3300049575 Bacteria 3302
281 Ga0501040_0036632 3300049576 Bacteria 3330
282 Ga0501040_0099144 3300049576 Bacteria 2031
283 Ga0501040_0446451 3300049576 Bacteria 931
284 Ga0501041_0008168 3300049577 Bacteria 6158
285 Ga0501041_0105098 3300049577 Unclassified 1750
286 Ga0501042_0102726 3300049578 Bacteria 2056
287 Ga0501042_0462169 3300049578 Bacteria 921
288 Ga0501046_0165457 3300049580 Unclassified 1662
289 Ga0501046_0257277 3300049580 Unclassified 1283
290 Ga0501048_0048742 3300049582 Bacteria 3021
291 Ga0501048_0204199 3300049582 Unclassified 1401
292 Ga0501068_0175541 3300049584 Unclassified 1354
293 Ga0501068_0216545 3300049584 Unclassified 1217
294 Ga0501068_0297959 3300049584 Unclassified 1032
295 Ga0501068_0421853 3300049584 Unclassified 862
296 Ga0501071_0018211 3300049587 Bacteria 4859
297 Ga0501071_0032462 3300049587 Bacteria 3707
298 Ga0501071_0051534 3300049587 Unclassified 2966
299 Ga0501071_0134703 3300049587 Bacteria 1837
300 Ga0501071_0609814 3300049587 Unclassified 839
301 Ga0501071_0683464 3300049587 Unclassified 790
302 Ga0501072_0008858 3300049588 Bacteria 7644
303 Ga0501072_0042649 3300049588 Unclassified 3564
304 Ga0501072_0077978 3300049588 Unclassified 2623
305 Ga0501072_0188672 3300049588 Unclassified 1644
306 Ga0501073_0174971 3300049589 Bacteria 1485
307 Ga0501074_0116907 3300049590 Unclassified 1908
308 Ga0501074_0123611 3300049590 Bacteria 1851
309 Ga0501074_0369556 3300049590 Bacteria 1017
310 Ga0501074_0514263 3300049590 Unclassified 848
311 Ga0501075_0004911 3300049591 Bacteria 9115
312 Ga0501075_0013739 3300049591 Bacteria 5786
313 Ga0501075_0237131 3300049591 Bacteria 1391
314 Ga0501075_0499374 3300049591 Bacteria 928
315 Ga0501075_0640576 3300049591 Bacteria 810
316 Ga0501075_0693284 3300049591 Unclassified 776
317 Ga0501076_0027428 3300049592 Bacteria 4417
318 Ga0501076_0100029 3300049592 Unclassified 2336
319 Ga0501076_0117930 3300049592 Unclassified 2148
320 Ga0501076_0239469 3300049592 Bacteria 1484
321 Ga0501076_0664386 3300049592 Bacteria 860
322 Ga0501076_0686545 3300049592 Bacteria 845
323 Ga0501077_0061890 3300049593 Bacteria 2375
324 Ga0501077_0118041 3300049593 Unclassified 1681
325 Ga0501077_0438266 3300049593 Bacteria 836
326 Ga0501077_0458349 3300049593 Unclassified 816
327 Ga0501079_0002556 3300049741 Bacteria 13215
328 Ga0501080_0153825 3300049742 Unclassified 2125
329 Ga0501080_0320503 3300049742 Unclassified 1403
330 Ga0501080_0391022 3300049742 Unclassified 1252
331 Ga0501080_0432746 3300049742 Bacteria 1181
332 Ga0501081_0058135 3300049743 Unclassified 2675
333 Ga0501081_0100110 3300049743 Bacteria 2048
334 Ga0501081_0124675 3300049743 Unclassified 1837
335 Ga0501045_0146495 3300049824 Bacteria 1757
336 Ga0501045_0164392 3300049824 Bacteria 1652
337 nmdc:mga05p37_1968_c1 3300050507 Bacteria 23961
338 nmdc:mga09592_164275_c1 3300050508 Bacteria 1918
339 nmdc:mga06r32_48607_c1 3300050510 Bacteria 4055
340 nmdc:mga08y16_37726_c1 3300050511 Bacteria 5072
341 nmdc:mga0n895_289441_c1 3300050512 Unclassified 1661
342 nmdc:mga0n895_691079_c1 3300050512 Bacteria 1017
343 nmdc:mga0rr50_362877_c1 3300050513 Unclassified 1219
344 nmdc:mga0a205_120463_c1 3300050515 Bacteria 2523
345 nmdc:mga0a205_28552_c1 3300050515 Bacteria 5335
346 Ga0495601_0192295 3300053077 Bacteria 1333
347 Ga0495601_0218656 3300053077 Unclassified 1244
348 Ga0495612_0000203 3300053078 Bacteria 25447
349 Ga0495595_0044585 3300053084 Bacteria 2038
350 Ga0495595_0084158 3300053084 Unclassified 1519
351 Ga0495619_0162158 3300053085 Bacteria 1544
352 Ga0501084_0048616 3300054114 Bacteria 3550
353 Ga0501084_0073678 3300054114 Unclassified 2859
354 Ga0501084_0402688 3300054114 Unclassified 1157
355 Ga0501084_0941744 3300054114 Unclassified 726
356 Ga0590074_017681 3300059423 Unclassified 1219
357 Ga0590075_025487 3300059424 Unclassified 1486
358 Ga0590077_017541 3300059426 Unclassified 1506
359 Ga0501082_0076013 3300060353 Bacteria 2894
360 Ga0501082_0091952 3300060353 Unclassified 2620
361 Ga0501082_0144403 3300060353 Bacteria 2065
362 Ga0530510_0003811 3300061734 Bacteria 10392
363 Ga0530510_0027651 3300061734 Unclassified 4064
364 Ga0530510_0060762 3300061734 Archaea 2735
365 Ga0530510_0104721 3300061734 Unclassified 2070
366 Ga0530510_0127434 3300061734 Bacteria 1872
367 Ga0530510_0176177 3300061734 Bacteria 1585
368 Ga0530510_0225550 3300061734 Bacteria 1393
369 Ga0530510_0470902 3300061734 Unclassified 951
370 Ga0496114_0005293
371 rootL2_10198934
372 Ga0070683_100469364
373 Ga0070690_100186865
374 Ga0070690_100681100
375 Ga0070682_100145823
376 Ga0070682_100685151
377 Ga0070689_100222232
378 Ga0070692_10076684
379 Ga0070692_10134084
380 Ga0070675_100791475
381 Ga0070671_100527802
382 Ga0070674_100110206
383 Ga0070673_100190780
384 Ga0070688_100213034
385 Ga0070714_100287512
386 Ga0070701_10407984
387 Ga0070700_100191082
388 Ga0070708_100014992
389 Ga0070663_100759315
390 Ga0070681_10091928
391 Ga0070685_10069477
392 Ga0070685_10143969
393 Ga0070707_100046795
394 Ga0070698_100038976
395 Ga0070698_100448988
396 Ga0070699_100013137
397 Ga0070684_100939809
398 Ga0070686_100010945
399 Ga0070693_100392803
400 Ga0070704_101175480
401 Ga0070664_100353324
402 Ga0068857_100062594
403 Ga0068857_100559076
404 Ga0068857_101558042
405 Ga0068854_100469755
406 Ga0068864_100035416
407 Ga0068864_100649880
408 Ga0068860_100527866
409 Ga0075431_100582624
410 Ga0075433_10051692
411 Ga0075433_10107013
412 Ga0075434_100086236
413 Ga0075434_100336900
414 Ga0075429_100168680
415 Ga0068865_100178732
416 Ga0075435_100032533
417 Ga0075435_100263803
418 Ga0111539_10015824
419 Ga0105245_10665574
420 Ga0114129_10000286
421 Ga0105243_10016596
422 Ga0105243_10018123
423 Ga0105243_10136985
424 Ga0105241_10403062
425 Ga0105248_10705080
426 Ga0105248_10959913
427 Ga0105249_10026689
428 Ga0105249_10445468
429 Ga0105239_10324028
430 Ga0105239_10327314
431 Ga0105246_10023349
432 Ga0105246_10025408
433 Ga0105246_10851467
434 Ga0157378_10199257
435 Ga0157378_10641560
436 Ga0163162_10361457
437 Ga0157375_10015545
438 Ga0157375_10431628
439 Ga0163163_10391920
440 Ga0163163_10447307
441 Ga0163163_10662666
442 Ga0157380_10467636
443 Ga0157377_10106218
444 Ga0157379_10113749
445 Ga0157376_10648877
446 Ga0163161_10106319
447 Ga0207710_10320919
448 Ga0207643_10026166
449 Ga0207684_10065853
450 Ga0207684_10478407
451 Ga0207662_10540456
452 Ga0207646_10013021
453 Ga0207659_10612069
454 Ga0207687_10136072
455 Ga0207687_10458336
456 Ga0207644_10482435
457 Ga0207644_10790090
458 Ga0207686_10096360
459 Ga0207669_10063804
460 Ga0207669_10068893
461 Ga0207704_10516005
462 Ga0207691_10261459
463 Ga0207711_10969970
464 Ga0207661_10162152
465 Ga0207661_10287517
466 Ga0207679_10042742
467 Ga0207712_10118924
468 Ga0207677_10435035
469 Ga0207703_10581145
470 Ga0207639_10129952
471 Ga0207641_10106456
472 Ga0207676_10132470
473 Ga0207676_11329823
474 Ga0207674_10062328
475 Ga0207674_10620044
476 Ga0207675_101121074
477 Ga0207698_10213543
478 Ga0207698_11266104
479 Ga0209971_1002642
480 Ga0209974_10013814
481 Ga0207428_10070341
482 Ga0265326_10011362
483 Ga0265326_10110896
484 Ga0265319_1001557
485 Ga0265334_10009016
486 Ga0265334_10031261
487 Ga0265334_10031842
488 Ga0265318_10011724
489 Ga0265318_10019556
490 Ga0265318_10034376
491 Ga0265318_10038682
492 Ga0265322_10009410
493 Ga0265336_10018768
494 Ga0265336_10104673
495 Ga0265338_10109029
496 Ga0265338_10110437
497 Ga0265338_10221827
498 Ga0265330_10047851
499 Ga0265332_10009447
500 Ga0265320_10016150
501 Ga0265320_10020855
502 Ga0265320_10043923
503 Ga0265325_10029964
504 Ga0265325_10056488
505 Ga0265325_10113822
506 Ga0265329_10002514
507 Ga0265329_10005869
508 Ga0265340_10011524
509 Ga0265340_10013761
510 Ga0265339_10148297
511 Ga0265331_10023966
512 Ga0265331_10161435
513 Ga0265316_10059121
514 Ga0265316_10072592
515 Ga0265316_10082574
516 Ga0307408_100250216
517 Ga0265313_10037237
518 Ga0265313_10129883
519 Ga0316575_10018399
520 Ga0265314_10004439
521 Ga0265314_10020911
522 Ga0265314_10021387
523 Ga0265342_10028561
524 Ga0265342_10036239
525 Ga0265342_10046397
526 Ga0316578_10037877
527 Ga0307405_10144741
528 Ga0307413_10235558
529 Ga0307413_10454425
530 Ga0307409_100322491
531 Ga0307409_101321391
532 Ga0307416_100009750
533 Ga0307416_100318507
534 Ga0307411_10116737
535 Ga0307411_10397277
536 Ga0307415_100049572
537 Ga0307415_100194555
538 Ga0316583_10005396
539 Ga0316593_10006625
540 Ga0316593_10007619
541 Ga0316593_10029349
542 Ga0316593_10035770
543 Ga0316593_10047480
544 Ga0316592_1002554
545 Ga0316592_1003672
546 Ga0316586_1005815
547 Ga0316596_1003816
548 Ga0316596_1005564
549 Ga0316596_1014083
550 Ga0316596_1016396
551 Ga0373928_0086598
552 Ga0373944_0171258
553 Ga0373960_0204234
554 Ga0373943_0049010
555 Ga0373943_0459265
556 Ga0373946_0257058
557 Ga0373955_0353648
558 Ga0373955_0625068
559 Ga0373962_0074924
560 Ga0316574_0076384
561 Ga0316574_0114081
562 Ga0316574_0407593
563 Ga0373933_0413441
564 Ga0373947_0132589
565 Ga0373937_0401014
566 Ga0373937_0843864
567 Ga0316582_0080901
568 Ga0439465_0109962
569 Ga0451839_0346456
570 Ga0451853_3340028
571 Ga0439454_022476
572 Ga0450920_011506
573 Ga0450906_019714
574 Ga0439435_0010981
575 Ga0439435_0067058
576 Ga0451577_0014643
577 Ga0451577_0183675
578 Ga0451577_0745767
579 Ga0453683_0045268
580 Ga0453684_0222250
581 Ga0451576_0071187
582 Ga0451576_0761997
583 Ga0495592_0284450
584 Ga0495653_0205626
585 Ga0495582_0444362
586 Ga0495662_0068237
587 Ga0495608_0473066
588 Ga0495628_0244354
589 Ga0495628_0290582
590 Ga0495652_0300420
591 Ga0495640_0247555
592 Ga0495640_0349427
593 Ga0495645_0221258
594 Ga0495667_0034977
595 Ga0495656_0034059
596 Ga0495656_0404695
597 Ga0495634_0104509
598 Ga0495658_0156507
599 Ga0495658_0308695
600 Ga0495624_0233143
601 Ga0495600_0097077
602 Ga0495674_0272576
603 Ga0495674_0549299
604 Ga0495680_0174420
605 Ga0496100_0299646
606 Ga0496100_0455462
607 Ga0496102_0329695
608 Ga0496104_0003658
609 Ga0496104_0009378
610 Ga0496104_0019665
611 Ga0496104_0073010
612 Ga0496104_0274281
613 Ga0496105_0028741
614 Ga0496105_0050162
615 Ga0496105_0216809
616 Ga0496106_0153546
617 Ga0496106_0840295
618 Ga0496107_0154625
619 Ga0496107_0205788
620 Ga0496108_0014798
621 Ga0496108_0261472
622 Ga0496108_0276771
623 Ga0496109_0002307
624 Ga0496109_0014248
625 Ga0496109_0015894
626 Ga0496109_0234127
627 Ga0496109_0251559
628 Ga0496110_0035729
629 Ga0496111_0049409
630 Ga0496112_0000012
631 Ga0496112_0056967
632 Ga0496112_0442901
633 Ga0496112_0926142
634 Ga0496113_0131064
635 Ga0496113_0143658
636 Ga0496113_0739366
637 Ga0496113_0877891
638 Ga0496114_0152916
639 Ga0496114_0370273
640 Ga0501031_0110220
641 Ga0501031_0211958
642 Ga0501033_0378663
643 Ga0501036_0075284
644 Ga0501036_0078835
645 Ga0501037_0058493
646 Ga0501038_0136775
647 Ga0501038_0160233
648 Ga0501039_0022486
649 Ga0501039_0047952
650 Ga0501040_0036632
651 Ga0501040_0099144
652 Ga0501040_0446451
653 Ga0501041_0008168
654 Ga0501041_0105098
655 Ga0501042_0102726
656 Ga0501042_0462169
657 Ga0501046_0165457
658 Ga0501046_0257277
659 Ga0501048_0048742
660 Ga0501048_0204199
661 Ga0501068_0175541
662 Ga0501068_0216545
663 Ga0501068_0297959
664 Ga0501068_0421853
665 Ga0501071_0018211
666 Ga0501071_0032462
667 Ga0501071_0051534
668 Ga0501071_0134703
669 Ga0501071_0609814
670 Ga0501071_0683464
671 Ga0501072_0008858
672 Ga0501072_0042649
673 Ga0501072_0077978
674 Ga0501072_0188672
675 Ga0501073_0174971
676 Ga0501074_0116907
677 Ga0501074_0123611
678 Ga0501074_0369556
679 Ga0501074_0514263
680 Ga0501075_0004911
681 Ga0501075_0013739
682 Ga0501075_0237131
683 Ga0501075_0499374
684 Ga0501075_0640576
685 Ga0501075_0693284
686 Ga0501076_0027428
687 Ga0501076_0100029
688 Ga0501076_0117930
689 Ga0501076_0239469
690 Ga0501076_0664386
691 Ga0501076_0686545
692 Ga0501077_0061890
693 Ga0501077_0118041
694 Ga0501077_0438266
695 Ga0501077_0458349
696 Ga0501079_0002556
697 Ga0501080_0153825
698 Ga0501080_0320503
699 Ga0501080_0391022
700 Ga0501080_0432746
701 Ga0501081_0058135
702 Ga0501081_0100110
703 Ga0501081_0124675
704 Ga0501045_0146495
705 Ga0501045_0164392
706 nmdc:mga05p37_1968_c1
707 nmdc:mga09592_164275_c1
708 nmdc:mga06r32_48607_c1
709 nmdc:mga08y16_37726_c1
710 nmdc:mga0n895_289441_c1
711 nmdc:mga0n895_691079_c1
712 nmdc:mga0rr50_362877_c1
713 nmdc:mga0a205_120463_c1
714 nmdc:mga0a205_28552_c1
715 Ga0495601_0192295
716 Ga0495601_0218656
717 Ga0495612_0000203
718 Ga0495595_0044585
719 Ga0495595_0084158
720 Ga0495619_0162158
721 Ga0501084_0048616
722 Ga0501084_0073678
723 Ga0501084_0402688
724 Ga0501084_0941744
725 Ga0590074_017681
726 Ga0590075_025487
727 Ga0590077_017541
728 Ga0501082_0076013
729 Ga0501082_0091952
730 Ga0501082_0144403
731 Ga0530510_0003811
732 Ga0530510_0027651
733 Ga0530510_0060762
734 Ga0530510_0104721
735 Ga0530510_0127434
736 Ga0530510_0176177
737 Ga0530510_0225550
738 Ga0530510_0470902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13686

DrsE_2

DsrE/DsrF/DrsH-like family

134

180

0.96

PF13686

DrsE_2

DsrE/DsrF/DrsH-like family

46

135

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.8944 45 200
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.8837 45 200
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8343 45 200
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8232 45 200
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.8137 45 200
ID Description Score Start End Superfamily
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8893 41 81 3.40.50.10860
af_Q2G1R7_198_355_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8822 44 200 3.40.1260.10
af_Q17399_1_268_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.868 44 80 3.40.50.2000
af_Q2G1R7_198_355_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8668 44 200 3.40.1260.10
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8342 46 200 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A7Y3PG71-F1-model_v4 Proton-conducting membrane transporter 0.9515 48 200 GO:0016020
AF-C7LYV7-F1-model_v4 Putative NADH dehydrogenase 0.9439 40 200
AF-A0A523C360-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9401 46 200 GO:0016020
AF-A0A7Y3PG71-F1-model_v4 Proton-conducting membrane transporter 0.9396 48 200 GO:0016020
AF-A0A1F2YCQ1-F1-model_v4 NADH dehydrogenase 0.9315 49 200

Map