F425105

General Info

Members Datasets Scaffolds Average Seq Length
369 216 738 222

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0157605|Ga0373937_0157605_651_1406
Length 251
Sequence MAPTPCCGVAGGNGGLFPRDHSEPLAVARPVLVAPSILSADFGRLAEEVRAAELAGADWIHVDVMDGRFVPNITIGPVVVEAVRRATAKPVDVHLMIVEPEHYLDDFAKAGADHLIVHCEPGSTIHLHRTLSHIRDLGKVAGVVLNPATPLSQIEYVLHLCGVVLIMTVNPGFGGQKFLPEMLPKIAALRRMCDERGFDPVIEVDGGLSGENAWQVVEAGANSIVAGSAVFHARDYAEAIAAIRHSTPGRS

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 6.78
Rhizosphere 85.64
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0157605 3300036401 Bacteria 2128
2 rootH1_10017124 3300003323 Bacteria 13318
3 Ga0070683_100032505 3300005329 Bacteria 4751
4 Ga0068869_100084025 3300005334 Bacteria 2382
5 Ga0070680_100024878 3300005336 Bacteria 4785
6 Ga0070680_100026095 3300005336 Bacteria 4673
7 Ga0070682_100248016 3300005337 Bacteria 1282
8 Ga0068868_100964361 3300005338 Bacteria 778
9 Ga0070691_10030367 3300005341 Bacteria 2531
10 Ga0070691_10288329 3300005341 Bacteria 893
11 Ga0070671_100080874 3300005355 Bacteria 2717
12 Ga0070703_10000571 3300005406 Bacteria 13353
13 Ga0070703_10092018 3300005406 Bacteria 1053
14 Ga0070709_10015291 3300005434 Bacteria 4363
15 Ga0070713_100003373 3300005436 Bacteria 10547
16 Ga0070701_10010285 3300005438 Bacteria 4131
17 Ga0070711_100002484 3300005439 Bacteria 10529
18 Ga0070705_100003349 3300005440 Bacteria 7867
19 Ga0070694_100001180 3300005444 Bacteria 15009
20 Ga0070694_100033897 3300005444 Bacteria 3364
21 Ga0070694_100043709 3300005444 Bacteria 2997
22 Ga0070694_100111073 3300005444 Bacteria 1953
23 Ga0070708_100013035 3300005445 Bacteria 6794
24 Ga0070708_100013514 3300005445 Bacteria 6688
25 Ga0070708_100028221 3300005445 Bacteria 4827
26 Ga0070708_100043733 3300005445 Bacteria 3936
27 Ga0070678_100110938 3300005456 Bacteria 2146
28 Ga0070662_100199645 3300005457 Bacteria 1586
29 Ga0070681_10001515 3300005458 Bacteria 20591
30 Ga0070681_10106217 3300005458 Bacteria 2749
31 Ga0070681_10251871 3300005458 Bacteria 1678
32 Ga0070681_10324950 3300005458 Bacteria 1448
33 Ga0068867_100091203 3300005459 Bacteria 2313
34 Ga0070706_100004140 3300005467 Bacteria 14103
35 Ga0070706_100215939 3300005467 Bacteria 1790
36 Ga0070706_100265824 3300005467 Bacteria 1601
37 Ga0070706_101030428 3300005467 Bacteria 758
38 Ga0070707_100005382 3300005468 Bacteria 11975
39 Ga0070707_100009765 3300005468 Bacteria 8921
40 Ga0070707_100013120 3300005468 Bacteria 7746
41 Ga0070707_100361115 3300005468 Bacteria 1411
42 Ga0070698_100018190 3300005471 Bacteria 7399
43 Ga0070698_100387094 3300005471 Bacteria 1331
44 Ga0070699_100063705 3300005518 Bacteria 3197
45 Ga0070699_100132500 3300005518 Bacteria 2197
46 Ga0070679_100015073 3300005530 Bacteria 7427
47 Ga0070679_100143639 3300005530 Bacteria 2365
48 Ga0070684_100031291 3300005535 Bacteria 4528
49 Ga0070697_100003196 3300005536 Bacteria 12582
50 Ga0070697_100004565 3300005536 Bacteria 10633
51 Ga0070697_100161672 3300005536 Bacteria 1892
52 Ga0070697_100165507 3300005536 Bacteria 1870
53 Ga0070686_100315810 3300005544 Bacteria 1163
54 Ga0070695_100001887 3300005545 Bacteria 11848
55 Ga0070695_100010449 3300005545 Bacteria 5542
56 Ga0070696_100001401 3300005546 Bacteria 15762
57 Ga0070696_100007128 3300005546 Bacteria 7467
58 Ga0070696_100128278 3300005546 Bacteria 1843
59 Ga0070665_100048987 3300005548 Bacteria 4240
60 Ga0070704_100002085 3300005549 Bacteria 11111
61 Ga0070704_100021287 3300005549 Bacteria 4202
62 Ga0070704_100035511 3300005549 Bacteria 3389
63 Ga0070704_100043516 3300005549 Bacteria 3113
64 Ga0070704_100046653 3300005549 Bacteria 3024
65 Ga0070704_100071962 3300005549 Bacteria 2514
66 Ga0070704_100180087 3300005549 Bacteria 1689
67 Ga0070704_100253507 3300005549 Bacteria 1446
68 Ga0070704_100371847 3300005549 Bacteria 1212
69 Ga0068855_100464570 3300005563 Bacteria 1380
70 Ga0068854_100374137 3300005578 Bacteria 1172
71 Ga0070702_100101654 3300005615 Bacteria 1764
72 Ga0068859_100023595 3300005617 Bacteria 6173
73 Ga0068859_100263208 3300005617 Bacteria 1816
74 Ga0068858_100284335 3300005842 Bacteria 1575
75 Ga0068862_100020236 3300005844 Bacteria 5559
76 Ga0068862_100318311 3300005844 Bacteria 1435
77 Ga0081540_1009749 3300005983 Bacteria 6581
78 Ga0081540_1023929 3300005983 Bacteria 3556
79 Ga0070717_10277711 3300006028 Bacteria 1485
80 Ga0075365_10326264 3300006038 Bacteria 1081
81 Ga0075368_10046316 3300006042 Unclassified 1720
82 Ga0075363_100013347 3300006048 Bacteria 3978
83 Ga0075364_10000631 3300006051 Bacteria 18165
84 Ga0070712_100307795 3300006175 Bacteria 1284
85 Ga0075362_10000004 3300006177 Bacteria 135261
86 Ga0075370_10000606 3300006353 Bacteria 13857
87 Ga0075428_100005684 3300006844 Bacteria 13863
88 Ga0075428_100068628 3300006844 Bacteria 3878
89 Ga0075428_100122902 3300006844 Bacteria 2825
90 Ga0075428_101031309 3300006844 Bacteria 870
91 Ga0075431_100079536 3300006847 Bacteria 3384
92 Ga0075431_100086568 3300006847 Bacteria 3233
93 Ga0075433_10017616 3300006852 Bacteria 5923
94 Ga0075433_10065810 3300006852 Bacteria 3179
95 Ga0075433_10105813 3300006852 Bacteria 2493
96 Ga0075433_10156018 3300006852 Bacteria 2031
97 Ga0075433_10189417 3300006852 Bacteria 1830
98 Ga0075434_100009964 3300006871 Bacteria 8893
99 Ga0075434_100013145 3300006871 Bacteria 7864
100 Ga0075434_100015498 3300006871 Bacteria 7312
101 Ga0075434_100066864 3300006871 Bacteria 3581
102 Ga0075434_100071005 3300006871 Bacteria 3473
103 Ga0075434_100091250 3300006871 Bacteria 3048
104 Ga0075434_100444239 3300006871 Bacteria 1318
105 Ga0075434_100456784 3300006871 Bacteria 1298
106 Ga0075434_100940141 3300006871 Bacteria 879
107 Ga0075429_100059783 3300006880 Bacteria 3320
108 Ga0075436_100025380 3300006914 Bacteria 4078
109 Ga0075436_100047745 3300006914 Bacteria 2953
110 Ga0075436_100111565 3300006914 Bacteria 1909
111 Ga0075436_100177450 3300006914 Bacteria 1505
112 Ga0097620_100023596 3300006931 Bacteria 6173
113 Ga0097620_100263243 3300006931 Bacteria 1816
114 Ga0075435_100007775 3300007076 Bacteria 7662
115 Ga0075435_100031087 3300007076 Bacteria 4203
116 Ga0075435_100042034 3300007076 Bacteria 3655
117 Ga0075435_100063291 3300007076 Bacteria 3004
118 Ga0075435_100429389 3300007076 Bacteria 1138
119 Ga0099794_10000020 3300007265 Bacteria 72580
120 Ga0099794_10025856 3300007265 Bacteria 2709
121 Ga0099795_10064357 3300007788 Bacteria 1369
122 Ga0111539_10007891 3300009094 Bacteria 13583
123 Ga0111539_10084425 3300009094 Bacteria 3734
124 Ga0111539_10362144 3300009094 Bacteria 1688
125 Ga0114129_10001685 3300009147 Bacteria 30136
126 Ga0114129_10084676 3300009147 Bacteria 4401
127 Ga0114129_10864784 3300009147 Bacteria 1148
128 Ga0105242_10003875 3300009176 Bacteria 11626
129 Ga0105248_10031695 3300009177 Bacteria 5906
130 Ga0105249_10906022 3300009553 Bacteria 949
131 Ga0157369_10078781 3300013105 Bacteria 3530
132 Ga0157378_10358789 3300013297 Bacteria 1426
133 Ga0157372_10058992 3300013307 Bacteria 4291
134 Ga0163163_10026614 3300014325 Bacteria 5532
135 Ga0157376_10001977 3300014969 Bacteria 13719
136 Ga0213873_10084252 3300021358 Bacteria 894
137 Ga0213876_10214449 3300021384 Bacteria 1024
138 Ga0213875_10113275 3300021388 Bacteria 1267
139 Ga0207653_10000048 3300025885 Bacteria 90730
140 Ga0207684_10090429 3300025910 Bacteria 2608
141 Ga0207707_10056331 3300025912 Bacteria 3420
142 Ga0207707_10099548 3300025912 Bacteria 2541
143 Ga0207707_10149726 3300025912 Bacteria 2041
144 Ga0207695_10080796 3300025913 Bacteria 3291
145 Ga0207693_10001564 3300025915 Bacteria 20202
146 Ga0207660_10018869 3300025917 Bacteria 4605
147 Ga0207660_10057249 3300025917 Bacteria 2792
148 Ga0207652_10318999 3300025921 Bacteria 1403
149 Ga0207652_10336634 3300025921 Bacteria 1362
150 Ga0207652_10678110 3300025921 Bacteria 921
151 Ga0207646_10004797 3300025922 Bacteria 14508
152 Ga0207646_10029301 3300025922 Bacteria 5005
153 Ga0207646_10057420 3300025922 Bacteria 3477
154 Ga0207646_10257531 3300025922 Bacteria 1577
155 Ga0207646_10428744 3300025922 Bacteria 1193
156 Ga0207664_10013534 3300025929 Bacteria 5860
157 Ga0207644_10064431 3300025931 Bacteria 2663
158 Ga0207706_10226902 3300025933 Bacteria 1635
159 Ga0207709_10241601 3300025935 Bacteria 1314
160 Ga0207709_10481553 3300025935 Bacteria 965
161 Ga0207711_10199923 3300025941 Bacteria 1823
162 Ga0207661_10001615 3300025944 Bacteria 15334
163 Ga0207712_10136246 3300025961 Bacteria 1878
164 Ga0207640_10279332 3300025981 Bacteria 1311
165 Ga0207658_10272532 3300025986 Bacteria 1447
166 Ga0207708_10043592 3300026075 Bacteria 3419
167 Ga0207708_10256515 3300026075 Bacteria 1410
168 Ga0207648_10094300 3300026089 Bacteria 2617
169 Ga0207674_10590274 3300026116 Bacteria 1073
170 Ga0207683_10234354 3300026121 Bacteria 1674
171 Ga0209588_1002292 3300027671 Bacteria 5178
172 Ga0209813_10099024 3300027866 Unclassified 990
173 Ga0207428_10003412 3300027907 Bacteria 15437
174 Ga0268266_10110492 3300028379 Bacteria 2435
175 Ga0268265_10050486 3300028380 Bacteria 3134
176 Ga0307408_100103562 3300031548 Bacteria 2173
177 Ga0307410_10256784 3300031852 Bacteria 1361
178 Ga0307406_10069555 3300031901 Bacteria 2302
179 Ga0307407_10199201 3300031903 Bacteria 1341
180 Ga0307409_100077192 3300031995 Bacteria 2675
181 Ga0307416_100189102 3300032002 Bacteria 1939
182 Ga0307414_10034727 3300032004 Bacteria 3348
183 Ga0307415_100140840 3300032126 Bacteria 1842
184 Ga0373958_0041634 3300034819 Bacteria 941
185 Ga0373934_0063336 3300035086 Bacteria 1475
186 Ga0373940_0017827 3300035088 Bacteria 1774
187 Ga0373940_0061402 3300035088 Bacteria 1076
188 Ga0373951_0086041 3300035091 Bacteria 819
189 Ga0373932_0085084 3300035112 Bacteria 1006
190 Ga0373939_0254331 3300035114 Bacteria 685
191 Ga0373953_0113807 3300035117 Bacteria 1146
192 Ga0373956_0024425 3300035119 Bacteria 2604
193 Ga0373956_0080446 3300035119 Bacteria 1495
194 Ga0373943_0136972 3300035170 Bacteria 1316
195 Ga0373955_0002079 3300035172 Bacteria 8630
196 Ga0373955_0141283 3300035172 Bacteria 1412
197 Ga0373961_0019862 3300035241 Bacteria 1770
198 Ga0373961_0033693 3300035241 Bacteria 1444
199 Ga0373931_0096023 3300035691 Bacteria 1660
200 Ga0373935_0065900 3300035692 Bacteria 2325
201 Ga0373927_0002144 3300035695 Bacteria 14504
202 Ga0373947_0005016 3300035725 Bacteria 7750
203 Ga0373947_0086012 3300035725 Bacteria 1953
204 Ga0373937_0133552 3300036401 Bacteria 2319
205 Ga0373937_0135082 3300036401 Bacteria 2306
206 Ga0373925_0082984 3300037068 Bacteria 2440
207 Ga0395900_0838906 3300037418 Bacteria 845
208 Ga0395905_0236127 3300037471 Bacteria 1709
209 Ga0436364_1420535 3300037853 Bacteria 6293
210 Ga0395901_0779679 3300038443 Bacteria 947
211 Ga0242420_054002 3300038996 Bacteria 790
212 Ga0436365_0137876 3300039437 Bacteria 3661
213 Ga0436360_0828034 3300039438 Bacteria 1116
214 Ga0436363_0584836 3300039450 Bacteria 2105
215 Ga0436362_0178433 3300039453 Bacteria 2071
216 Ga0436362_0283118 3300039453 Bacteria 2414
217 Ga0436362_0797226 3300039453 Bacteria 950
218 Ga0451807_1547469 3300041486 Bacteria 1337
219 Ga0451849_0138686 3300041505 Bacteria 788
220 Ga0439462_0043834 3300042015 Bacteria 1196
221 Ga0451577_0000104 3300042876 Bacteria 186417
222 Ga0451577_0302465 3300042876 Bacteria 1449
223 Ga0451577_0576799 3300042876 Bacteria 1021
224 Ga0451577_0641458 3300042876 Bacteria 963
225 Ga0453684_0000364 3300044712 Bacteria 186418
226 Ga0451576_0001404 3300045051 Bacteria 41339
227 Ga0451576_0003210 3300045051 Bacteria 22792
228 Ga0451576_0026008 3300045051 Bacteria 6298
229 Ga0451576_0086630 3300045051 Bacteria 3257
230 Ga0451576_0460690 3300045051 Bacteria 1335
231 Ga0451576_0807763 3300045051 Bacteria 985
232 Ga0495629_0249034 3300046459 Bacteria 1223
233 Ga0495651_0186943 3300046462 Bacteria 1461
234 Ga0495651_0217662 3300046462 Bacteria 1324
235 Ga0495651_0285983 3300046462 Bacteria 1112
236 Ga0495580_0004863 3300046472 Bacteria 11239
237 Ga0495580_0015365 3300046472 Bacteria 5775
238 Ga0495582_0029237 3300046473 Bacteria 3025
239 Ga0495594_0003388 3300046499 Bacteria 8232
240 Ga0495594_0140085 3300046499 Bacteria 1372
241 Ga0495608_0015246 3300046511 Bacteria 5332
242 Ga0495610_0047804 3300046512 Bacteria 2103
243 Ga0495618_0051392 3300046514 Bacteria 2604
244 Ga0495630_0076096 3300046517 Bacteria 2529
245 Ga0495666_0073565 3300046526 Bacteria 1622
246 Ga0495652_0191921 3300046529 Bacteria 1558
247 Ga0495640_0069601 3300046533 Bacteria 2367
248 Ga0495586_0035933 3300046535 Bacteria 2661
249 Ga0495609_0021320 3300046538 Bacteria 2989
250 Ga0495621_0073282 3300046539 Bacteria 1265
251 Ga0495667_0004929 3300046559 Bacteria 9026
252 Ga0495657_0169900 3300046675 Bacteria 1343
253 Ga0495599_0095620 3300046678 Bacteria 1853
254 Ga0495669_0060376 3300046684 Bacteria 1714
255 Ga0495600_0047974 3300046809 Bacteria 2786
256 Ga0495600_0147034 3300046809 Bacteria 1527
257 Ga0495604_0041814 3300047317 Bacteria 3594
258 Ga0495636_0006596 3300047318 Bacteria 4564
259 Ga0495636_0054872 3300047318 Bacteria 1675
260 Ga0495680_0042286 3300047322 Bacteria 3618
261 Ga0495680_0054925 3300047322 Bacteria 3090
262 Ga0495675_0025199 3300047444 Bacteria 3793
263 Ga0495684_0015025 3300047471 Bacteria 5962
264 Ga0495593_0390740 3300047673 Bacteria 696
265 Ga0496100_0032443 3300048903 Bacteria 3258
266 Ga0496101_0031477 3300048904 Bacteria 3730
267 Ga0496102_0051962 3300048905 Bacteria 3733
268 Ga0496102_0091724 3300048905 Bacteria 2812
269 Ga0496103_0005063 3300048906 Bacteria 7944
270 Ga0496104_0001538 3300048907 Bacteria 19909
271 Ga0496104_0030437 3300048907 Bacteria 5016
272 Ga0496105_0020171 3300048908 Bacteria 5383
273 Ga0496107_0073161 3300048910 Bacteria 2493
274 Ga0496108_0001156 3300048911 Bacteria 20587
275 Ga0496108_0010058 3300048911 Bacteria 7673
276 Ga0496108_0016764 3300048911 Bacteria 5985
277 Ga0496109_0004964 3300048912 Bacteria 11112
278 Ga0496109_0007955 3300048912 Bacteria 8987
279 Ga0496109_0016492 3300048912 Bacteria 6459
280 Ga0496110_0009546 3300048913 Bacteria 7854
281 Ga0496110_0070531 3300048913 Bacteria 3096
282 Ga0496111_0078314 3300048914 Bacteria 2410
283 Ga0496111_0494620 3300048914 Bacteria 900
284 Ga0496112_0007080 3300048915 Bacteria 9911
285 Ga0496112_0017204 3300048915 Bacteria 6789
286 Ga0496112_0025675 3300048915 Bacteria 5659
287 Ga0496113_0006189 3300048916 Bacteria 7559
288 Ga0496115_0023742 3300048918 Bacteria 4760
289 Ga0496117_0021492 3300048920 Bacteria 5217
290 Ga0496118_0001617 3300048921 Bacteria 33315
291 Ga0496122_0143477 3300048925 Bacteria 1489
292 Ga0496123_0263461 3300048926 Bacteria 843
293 Ga0496124_0172057 3300048927 Bacteria 1676
294 Ga0496125_0011654 3300048928 Bacteria 8778
295 Ga0496126_0002493 3300048929 Bacteria 24761
296 Ga0496126_0155409 3300048929 Bacteria 1958
297 Ga0501032_0532213 3300049569 Bacteria 750
298 Ga0501034_0555867 3300049571 Bacteria 1057
299 Ga0501041_0170015 3300049577 Bacteria 1364
300 Ga0501043_0020865 3300049579 Bacteria 5139
301 Ga0501046_0998696 3300049580 Bacteria 581
302 Ga0501047_0001117 3300049581 Bacteria 26643
303 Ga0501072_0336408 3300049588 Bacteria 1199
304 Ga0501073_0105490 3300049589 Bacteria 1955
305 Ga0501073_0117774 3300049589 Bacteria 1840
306 Ga0501074_0016567 3300049590 Bacteria 5350
307 Ga0501259_000058 3300049688 Bacteria 15243
308 Ga0501079_0313634 3300049741 Bacteria 1227
309 Ga0501080_0006009 3300049742 Bacteria 10885
310 Ga0501080_0491593 3300049742 Bacteria 1097
311 Ga0501083_0021818 3300049744 Bacteria 4447
312 Ga0501083_0128086 3300049744 Bacteria 1664
313 Ga0501035_0208011 3300049822 Bacteria 1675
314 Ga0501044_0230688 3300049823 Bacteria 1799
315 nmdc:mga03683_10_c1 3300050489 Bacteria 135396
316 nmdc:mga03n38_1469_c1 3300050490 Bacteria 6781
317 nmdc:mga00v17_703_c1 3300050491 Bacteria 18293
318 nmdc:mga04h51_32094_c1 3300050495 Unclassified 1663
319 nmdc:mga07m45_4946_c1 3300050496 Bacteria 6571
320 nmdc:mga05p37_1647_c1 3300050507 Bacteria 25911
321 nmdc:mga05p37_336951_c1 3300050507 Bacteria 1780
322 nmdc:mga05p37_901256_c1 3300050507 Bacteria 953
323 nmdc:mga09592_56089_c1 3300050508 Bacteria 3329
324 nmdc:mga06r32_201809_c1 3300050510 Bacteria 1976
325 nmdc:mga06r32_589264_c1 3300050510 Bacteria 1083
326 nmdc:mga08y16_1287296_c1 3300050511 Bacteria 698
327 nmdc:mga08y16_171977_c1 3300050511 Bacteria 2250
328 nmdc:mga08y16_1930_c1 3300050511 Bacteria 21159
329 nmdc:mga08y16_745011_c1 3300050511 Bacteria 976
330 nmdc:mga0n895_12286_c1 3300050512 Bacteria 7674
331 nmdc:mga0n895_258688_c1 3300050512 Bacteria 1767
332 nmdc:mga0n895_269358_c1 3300050512 Bacteria 1728
333 nmdc:mga0n895_352694_c1 3300050512 Bacteria 1490
334 nmdc:mga0n895_357300_c1 3300050512 Bacteria 1480
335 nmdc:mga0n895_390936_c1 3300050512 Bacteria 1407
336 nmdc:mga0n895_41406_c1 3300050512 Bacteria 4479
337 nmdc:mga0n895_714933_c1 3300050512 Bacteria 997
338 nmdc:mga0n895_94329_c1 3300050512 Bacteria 2996
339 nmdc:mga0rr50_103722_c1 3300050513 Bacteria 2239
340 nmdc:mga0rr50_152677_c1 3300050513 Bacteria 1868
341 nmdc:mga0rr50_191286_c1 3300050513 Bacteria 1677
342 nmdc:mga0rr50_33411_c1 3300050513 Bacteria 3675
343 nmdc:mga0rr50_63942_c1 3300050513 Bacteria 2781
344 nmdc:mga0rr50_653060_c1 3300050513 Bacteria 897
345 nmdc:mga0rr50_72022_c1 3300050513 Bacteria 2639
346 nmdc:mga0rr50_73531_c1 3300050513 Bacteria 2614
347 nmdc:mga08x19_15706_c1 3300050514 Bacteria 4607
348 nmdc:mga08x19_186443_c1 3300050514 Bacteria 1418
349 nmdc:mga08x19_42232_c1 3300050514 Bacteria 2906
350 nmdc:mga08x19_54385_c1 3300050514 Bacteria 2577
351 nmdc:mga08x19_55403_c1 3300050514 Bacteria 2555
352 nmdc:mga08x19_5694_c1 3300050514 Bacteria 6282
353 nmdc:mga08x19_595346_c1 3300050514 Bacteria 783
354 nmdc:mga0a205_18955_c1 3300050515 Bacteria 6482
355 nmdc:mga0a205_246981_c1 3300050515 Bacteria 1665
356 nmdc:mga0a205_32620_c1 3300050515 Bacteria 4993
357 nmdc:mga0a205_59448_c1 3300050515 Bacteria 3692
358 Ga0495601_0005470 3300053077 Bacteria 7402
359 Ga0495601_0044093 3300053077 Bacteria 2803
360 Ga0495601_0181924 3300053077 Bacteria 1374
361 Ga0495595_0021451 3300053084 Bacteria 2823
362 Ga0495595_0121282 3300053084 Bacteria 1273
363 Ga0495595_0143016 3300053084 Bacteria 1174
364 Ga0495619_0007969 3300053085 Bacteria 6703
365 Ga0495619_0055166 3300053085 Bacteria 2631
366 Ga0495619_0101900 3300053085 Bacteria 1955
367 Ga0495619_0167002 3300053085 Bacteria 1521
368 Ga0500638_000018 3300053162 Bacteria 96393
369 Ga0501084_0000657 3300054114 Bacteria 26380
370 Ga0373937_0157605
371 rootH1_10017124
372 Ga0070683_100032505
373 Ga0068869_100084025
374 Ga0070680_100024878
375 Ga0070680_100026095
376 Ga0070682_100248016
377 Ga0068868_100964361
378 Ga0070691_10030367
379 Ga0070691_10288329
380 Ga0070671_100080874
381 Ga0070703_10000571
382 Ga0070703_10092018
383 Ga0070709_10015291
384 Ga0070713_100003373
385 Ga0070701_10010285
386 Ga0070711_100002484
387 Ga0070705_100003349
388 Ga0070694_100001180
389 Ga0070694_100033897
390 Ga0070694_100043709
391 Ga0070694_100111073
392 Ga0070708_100013035
393 Ga0070708_100013514
394 Ga0070708_100028221
395 Ga0070708_100043733
396 Ga0070678_100110938
397 Ga0070662_100199645
398 Ga0070681_10001515
399 Ga0070681_10106217
400 Ga0070681_10251871
401 Ga0070681_10324950
402 Ga0068867_100091203
403 Ga0070706_100004140
404 Ga0070706_100215939
405 Ga0070706_100265824
406 Ga0070706_101030428
407 Ga0070707_100005382
408 Ga0070707_100009765
409 Ga0070707_100013120
410 Ga0070707_100361115
411 Ga0070698_100018190
412 Ga0070698_100387094
413 Ga0070699_100063705
414 Ga0070699_100132500
415 Ga0070679_100015073
416 Ga0070679_100143639
417 Ga0070684_100031291
418 Ga0070697_100003196
419 Ga0070697_100004565
420 Ga0070697_100161672
421 Ga0070697_100165507
422 Ga0070686_100315810
423 Ga0070695_100001887
424 Ga0070695_100010449
425 Ga0070696_100001401
426 Ga0070696_100007128
427 Ga0070696_100128278
428 Ga0070665_100048987
429 Ga0070704_100002085
430 Ga0070704_100021287
431 Ga0070704_100035511
432 Ga0070704_100043516
433 Ga0070704_100046653
434 Ga0070704_100071962
435 Ga0070704_100180087
436 Ga0070704_100253507
437 Ga0070704_100371847
438 Ga0068855_100464570
439 Ga0068854_100374137
440 Ga0070702_100101654
441 Ga0068859_100023595
442 Ga0068859_100263208
443 Ga0068858_100284335
444 Ga0068862_100020236
445 Ga0068862_100318311
446 Ga0081540_1009749
447 Ga0081540_1023929
448 Ga0070717_10277711
449 Ga0075365_10326264
450 Ga0075368_10046316
451 Ga0075363_100013347
452 Ga0075364_10000631
453 Ga0070712_100307795
454 Ga0075362_10000004
455 Ga0075370_10000606
456 Ga0075428_100005684
457 Ga0075428_100068628
458 Ga0075428_100122902
459 Ga0075428_101031309
460 Ga0075431_100079536
461 Ga0075431_100086568
462 Ga0075433_10017616
463 Ga0075433_10065810
464 Ga0075433_10105813
465 Ga0075433_10156018
466 Ga0075433_10189417
467 Ga0075434_100009964
468 Ga0075434_100013145
469 Ga0075434_100015498
470 Ga0075434_100066864
471 Ga0075434_100071005
472 Ga0075434_100091250
473 Ga0075434_100444239
474 Ga0075434_100456784
475 Ga0075434_100940141
476 Ga0075429_100059783
477 Ga0075436_100025380
478 Ga0075436_100047745
479 Ga0075436_100111565
480 Ga0075436_100177450
481 Ga0097620_100023596
482 Ga0097620_100263243
483 Ga0075435_100007775
484 Ga0075435_100031087
485 Ga0075435_100042034
486 Ga0075435_100063291
487 Ga0075435_100429389
488 Ga0099794_10000020
489 Ga0099794_10025856
490 Ga0099795_10064357
491 Ga0111539_10007891
492 Ga0111539_10084425
493 Ga0111539_10362144
494 Ga0114129_10001685
495 Ga0114129_10084676
496 Ga0114129_10864784
497 Ga0105242_10003875
498 Ga0105248_10031695
499 Ga0105249_10906022
500 Ga0157369_10078781
501 Ga0157378_10358789
502 Ga0157372_10058992
503 Ga0163163_10026614
504 Ga0157376_10001977
505 Ga0213873_10084252
506 Ga0213876_10214449
507 Ga0213875_10113275
508 Ga0207653_10000048
509 Ga0207684_10090429
510 Ga0207707_10056331
511 Ga0207707_10099548
512 Ga0207707_10149726
513 Ga0207695_10080796
514 Ga0207693_10001564
515 Ga0207660_10018869
516 Ga0207660_10057249
517 Ga0207652_10318999
518 Ga0207652_10336634
519 Ga0207652_10678110
520 Ga0207646_10004797
521 Ga0207646_10029301
522 Ga0207646_10057420
523 Ga0207646_10257531
524 Ga0207646_10428744
525 Ga0207664_10013534
526 Ga0207644_10064431
527 Ga0207706_10226902
528 Ga0207709_10241601
529 Ga0207709_10481553
530 Ga0207711_10199923
531 Ga0207661_10001615
532 Ga0207712_10136246
533 Ga0207640_10279332
534 Ga0207658_10272532
535 Ga0207708_10043592
536 Ga0207708_10256515
537 Ga0207648_10094300
538 Ga0207674_10590274
539 Ga0207683_10234354
540 Ga0209588_1002292
541 Ga0209813_10099024
542 Ga0207428_10003412
543 Ga0268266_10110492
544 Ga0268265_10050486
545 Ga0307408_100103562
546 Ga0307410_10256784
547 Ga0307406_10069555
548 Ga0307407_10199201
549 Ga0307409_100077192
550 Ga0307416_100189102
551 Ga0307414_10034727
552 Ga0307415_100140840
553 Ga0373958_0041634
554 Ga0373934_0063336
555 Ga0373940_0017827
556 Ga0373940_0061402
557 Ga0373951_0086041
558 Ga0373932_0085084
559 Ga0373939_0254331
560 Ga0373953_0113807
561 Ga0373956_0024425
562 Ga0373956_0080446
563 Ga0373943_0136972
564 Ga0373955_0002079
565 Ga0373955_0141283
566 Ga0373961_0019862
567 Ga0373961_0033693
568 Ga0373931_0096023
569 Ga0373935_0065900
570 Ga0373927_0002144
571 Ga0373947_0005016
572 Ga0373947_0086012
573 Ga0373937_0133552
574 Ga0373937_0135082
575 Ga0373925_0082984
576 Ga0395900_0838906
577 Ga0395905_0236127
578 Ga0436364_1420535
579 Ga0395901_0779679
580 Ga0242420_054002
581 Ga0436365_0137876
582 Ga0436360_0828034
583 Ga0436363_0584836
584 Ga0436362_0178433
585 Ga0436362_0283118
586 Ga0436362_0797226
587 Ga0451807_1547469
588 Ga0451849_0138686
589 Ga0439462_0043834
590 Ga0451577_0000104
591 Ga0451577_0302465
592 Ga0451577_0576799
593 Ga0451577_0641458
594 Ga0453684_0000364
595 Ga0451576_0001404
596 Ga0451576_0003210
597 Ga0451576_0026008
598 Ga0451576_0086630
599 Ga0451576_0460690
600 Ga0451576_0807763
601 Ga0495629_0249034
602 Ga0495651_0186943
603 Ga0495651_0217662
604 Ga0495651_0285983
605 Ga0495580_0004863
606 Ga0495580_0015365
607 Ga0495582_0029237
608 Ga0495594_0003388
609 Ga0495594_0140085
610 Ga0495608_0015246
611 Ga0495610_0047804
612 Ga0495618_0051392
613 Ga0495630_0076096
614 Ga0495666_0073565
615 Ga0495652_0191921
616 Ga0495640_0069601
617 Ga0495586_0035933
618 Ga0495609_0021320
619 Ga0495621_0073282
620 Ga0495667_0004929
621 Ga0495657_0169900
622 Ga0495599_0095620
623 Ga0495669_0060376
624 Ga0495600_0047974
625 Ga0495600_0147034
626 Ga0495604_0041814
627 Ga0495636_0006596
628 Ga0495636_0054872
629 Ga0495680_0042286
630 Ga0495680_0054925
631 Ga0495675_0025199
632 Ga0495684_0015025
633 Ga0495593_0390740
634 Ga0496100_0032443
635 Ga0496101_0031477
636 Ga0496102_0051962
637 Ga0496102_0091724
638 Ga0496103_0005063
639 Ga0496104_0001538
640 Ga0496104_0030437
641 Ga0496105_0020171
642 Ga0496107_0073161
643 Ga0496108_0001156
644 Ga0496108_0010058
645 Ga0496108_0016764
646 Ga0496109_0004964
647 Ga0496109_0007955
648 Ga0496109_0016492
649 Ga0496110_0009546
650 Ga0496110_0070531
651 Ga0496111_0078314
652 Ga0496111_0494620
653 Ga0496112_0007080
654 Ga0496112_0017204
655 Ga0496112_0025675
656 Ga0496113_0006189
657 Ga0496115_0023742
658 Ga0496117_0021492
659 Ga0496118_0001617
660 Ga0496122_0143477
661 Ga0496123_0263461
662 Ga0496124_0172057
663 Ga0496125_0011654
664 Ga0496126_0002493
665 Ga0496126_0155409
666 Ga0501032_0532213
667 Ga0501034_0555867
668 Ga0501041_0170015
669 Ga0501043_0020865
670 Ga0501046_0998696
671 Ga0501047_0001117
672 Ga0501072_0336408
673 Ga0501073_0105490
674 Ga0501073_0117774
675 Ga0501074_0016567
676 Ga0501259_000058
677 Ga0501079_0313634
678 Ga0501080_0006009
679 Ga0501080_0491593
680 Ga0501083_0021818
681 Ga0501083_0128086
682 Ga0501035_0208011
683 Ga0501044_0230688
684 nmdc:mga03683_10_c1
685 nmdc:mga03n38_1469_c1
686 nmdc:mga00v17_703_c1
687 nmdc:mga04h51_32094_c1
688 nmdc:mga07m45_4946_c1
689 nmdc:mga05p37_1647_c1
690 nmdc:mga05p37_336951_c1
691 nmdc:mga05p37_901256_c1
692 nmdc:mga09592_56089_c1
693 nmdc:mga06r32_201809_c1
694 nmdc:mga06r32_589264_c1
695 nmdc:mga08y16_1287296_c1
696 nmdc:mga08y16_171977_c1
697 nmdc:mga08y16_1930_c1
698 nmdc:mga08y16_745011_c1
699 nmdc:mga0n895_12286_c1
700 nmdc:mga0n895_258688_c1
701 nmdc:mga0n895_269358_c1
702 nmdc:mga0n895_352694_c1
703 nmdc:mga0n895_357300_c1
704 nmdc:mga0n895_390936_c1
705 nmdc:mga0n895_41406_c1
706 nmdc:mga0n895_714933_c1
707 nmdc:mga0n895_94329_c1
708 nmdc:mga0rr50_103722_c1
709 nmdc:mga0rr50_152677_c1
710 nmdc:mga0rr50_191286_c1
711 nmdc:mga0rr50_33411_c1
712 nmdc:mga0rr50_63942_c1
713 nmdc:mga0rr50_653060_c1
714 nmdc:mga0rr50_72022_c1
715 nmdc:mga0rr50_73531_c1
716 nmdc:mga08x19_15706_c1
717 nmdc:mga08x19_186443_c1
718 nmdc:mga08x19_42232_c1
719 nmdc:mga08x19_54385_c1
720 nmdc:mga08x19_55403_c1
721 nmdc:mga08x19_5694_c1
722 nmdc:mga08x19_595346_c1
723 nmdc:mga0a205_18955_c1
724 nmdc:mga0a205_246981_c1
725 nmdc:mga0a205_32620_c1
726 nmdc:mga0a205_59448_c1
727 Ga0495601_0005470
728 Ga0495601_0044093
729 Ga0495601_0181924
730 Ga0495595_0021451
731 Ga0495595_0121282
732 Ga0495595_0143016
733 Ga0495619_0007969
734 Ga0495619_0055166
735 Ga0495619_0101900
736 Ga0495619_0167002
737 Ga0500638_000018
738 Ga0501084_0000657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

32

231

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9333 10 198
1rpx-assembly1.cif.gz_A d-ribulose-5-phosphate 3-epimerase from solanum tuberosum chloroplasts 0.9245 7 202
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9239 10 198
3inp-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. 0.9181 6 198
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9117 10 199
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9404 10 199 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9315 10 199 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9079 10 188 3.20.20.70
af_A4IBQ7_24_252_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8992 10 198 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8939 4 199 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A661INI8-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9544 35 198 GO:0005975
GO:0016857
AF-A0A3B9SKL1-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9532 28 197 GO:0005975
GO:0016857
AF-A0A3B8RQ74-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9531 31 198 GO:0005975
GO:0016857
AF-A0A7C2L3C1-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9511 27 199 GO:0005975
GO:0016857
AF-A0A849FQY7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9491 26 200 GO:0004750
GO:0005975
GO:0006098

Map