F425078

General Info

Members Datasets Scaffolds Average Seq Length
369 186 738 152

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_11424565|Ga0268264_114245651
Length 151
Sequence MVQVETGRFTVGVFQDVAWASKGIDALKQAGLPPESLTILAKDTPDSAALIQKALGVAAERIEVGGVGTVVARGPLLGALGSGQDLAKLGLAGTMRRVGFQSHDGRIFETLAARGGILVAIHSEPRAADALAILFSYGGGNAAIGAWTGRI

Samples

Sample ID Description Type Environment
1 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.34
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 28.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268264_11424565 3300028381 Unclassified 703
2 Ga0065707_10882284 3300005295 Unclassified 550
3 Ga0070676_10003087 3300005328 Bacteria 8608
4 Ga0070676_10167891 3300005328 Bacteria 1417
5 Ga0070690_100501427 3300005330 Bacteria 908
6 Ga0070690_100745258 3300005330 Unclassified 756
7 Ga0070690_101033290 3300005330 Bacteria 649
8 Ga0070670_100586700 3300005331 Unclassified 996
9 Ga0070670_100789245 3300005331 Bacteria 857
10 Ga0068869_101504320 3300005334 Bacteria 598
11 Ga0070666_10125239 3300005335 Bacteria 1784
12 Ga0070680_100295851 3300005336 Bacteria 1372
13 Ga0068868_100336366 3300005338 Unclassified 1290
14 Ga0070660_100043219 3300005339 Bacteria 3443
15 Ga0070689_100031384 3300005340 Unclassified 4037
16 Ga0070689_101449843 3300005340 Bacteria 621
17 Ga0070691_10459829 3300005341 Unclassified 728
18 Ga0070691_10569193 3300005341 Bacteria 664
19 Ga0070687_100024078 3300005343 Bacteria 2901
20 Ga0070687_100196494 3300005343 Unclassified 1219
21 Ga0070661_100077154 3300005344 Unclassified 2456
22 Ga0070668_100098426 3300005347 Bacteria 2315
23 Ga0070669_100037201 3300005353 Bacteria 3530
24 Ga0070669_100155373 3300005353 Bacteria 1774
25 Ga0070669_100284885 3300005353 Unclassified 1325
26 Ga0070669_100843503 3300005353 Bacteria 780
27 Ga0070675_100033959 3300005354 Bacteria 4137
28 Ga0070671_100014004 3300005355 Bacteria 6476
29 Ga0070673_100094407 3300005364 Bacteria 2452
30 Ga0070673_100440420 3300005364 Unclassified 1171
31 Ga0070688_100015865 3300005365 Bacteria 4295
32 Ga0070659_100156376 3300005366 Bacteria 1862
33 Ga0070667_100434641 3300005367 Unclassified 1198
34 Ga0070709_10404280 3300005434 Unclassified 1020
35 Ga0070701_10061352 3300005438 Bacteria 1983
36 Ga0070701_10544703 3300005438 Unclassified 760
37 Ga0070705_100004748 3300005440 Bacteria 6616
38 Ga0070705_100018087 3300005440 Bacteria 3688
39 Ga0070705_100105368 3300005440 Bacteria 1790
40 Ga0070705_101202473 3300005440 Unclassified 624
41 Ga0070700_100016529 3300005441 Bacteria 4204
42 Ga0070694_100146379 3300005444 Unclassified 1721
43 Ga0070694_100198015 3300005444 Bacteria 1496
44 Ga0070678_100490754 3300005456 Bacteria 1082
45 Ga0070662_100096055 3300005457 Bacteria 2235
46 Ga0070662_100291717 3300005457 Bacteria 1323
47 Ga0070681_10032790 3300005458 Bacteria 5215
48 Ga0070681_10173499 3300005458 Bacteria 2078
49 Ga0068867_100131461 3300005459 Viruses 1946
50 Ga0068867_101005868 3300005459 Bacteria 756
51 Ga0068867_101093731 3300005459 Bacteria 727
52 Ga0070706_100212819 3300005467 Bacteria 1805
53 Ga0070707_101047852 3300005468 Bacteria 781
54 Ga0070698_100188584 3300005471 Unclassified 2000
55 Ga0070698_100218368 3300005471 Bacteria 1840
56 Ga0070698_100241857 3300005471 Unclassified 1738
57 Ga0070698_100908831 3300005471 Bacteria 826
58 Ga0070699_100013590 3300005518 Bacteria 7008
59 Ga0070699_100031913 3300005518 Bacteria 4548
60 Ga0070699_101725234 3300005518 Bacteria 573
61 Ga0070679_100053680 3300005530 Unclassified 4012
62 Ga0070679_100508046 3300005530 Bacteria 1149
63 Ga0070697_100202271 3300005536 Unclassified 1688
64 Ga0070697_101677280 3300005536 Unclassified 568
65 Ga0070672_100009885 3300005543 Bacteria 6595
66 Ga0070672_100155968 3300005543 Bacteria 1891
67 Ga0070686_100024935 3300005544 Bacteria 3589
68 Ga0070686_100154282 3300005544 Bacteria 1611
69 Ga0070686_100188646 3300005544 Bacteria 1470
70 Ga0070686_100339871 3300005544 Bacteria 1125
71 Ga0070695_100337597 3300005545 Unclassified 1125
72 Ga0070695_100652950 3300005545 Bacteria 831
73 Ga0070696_100016329 3300005546 Bacteria 4997
74 Ga0070696_100090719 3300005546 Unclassified 2175
75 Ga0070696_100307594 3300005546 Bacteria 1216
76 Ga0070696_100427994 3300005546 Bacteria 1040
77 Ga0070665_100001131 3300005548 Bacteria 32798
78 Ga0070704_100060882 3300005549 Bacteria 2699
79 Ga0070704_100209124 3300005549 Unclassified 1580
80 Ga0070704_100752935 3300005549 Unclassified 867
81 Ga0070664_100535320 3300005564 Unclassified 1082
82 Ga0070702_100016897 3300005615 Bacteria 3755
83 Ga0068859_100339570 3300005617 Unclassified 1596
84 Ga0068864_100098395 3300005618 Unclassified 2591
85 Ga0068864_100967094 3300005618 Unclassified 843
86 Ga0068864_102111953 3300005618 Bacteria 570
87 Ga0068866_10229984 3300005718 Unclassified 1124
88 Ga0068861_100009058 3300005719 Bacteria 6860
89 Ga0068861_100064348 3300005719 Bacteria 2821
90 Ga0068861_100401587 3300005719 Bacteria 1216
91 Ga0068861_100587844 3300005719 Bacteria 1020
92 Ga0068863_100025549 3300005841 Bacteria 5631
93 Ga0068863_100445348 3300005841 Unclassified 1271
94 Ga0068858_100003685 3300005842 Bacteria 15179
95 Ga0068858_100563957 3300005842 Bacteria 1103
96 Ga0068860_100161487 3300005843 Unclassified 2161
97 Ga0068860_100666948 3300005843 Unclassified 1048
98 Ga0068862_100019097 3300005844 Bacteria 5714
99 Ga0068862_100061151 3300005844 Bacteria 3237
100 Ga0068862_100083155 3300005844 Bacteria 2780
101 Ga0068862_100116104 3300005844 Bacteria 2354
102 Ga0068862_100347460 3300005844 Bacteria 1375
103 Ga0081455_10187076 3300005937 Bacteria 1563
104 Ga0070716_100122731 3300006173 Bacteria 1629
105 Ga0097621_100392193 3300006237 Bacteria 1242
106 Ga0097621_101326121 3300006237 Bacteria 680
107 Ga0068871_100276903 3300006358 Unclassified 1467
108 Ga0075428_100082517 3300006844 Bacteria 3507
109 Ga0075430_101200556 3300006846 Unclassified 624
110 Ga0075433_10090798 3300006852 Unclassified 2700
111 Ga0075433_10247378 3300006852 Unclassified 1582
112 Ga0075433_11180364 3300006852 Unclassified 665
113 Ga0075434_100009905 3300006871 Bacteria 8915
114 Ga0075434_100043903 3300006871 Bacteria 4434
115 Ga0075434_100044262 3300006871 Bacteria 4416
116 Ga0075434_100128263 3300006871 Unclassified 2554
117 Ga0075434_100449440 3300006871 Bacteria 1310
118 Ga0075434_100500733 3300006871 Unclassified 1236
119 Ga0075434_100995706 3300006871 Bacteria 852
120 Ga0075434_101173455 3300006871 Unclassified 780
121 Ga0075429_100092122 3300006880 Bacteria 2644
122 Ga0075429_100102705 3300006880 Bacteria 2496
123 Ga0068865_100518093 3300006881 Bacteria 997
124 Ga0068865_100908996 3300006881 Bacteria 766
125 Ga0068865_101488593 3300006881 Bacteria 606
126 Ga0075436_100030450 3300006914 Bacteria 3715
127 Ga0075436_100039046 3300006914 Bacteria 3275
128 Ga0075436_100086156 3300006914 Bacteria 2181
129 Ga0075436_100203214 3300006914 Bacteria 1403
130 Ga0075436_100385017 3300006914 Bacteria 1014
131 Ga0097620_100339569 3300006931 Unclassified 1596
132 Ga0075435_100000436 3300007076 Bacteria 25536
133 Ga0075435_100000440 3300007076 Bacteria 25381
134 Ga0075435_100038987 3300007076 Bacteria 3791
135 Ga0075435_100226052 3300007076 Bacteria 1590
136 Ga0075435_101277820 3300007076 Bacteria 643
137 Ga0111539_10023759 3300009094 Bacteria 7531
138 Ga0111539_10030733 3300009094 Bacteria 6529
139 Ga0111539_10030835 3300009094 Bacteria 6518
140 Ga0111539_10267834 3300009094 Bacteria 1989
141 Ga0111539_10698106 3300009094 Bacteria 1181
142 Ga0111539_13314294 3300009094 Unclassified 518
143 Ga0105245_10207687 3300009098 Bacteria 1883
144 Ga0105245_10257435 3300009098 Unclassified 1697
145 Ga0105245_11946512 3300009098 Bacteria 641
146 Ga0105247_10168294 3300009101 Bacteria 1455
147 Ga0105247_10891491 3300009101 Bacteria 686
148 Ga0114129_10006369 3300009147 Bacteria 16735
149 Ga0114129_10048664 3300009147 Bacteria 5957
150 Ga0114129_10089231 3300009147 Bacteria 4274
151 Ga0114129_10115616 3300009147 Bacteria 3697
152 Ga0114129_10141455 3300009147 Bacteria 3298
153 Ga0114129_10145790 3300009147 Unclassified 3243
154 Ga0114129_10171200 3300009147 Bacteria 2961
155 Ga0114129_10266124 3300009147 Bacteria 2295
156 Ga0105243_10058421 3300009148 Bacteria 3074
157 Ga0105242_10012694 3300009176 Bacteria 6488
158 Ga0105242_10027503 3300009176 Unclassified 4517
159 Ga0105242_10233915 3300009176 Bacteria 1648
160 Ga0105242_10650534 3300009176 Unclassified 1025
161 Ga0105248_10021755 3300009177 Bacteria 7105
162 Ga0105248_10068266 3300009177 Bacteria 3992
163 Ga0105248_10120660 3300009177 Bacteria 2958
164 Ga0105248_10224135 3300009177 Unclassified 2116
165 Ga0105248_10627970 3300009177 Bacteria 1212
166 Ga0105248_10875032 3300009177 Unclassified 1014
167 Ga0105248_12602577 3300009177 Bacteria 577
168 Ga0105248_12867293 3300009177 Unclassified 550
169 Ga0105238_10636797 3300009551 Bacteria 1076
170 Ga0105249_10659770 3300009553 Bacteria 1104
171 Ga0105249_11011496 3300009553 Bacteria 900
172 Ga0105249_11042478 3300009553 Bacteria 887
173 Ga0105249_11842649 3300009553 Unclassified 678
174 Ga0105239_11162090 3300010375 Bacteria 889
175 Ga0105239_11975736 3300010375 Bacteria 677
176 Ga0105246_10262265 3300011119 Bacteria 1377
177 Ga0157374_10117633 3300013296 Bacteria 2562
178 Ga0163162_10129583 3300013306 Bacteria 2631
179 Ga0157372_10209169 3300013307 Bacteria 2261
180 Ga0157375_10195821 3300013308 Bacteria 2176
181 Ga0157375_10849278 3300013308 Unclassified 1060
182 Ga0157375_10855126 3300013308 Bacteria 1056
183 Ga0157375_10942874 3300013308 Bacteria 1005
184 Ga0163163_10180527 3300014325 Bacteria 2158
185 Ga0163163_10510638 3300014325 Bacteria 1264
186 Ga0157380_10198337 3300014326 Unclassified 1778
187 Ga0157380_10393541 3300014326 Unclassified 1312
188 Ga0157380_11418008 3300014326 Unclassified 745
189 Ga0157379_10177655 3300014968 Bacteria 1923
190 Ga0157379_10206161 3300014968 Unclassified 1778
191 Ga0163161_10218442 3300017792 Unclassified 1475
192 Ga0207697_10182370 3300025315 Bacteria 920
193 Ga0207710_10490755 3300025900 Bacteria 637
194 Ga0207688_10144236 3300025901 Bacteria 1403
195 Ga0207680_10097209 3300025903 Bacteria 1885
196 Ga0207680_10160248 3300025903 Bacteria 1508
197 Ga0207699_10287521 3300025906 Unclassified 1144
198 Ga0207645_10012162 3300025907 Bacteria 5846
199 Ga0207684_10239182 3300025910 Bacteria 1566
200 Ga0207707_10109274 3300025912 Bacteria 2417
201 Ga0207707_10132058 3300025912 Bacteria 2184
202 Ga0207707_10164538 3300025912 Bacteria 1939
203 Ga0207707_11060457 3300025912 Bacteria 662
204 Ga0207695_10190954 3300025913 Unclassified 1966
205 Ga0207671_10551442 3300025914 Unclassified 919
206 Ga0207663_10872588 3300025916 Bacteria 719
207 Ga0207660_10261406 3300025917 Bacteria 1369
208 Ga0207662_10358697 3300025918 Bacteria 980
209 Ga0207662_10644724 3300025918 Bacteria 739
210 Ga0207657_10097462 3300025919 Bacteria 2445
211 Ga0207657_10346438 3300025919 Bacteria 1172
212 Ga0207652_10015932 3300025921 Bacteria 6126
213 Ga0207652_10172336 3300025921 Bacteria 1942
214 Ga0207646_10696859 3300025922 Bacteria 908
215 Ga0207681_10019324 3300025923 Bacteria 4304
216 Ga0207681_10151012 3300025923 Bacteria 1741
217 Ga0207659_10074519 3300025926 Bacteria 2488
218 Ga0207659_11122695 3300025926 Bacteria 676
219 Ga0207687_10165070 3300025927 Bacteria 1703
220 Ga0207687_10566060 3300025927 Unclassified 955
221 Ga0207664_10053947 3300025929 Bacteria 3184
222 Ga0207644_10026724 3300025931 Bacteria 3981
223 Ga0207690_10301539 3300025932 Bacteria 1254
224 Ga0207706_10165962 3300025933 Bacteria 1940
225 Ga0207706_10241558 3300025933 Bacteria 1579
226 Ga0207709_10239205 3300025935 Bacteria 1320
227 Ga0207670_10352098 3300025936 Bacteria 1166
228 Ga0207669_11463334 3300025937 Unclassified 582
229 Ga0207704_10166198 3300025938 Bacteria 1576
230 Ga0207704_10668613 3300025938 Bacteria 857
231 Ga0207665_10075399 3300025939 Unclassified 2310
232 Ga0207691_10052636 3300025940 Bacteria 3719
233 Ga0207711_10039565 3300025941 Bacteria 4011
234 Ga0207711_10359660 3300025941 Bacteria 1348
235 Ga0207711_11355865 3300025941 Unclassified 654
236 Ga0207679_10409945 3300025945 Unclassified 1194
237 Ga0207651_10029450 3300025960 Bacteria 3479
238 Ga0207658_10513884 3300025986 Unclassified 1068
239 Ga0207677_10441152 3300026023 Unclassified 1113
240 Ga0207677_10551485 3300026023 Bacteria 1005
241 Ga0207703_10080443 3300026035 Unclassified 2713
242 Ga0207703_10214831 3300026035 Bacteria 1717
243 Ga0207703_10432459 3300026035 Bacteria 1226
244 Ga0207708_10016814 3300026075 Bacteria 5508
245 Ga0207708_10021028 3300026075 Bacteria 4923
246 Ga0207708_10317740 3300026075 Unclassified 1270
247 Ga0207641_10006764 3300026088 Bacteria 9607
248 Ga0207641_10484921 3300026088 Unclassified 1199
249 Ga0207641_10977061 3300026088 Unclassified 843
250 Ga0207648_10112876 3300026089 Bacteria 2386
251 Ga0207676_10100918 3300026095 Unclassified 2392
252 Ga0207675_100016548 3300026118 Bacteria 6887
253 Ga0207675_100053332 3300026118 Bacteria 3773
254 Ga0207675_100057225 3300026118 Bacteria 3637
255 Ga0207675_100197846 3300026118 Unclassified 1929
256 Ga0207675_100394631 3300026118 Bacteria 1363
257 Ga0207683_10751103 3300026121 Bacteria 905
258 Ga0209966_1027119 3300027695 Bacteria 1144
259 Ga0207428_10035731 3300027907 Bacteria 4059
260 Ga0207428_10074316 3300027907 Bacteria 2665
261 Ga0207428_10733769 3300027907 Bacteria 705
262 Ga0268266_10080931 3300028379 Bacteria 2830
263 Ga0268266_10751492 3300028379 Unclassified 941
264 Ga0268265_10005294 3300028380 Bacteria 8837
265 Ga0268265_10033173 3300028380 Bacteria 3751
266 Ga0268265_10144296 3300028380 Bacteria 1997
267 Ga0268265_10391875 3300028380 Bacteria 1281
268 Ga0268264_10117467 3300028381 Unclassified 2339
269 Ga0268264_11314660 3300028381 Bacteria 733
270 Ga0307513_10596630 3300031456 Bacteria 814
271 Ga0307408_101267400 3300031548 Bacteria 690
272 Ga0307412_10322838 3300031911 Bacteria 1229
273 Ga0307414_11052932 3300032004 Unclassified 750
274 Ga0373945_0299286 3300035116 Bacteria 689
275 Ga0373943_0070828 3300035170 Bacteria 1765
276 Ga0373955_0503758 3300035172 Bacteria 739
277 Ga0373962_0064824 3300035242 Unclassified 1080
278 Ga0373935_0608232 3300035692 Bacteria 800
279 Ga0373947_0204284 3300035725 Bacteria 1294
280 Ga0373937_0236166 3300036401 Bacteria 1722
281 Ga0373937_0360696 3300036401 Bacteria 1377
282 Ga0373925_0081780 3300037068 Unclassified 2457
283 Ga0466963_0092289 3300044694 Bacteria 2063
284 Ga0466960_0755360 3300044901 Bacteria 586
285 Ga0495629_0932803 3300046459 Bacteria 568
286 Ga0495651_0365552 3300046462 Unclassified 950
287 Ga0495628_0339876 3300046516 Bacteria 1105
288 Ga0495628_0638937 3300046516 Unclassified 757
289 Ga0495645_0806492 3300046543 Unclassified 563
290 Ga0495635_0617510 3300046663 Bacteria 707
291 Ga0495659_0357378 3300046664 Unclassified 625
292 Ga0495623_0435891 3300046679 Bacteria 700
293 Ga0495658_0066712 3300046683 Bacteria 2079
294 Ga0495658_0349941 3300046683 Unclassified 939
295 Ga0495604_0225183 3300047317 Bacteria 1289
296 Ga0496102_0786445 3300048905 Bacteria 874
297 Ga0496104_0157802 3300048907 Bacteria 2177
298 Ga0496104_0962286 3300048907 Unclassified 758
299 Ga0496105_0176715 3300048908 Bacteria 1749
300 Ga0496105_0282788 3300048908 Unclassified 1337
301 Ga0496106_0870041 3300048909 Unclassified 713
302 Ga0496108_0539193 3300048911 Bacteria 1018
303 Ga0496109_0259793 3300048912 Unclassified 1636
304 Ga0496109_0941055 3300048912 Unclassified 802
305 Ga0496110_0415577 3300048913 Bacteria 1226
306 Ga0496111_0092673 3300048914 Unclassified 2215
307 Ga0496112_0062135 3300048915 Bacteria 3684
308 Ga0496112_0239386 3300048915 Bacteria 1768
309 Ga0496114_0268100 3300048917 Bacteria 1504
310 Ga0496114_0278317 3300048917 Bacteria 1475
311 Ga0496115_0211672 3300048918 Unclassified 1601
312 Ga0501067_0509821 3300049583 Unclassified 673
313 Ga0501067_0740024 3300049583 Bacteria 553
314 Ga0501069_0131534 3300049585 Bacteria 1433
315 Ga0501072_0295664 3300049588 Bacteria 1287
316 Ga0501073_0154028 3300049589 Bacteria 1593
317 Ga0501075_0370814 3300049591 Unclassified 1091
318 Ga0501075_0526576 3300049591 Unclassified 902
319 Ga0501077_0367097 3300049593 Bacteria 919
320 Ga0501081_0783617 3300049743 Unclassified 717
321 nmdc:mga05p37_127267_c1 3300050507 Bacteria 3127
322 nmdc:mga05p37_1394695_c1 3300050507 Bacteria 706
323 nmdc:mga05p37_14683_c1 3300050507 Bacteria 9408
324 nmdc:mga05p37_186424_c1 3300050507 Unclassified 2522
325 nmdc:mga05p37_202326_c1 3300050507 Bacteria 2404
326 nmdc:mga05p37_3286_c1 3300050507 Bacteria 18850
327 nmdc:mga05p37_35525_c1 3300050507 Bacteria 6111
328 nmdc:mga05p37_42790_c1 3300050507 Bacteria 5567
329 nmdc:mga09592_264114_c1 3300050508 Unclassified 1493
330 nmdc:mga09592_483428_c1 3300050508 Unclassified 1067
331 nmdc:mga08y16_17306_c2 3300050511 Bacteria 7085
332 nmdc:mga08y16_24980_c1 3300050511 Bacteria 6303
333 nmdc:mga08y16_63804_c1 3300050511 Bacteria 3848
334 nmdc:mga08y16_69304_c1 3300050511 Bacteria 3677
335 nmdc:mga08y16_7313_c1 3300050511 Bacteria 11586
336 nmdc:mga08y16_89892_c1 3300050511 Unclassified 3200
337 nmdc:mga0n895_294457_c1 3300050512 Unclassified 1645
338 nmdc:mga0n895_30452_c1 3300050512 Bacteria 5158
339 nmdc:mga0n895_3406_c1 3300050512 Bacteria 12809
340 nmdc:mga0n895_34533_c1 3300050512 Bacteria 4869
341 nmdc:mga0n895_57_c1 3300050512 Bacteria 65730
342 nmdc:mga0n895_874766_c1 3300050512 Unclassified 885
343 nmdc:mga0rr50_1015873_c1 3300050513 Bacteria 706
344 nmdc:mga0rr50_111849_c1 3300050513 Bacteria 1371
345 nmdc:mga0rr50_142648_c1 3300050513 Bacteria 1928
346 nmdc:mga0rr50_237261_c1 3300050513 Unclassified 1511
347 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
348 nmdc:mga0rr50_63438_c1 3300050513 Bacteria 2791
349 nmdc:mga0rr50_87466_c1 3300050513 Bacteria 2419
350 nmdc:mga08x19_1491_c1 3300050514 Bacteria 14495
351 nmdc:mga08x19_289342_c1 3300050514 Bacteria 1136
352 nmdc:mga08x19_66484_c1 3300050514 Bacteria 2343
353 nmdc:mga08x19_82294_c1 3300050514 Unclassified 2115
354 nmdc:mga0a205_188765_c1 3300050515 Bacteria 1953
355 nmdc:mga0a205_203126_c1 3300050515 Unclassified 1872
356 nmdc:mga0a205_407310_c1 3300050515 Bacteria 1223
357 nmdc:mga0a205_492390_c1 3300050515 Bacteria 1083
358 Ga0495601_0073837 3300053077 Bacteria 2182
359 Ga0495601_0120390 3300053077 Bacteria 1704
360 Ga0495601_0170486 3300053077 Bacteria 1423
361 Ga0495612_0496523 3300053078 Unclassified 560
362 Ga0495619_0070041 3300053085 Bacteria 2345
363 Ga0495619_0224402 3300053085 Bacteria 1301
364 Ga0500651_0192490 3300053093 Bacteria 1207
365 Ga0590074_000190 3300059423 Bacteria 7783
366 Ga0590075_000704 3300059424 Bacteria 8857
367 Ga0590075_010258 3300059424 Bacteria 2253
368 Ga0590077_000059 3300059426 Bacteria 26998
369 Ga0530510_0434973 3300061734 Bacteria 991
370 Ga0268264_11424565
371 Ga0065707_10882284
372 Ga0070676_10003087
373 Ga0070676_10167891
374 Ga0070690_100501427
375 Ga0070690_100745258
376 Ga0070690_101033290
377 Ga0070670_100586700
378 Ga0070670_100789245
379 Ga0068869_101504320
380 Ga0070666_10125239
381 Ga0070680_100295851
382 Ga0068868_100336366
383 Ga0070660_100043219
384 Ga0070689_100031384
385 Ga0070689_101449843
386 Ga0070691_10459829
387 Ga0070691_10569193
388 Ga0070687_100024078
389 Ga0070687_100196494
390 Ga0070661_100077154
391 Ga0070668_100098426
392 Ga0070669_100037201
393 Ga0070669_100155373
394 Ga0070669_100284885
395 Ga0070669_100843503
396 Ga0070675_100033959
397 Ga0070671_100014004
398 Ga0070673_100094407
399 Ga0070673_100440420
400 Ga0070688_100015865
401 Ga0070659_100156376
402 Ga0070667_100434641
403 Ga0070709_10404280
404 Ga0070701_10061352
405 Ga0070701_10544703
406 Ga0070705_100004748
407 Ga0070705_100018087
408 Ga0070705_100105368
409 Ga0070705_101202473
410 Ga0070700_100016529
411 Ga0070694_100146379
412 Ga0070694_100198015
413 Ga0070678_100490754
414 Ga0070662_100096055
415 Ga0070662_100291717
416 Ga0070681_10032790
417 Ga0070681_10173499
418 Ga0068867_100131461
419 Ga0068867_101005868
420 Ga0068867_101093731
421 Ga0070706_100212819
422 Ga0070707_101047852
423 Ga0070698_100188584
424 Ga0070698_100218368
425 Ga0070698_100241857
426 Ga0070698_100908831
427 Ga0070699_100013590
428 Ga0070699_100031913
429 Ga0070699_101725234
430 Ga0070679_100053680
431 Ga0070679_100508046
432 Ga0070697_100202271
433 Ga0070697_101677280
434 Ga0070672_100009885
435 Ga0070672_100155968
436 Ga0070686_100024935
437 Ga0070686_100154282
438 Ga0070686_100188646
439 Ga0070686_100339871
440 Ga0070695_100337597
441 Ga0070695_100652950
442 Ga0070696_100016329
443 Ga0070696_100090719
444 Ga0070696_100307594
445 Ga0070696_100427994
446 Ga0070665_100001131
447 Ga0070704_100060882
448 Ga0070704_100209124
449 Ga0070704_100752935
450 Ga0070664_100535320
451 Ga0070702_100016897
452 Ga0068859_100339570
453 Ga0068864_100098395
454 Ga0068864_100967094
455 Ga0068864_102111953
456 Ga0068866_10229984
457 Ga0068861_100009058
458 Ga0068861_100064348
459 Ga0068861_100401587
460 Ga0068861_100587844
461 Ga0068863_100025549
462 Ga0068863_100445348
463 Ga0068858_100003685
464 Ga0068858_100563957
465 Ga0068860_100161487
466 Ga0068860_100666948
467 Ga0068862_100019097
468 Ga0068862_100061151
469 Ga0068862_100083155
470 Ga0068862_100116104
471 Ga0068862_100347460
472 Ga0081455_10187076
473 Ga0070716_100122731
474 Ga0097621_100392193
475 Ga0097621_101326121
476 Ga0068871_100276903
477 Ga0075428_100082517
478 Ga0075430_101200556
479 Ga0075433_10090798
480 Ga0075433_10247378
481 Ga0075433_11180364
482 Ga0075434_100009905
483 Ga0075434_100043903
484 Ga0075434_100044262
485 Ga0075434_100128263
486 Ga0075434_100449440
487 Ga0075434_100500733
488 Ga0075434_100995706
489 Ga0075434_101173455
490 Ga0075429_100092122
491 Ga0075429_100102705
492 Ga0068865_100518093
493 Ga0068865_100908996
494 Ga0068865_101488593
495 Ga0075436_100030450
496 Ga0075436_100039046
497 Ga0075436_100086156
498 Ga0075436_100203214
499 Ga0075436_100385017
500 Ga0097620_100339569
501 Ga0075435_100000436
502 Ga0075435_100000440
503 Ga0075435_100038987
504 Ga0075435_100226052
505 Ga0075435_101277820
506 Ga0111539_10023759
507 Ga0111539_10030733
508 Ga0111539_10030835
509 Ga0111539_10267834
510 Ga0111539_10698106
511 Ga0111539_13314294
512 Ga0105245_10207687
513 Ga0105245_10257435
514 Ga0105245_11946512
515 Ga0105247_10168294
516 Ga0105247_10891491
517 Ga0114129_10006369
518 Ga0114129_10048664
519 Ga0114129_10089231
520 Ga0114129_10115616
521 Ga0114129_10141455
522 Ga0114129_10145790
523 Ga0114129_10171200
524 Ga0114129_10266124
525 Ga0105243_10058421
526 Ga0105242_10012694
527 Ga0105242_10027503
528 Ga0105242_10233915
529 Ga0105242_10650534
530 Ga0105248_10021755
531 Ga0105248_10068266
532 Ga0105248_10120660
533 Ga0105248_10224135
534 Ga0105248_10627970
535 Ga0105248_10875032
536 Ga0105248_12602577
537 Ga0105248_12867293
538 Ga0105238_10636797
539 Ga0105249_10659770
540 Ga0105249_11011496
541 Ga0105249_11042478
542 Ga0105249_11842649
543 Ga0105239_11162090
544 Ga0105239_11975736
545 Ga0105246_10262265
546 Ga0157374_10117633
547 Ga0163162_10129583
548 Ga0157372_10209169
549 Ga0157375_10195821
550 Ga0157375_10849278
551 Ga0157375_10855126
552 Ga0157375_10942874
553 Ga0163163_10180527
554 Ga0163163_10510638
555 Ga0157380_10198337
556 Ga0157380_10393541
557 Ga0157380_11418008
558 Ga0157379_10177655
559 Ga0157379_10206161
560 Ga0163161_10218442
561 Ga0207697_10182370
562 Ga0207710_10490755
563 Ga0207688_10144236
564 Ga0207680_10097209
565 Ga0207680_10160248
566 Ga0207699_10287521
567 Ga0207645_10012162
568 Ga0207684_10239182
569 Ga0207707_10109274
570 Ga0207707_10132058
571 Ga0207707_10164538
572 Ga0207707_11060457
573 Ga0207695_10190954
574 Ga0207671_10551442
575 Ga0207663_10872588
576 Ga0207660_10261406
577 Ga0207662_10358697
578 Ga0207662_10644724
579 Ga0207657_10097462
580 Ga0207657_10346438
581 Ga0207652_10015932
582 Ga0207652_10172336
583 Ga0207646_10696859
584 Ga0207681_10019324
585 Ga0207681_10151012
586 Ga0207659_10074519
587 Ga0207659_11122695
588 Ga0207687_10165070
589 Ga0207687_10566060
590 Ga0207664_10053947
591 Ga0207644_10026724
592 Ga0207690_10301539
593 Ga0207706_10165962
594 Ga0207706_10241558
595 Ga0207709_10239205
596 Ga0207670_10352098
597 Ga0207669_11463334
598 Ga0207704_10166198
599 Ga0207704_10668613
600 Ga0207665_10075399
601 Ga0207691_10052636
602 Ga0207711_10039565
603 Ga0207711_10359660
604 Ga0207711_11355865
605 Ga0207679_10409945
606 Ga0207651_10029450
607 Ga0207658_10513884
608 Ga0207677_10441152
609 Ga0207677_10551485
610 Ga0207703_10080443
611 Ga0207703_10214831
612 Ga0207703_10432459
613 Ga0207708_10016814
614 Ga0207708_10021028
615 Ga0207708_10317740
616 Ga0207641_10006764
617 Ga0207641_10484921
618 Ga0207641_10977061
619 Ga0207648_10112876
620 Ga0207676_10100918
621 Ga0207675_100016548
622 Ga0207675_100053332
623 Ga0207675_100057225
624 Ga0207675_100197846
625 Ga0207675_100394631
626 Ga0207683_10751103
627 Ga0209966_1027119
628 Ga0207428_10035731
629 Ga0207428_10074316
630 Ga0207428_10733769
631 Ga0268266_10080931
632 Ga0268266_10751492
633 Ga0268265_10005294
634 Ga0268265_10033173
635 Ga0268265_10144296
636 Ga0268265_10391875
637 Ga0268264_10117467
638 Ga0268264_11314660
639 Ga0307513_10596630
640 Ga0307408_101267400
641 Ga0307412_10322838
642 Ga0307414_11052932
643 Ga0373945_0299286
644 Ga0373943_0070828
645 Ga0373955_0503758
646 Ga0373962_0064824
647 Ga0373935_0608232
648 Ga0373947_0204284
649 Ga0373937_0236166
650 Ga0373937_0360696
651 Ga0373925_0081780
652 Ga0466963_0092289
653 Ga0466960_0755360
654 Ga0495629_0932803
655 Ga0495651_0365552
656 Ga0495628_0339876
657 Ga0495628_0638937
658 Ga0495645_0806492
659 Ga0495635_0617510
660 Ga0495659_0357378
661 Ga0495623_0435891
662 Ga0495658_0066712
663 Ga0495658_0349941
664 Ga0495604_0225183
665 Ga0496102_0786445
666 Ga0496104_0157802
667 Ga0496104_0962286
668 Ga0496105_0176715
669 Ga0496105_0282788
670 Ga0496106_0870041
671 Ga0496108_0539193
672 Ga0496109_0259793
673 Ga0496109_0941055
674 Ga0496110_0415577
675 Ga0496111_0092673
676 Ga0496112_0062135
677 Ga0496112_0239386
678 Ga0496114_0268100
679 Ga0496114_0278317
680 Ga0496115_0211672
681 Ga0501067_0509821
682 Ga0501067_0740024
683 Ga0501069_0131534
684 Ga0501072_0295664
685 Ga0501073_0154028
686 Ga0501075_0370814
687 Ga0501075_0526576
688 Ga0501077_0367097
689 Ga0501081_0783617
690 nmdc:mga05p37_127267_c1
691 nmdc:mga05p37_1394695_c1
692 nmdc:mga05p37_14683_c1
693 nmdc:mga05p37_186424_c1
694 nmdc:mga05p37_202326_c1
695 nmdc:mga05p37_3286_c1
696 nmdc:mga05p37_35525_c1
697 nmdc:mga05p37_42790_c1
698 nmdc:mga09592_264114_c1
699 nmdc:mga09592_483428_c1
700 nmdc:mga08y16_17306_c2
701 nmdc:mga08y16_24980_c1
702 nmdc:mga08y16_63804_c1
703 nmdc:mga08y16_69304_c1
704 nmdc:mga08y16_7313_c1
705 nmdc:mga08y16_89892_c1
706 nmdc:mga0n895_294457_c1
707 nmdc:mga0n895_30452_c1
708 nmdc:mga0n895_3406_c1
709 nmdc:mga0n895_34533_c1
710 nmdc:mga0n895_57_c1
711 nmdc:mga0n895_874766_c1
712 nmdc:mga0rr50_1015873_c1
713 nmdc:mga0rr50_111849_c1
714 nmdc:mga0rr50_142648_c1
715 nmdc:mga0rr50_237261_c1
716 nmdc:mga0rr50_5_c1
717 nmdc:mga0rr50_63438_c1
718 nmdc:mga0rr50_87466_c1
719 nmdc:mga08x19_1491_c1
720 nmdc:mga08x19_289342_c1
721 nmdc:mga08x19_66484_c1
722 nmdc:mga08x19_82294_c1
723 nmdc:mga0a205_188765_c1
724 nmdc:mga0a205_203126_c1
725 nmdc:mga0a205_407310_c1
726 nmdc:mga0a205_492390_c1
727 Ga0495601_0073837
728 Ga0495601_0120390
729 Ga0495601_0170486
730 Ga0495612_0496523
731 Ga0495619_0070041
732 Ga0495619_0224402
733 Ga0500651_0192490
734 Ga0590074_000190
735 Ga0590075_000704
736 Ga0590075_010258
737 Ga0590077_000059
738 Ga0530510_0434973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rww-assembly1.cif.gz_B crystal structure of l. monocytogenes psta in complex with cyclic-di-amp 0.7581 9 138
4rwx-assembly1.cif.gz_C crystal structure of l. monocytogenes psta 0.6937 9 139
3ncp-assembly3.cif.gz_C glnk2 from archaeoglobus fulgidus 0.634 8 146
2j9d-assembly4.cif.gz_K structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.6203 7 146
3mhy-assembly1.cif.gz_A a new pii protein structure 0.6154 8 146
ID Description Score Start End Superfamily
af_P9WIJ1_24_224_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6256 17 46 2.30.110.10
af_Q54E04_31_806_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.5567 9 151 1.20.58.390
af_A4I0M2_138_767_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.5367 2 151 1.20.58.390
5ypwH00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5236 7 136 3.30.70.260
af_A0A0B4LF84_83_159_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.5106 18 75 3.30.1370.50
ID Description Score Start End GO Terms
AF-A0A381WH95-F1-model_v4 Uncharacterized protein 0.9583 12 76
AF-A0A2E4W9K0-F1-model_v4 ACT domain-containing protein 0.9121 2 152
AF-A0A2E6ZWN8-F1-model_v4 Uncharacterized protein 0.904 1 152
AF-A0A2E4W9K0-F1-model_v4 ACT domain-containing protein 0.9007 2 152
AF-A0A381RHZ0-F1-model_v4 ACT domain-containing protein 0.8879 24 152

Map