F425015

General Info

Members Datasets Scaffolds Average Seq Length
369 210 366 227

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10366069|Ga0114129_103660692
Length 256
Sequence LVIAGSAPAIHYGAVFRPCCHRSSEIIATMSKLSIIMPVLDEGDAIAAALDALADLRALGTEVIVVDGGSRDATVQGARLRADRVISTPRGRALQMNAGAATAAGNVLLFLHADTRLPPDADHIVLRGLDRSGRAWGRFDVKIDGRNPLLAVVAVLMNIRSRLTGIATGDQAIFVRRDAFHAAGAFAAIPLMEDVALCKRLKRMSRPLCLHERAVTSGRRWETNGVVRTVLLMWRLRLAYFLGADPQALARQYGYE

Samples

Sample ID Description Type Environment
1 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
2 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
3 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
128 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
129 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
145 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
146 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0.81
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0.54
Rhizoplane 0.54
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10007520 3300003911 Bacteria 2011
2 Ga0070658_10063817 3300005327 Bacteria 3004
3 Ga0070658_10202619 3300005327 Bacteria 1675
4 Ga0070683_100021378 3300005329 Bacteria 5776
5 Ga0070683_100090504 3300005329 Bacteria 2873
6 Ga0070683_100356928 3300005329 Bacteria 1392
7 Ga0070670_100064464 3300005331 Bacteria 3143
8 Ga0070680_100393264 3300005336 Bacteria 1181
9 Ga0070660_100034522 3300005339 Bacteria 3822
10 Ga0070660_100177668 3300005339 Bacteria 1722
11 Ga0070689_100841534 3300005340 Bacteria 809
12 Ga0070687_100154083 3300005343 Bacteria 1352
13 Ga0070661_100262242 3300005344 Bacteria 1336
14 Ga0070675_100379154 3300005354 Bacteria 1258
15 Ga0070671_100178733 3300005355 Bacteria 1796
16 Ga0070671_100429321 3300005355 Bacteria 1132
17 Ga0070674_100098109 3300005356 Bacteria 2129
18 Ga0070674_100130949 3300005356 Bacteria 1870
19 Ga0070659_100145027 3300005366 Bacteria 1934
20 Ga0070659_100262575 3300005366 Bacteria 1433
21 Ga0070659_100412824 3300005366 Bacteria 1141
22 Ga0070714_100019705 3300005435 Bacteria 5500
23 Ga0070714_100024794 3300005435 Bacteria 4942
24 Ga0070714_100068448 3300005435 Bacteria 3063
25 Ga0070714_100075474 3300005435 Bacteria 2925
26 Ga0070713_100003525 3300005436 Bacteria 10340
27 Ga0070713_100350268 3300005436 Bacteria 1370
28 Ga0070663_100155455 3300005455 Bacteria 1757
29 Ga0070662_100358374 3300005457 Bacteria 1196
30 Ga0070681_10268599 3300005458 Bacteria 1617
31 Ga0070681_10478189 3300005458 Bacteria 1158
32 Ga0070681_10554399 3300005458 Bacteria 1063
33 Ga0070681_10622892 3300005458 Bacteria 994
34 Ga0070685_10249198 3300005466 Bacteria 1176
35 Ga0070699_100452604 3300005518 Bacteria 1164
36 Ga0070679_100232279 3300005530 Bacteria 1804
37 Ga0070679_100279043 3300005530 Bacteria 1624
38 Ga0070679_100815204 3300005530 Unclassified 876
39 Ga0070697_100004435 3300005536 Bacteria 10779
40 Ga0070686_100490149 3300005544 Bacteria 952
41 Ga0070695_100108766 3300005545 Bacteria 1878
42 Ga0070696_100008106 3300005546 Bacteria 7023
43 Ga0070693_100242568 3300005547 Bacteria 1191
44 Ga0068855_100010956 3300005563 Bacteria 10939
45 Ga0068855_100046787 3300005563 Bacteria 5113
46 Ga0068855_100073129 3300005563 Bacteria 3983
47 Ga0068855_100163660 3300005563 Bacteria 2523
48 Ga0068854_100133983 3300005578 Bacteria 1895
49 Ga0068854_100145170 3300005578 Bacteria 1825
50 Ga0068856_100149649 3300005614 Bacteria 2343
51 Ga0068856_100362229 3300005614 Bacteria 1468
52 Ga0068852_100012983 3300005616 Bacteria 6357
53 Ga0068852_100131557 3300005616 Bacteria 2305
54 Ga0068859_100076247 3300005617 Bacteria 3393
55 Ga0068863_100304413 3300005841 Bacteria 1546
56 Ga0068862_100326953 3300005844 Bacteria 1417
57 Ga0081455_10001479 3300005937 Bacteria 29079
58 Ga0081455_10004490 3300005937 Bacteria 15610
59 Ga0081455_10009018 3300005937 Bacteria 10296
60 Ga0081455_10018296 3300005937 Bacteria 6680
61 Ga0081540_1004153 3300005983 Bacteria 11164
62 Ga0081540_1018108 3300005983 Bacteria 4335
63 Ga0070717_10010435 3300006028 Bacteria 7015
64 Ga0075365_10022333 3300006038 Bacteria 3964
65 Ga0075363_100023185 3300006048 Bacteria 3143
66 Ga0075364_10016544 3300006051 Bacteria 4590
67 Ga0075432_10000272 3300006058 Bacteria 14285
68 Ga0075432_10010366 3300006058 Bacteria 3161
69 Ga0070715_10006599 3300006163 Bacteria 3954
70 Ga0070715_10082067 3300006163 Bacteria 1466
71 Ga0070716_100036436 3300006173 Bacteria 2712
72 Ga0070716_100078407 3300006173 Bacteria 1964
73 Ga0075362_10064685 3300006177 Bacteria 1660
74 Ga0075427_10001521 3300006194 Bacteria 2988
75 Ga0075366_10001869 3300006195 Bacteria 10616
76 Ga0075366_10077152 3300006195 Bacteria 1988
77 Ga0097621_100001554 3300006237 Bacteria 15677
78 Ga0075428_100001689 3300006844 Bacteria 23548
79 Ga0075428_100003180 3300006844 Bacteria 17952
80 Ga0075428_100014282 3300006844 Bacteria 8831
81 Ga0075428_100111419 3300006844 Bacteria 2981
82 Ga0075428_100131922 3300006844 Bacteria 2717
83 Ga0075428_100142639 3300006844 Bacteria 2604
84 Ga0075428_100468270 3300006844 Bacteria 1349
85 Ga0075430_100000201 3300006846 Bacteria 40551
86 Ga0075430_100005251 3300006846 Bacteria 10922
87 Ga0075430_100028930 3300006846 Bacteria 4704
88 Ga0075430_100034877 3300006846 Bacteria 4271
89 Ga0075430_100139021 3300006846 Bacteria 2023
90 Ga0075431_100000260 3300006847 Bacteria 40551
91 Ga0075431_100001296 3300006847 Bacteria 22847
92 Ga0075431_100008882 3300006847 Bacteria 10068
93 Ga0075431_100175918 3300006847 Bacteria 2198
94 Ga0075431_100318117 3300006847 Unclassified 1570
95 Ga0075433_10000007 3300006852 Bacteria 75995
96 Ga0075434_100000091 3300006871 Bacteria 49489
97 Ga0075434_100055217 3300006871 Bacteria 3947
98 Ga0075434_100074129 3300006871 Bacteria 3397
99 Ga0075429_100001824 3300006880 Bacteria 17627
100 Ga0075429_100002571 3300006880 Bacteria 15296
101 Ga0075429_100028413 3300006880 Bacteria 4857
102 Ga0075429_100317176 3300006880 Bacteria 1364
103 Ga0075429_100406724 3300006880 Bacteria 1192
104 Ga0075436_100231730 3300006914 Bacteria 1312
105 Ga0075436_100260898 3300006914 Bacteria 1236
106 Ga0097620_100076246 3300006931 Bacteria 3393
107 Ga0075435_100001332 3300007076 Bacteria 15855
108 Ga0075435_100005192 3300007076 Bacteria 9060
109 Ga0075435_100017727 3300007076 Bacteria 5396
110 Ga0099794_10044525 3300007265 Bacteria 2121
111 Ga0105240_10044690 3300009093 Bacteria 5626
112 Ga0111539_10000486 3300009094 Bacteria 50337
113 Ga0111539_10001004 3300009094 Bacteria 36978
114 Ga0111539_10001672 3300009094 Bacteria 29559
115 Ga0105245_10159140 3300009098 Bacteria 2142
116 Ga0105247_10042781 3300009101 Bacteria 2774
117 Ga0114129_10000717 3300009147 Bacteria 41954
118 Ga0114129_10001111 3300009147 Bacteria 35464
119 Ga0114129_10069532 3300009147 Bacteria 4908
120 Ga0114129_10334730 3300009147 Bacteria 2009
121 Ga0114129_10366069 3300009147 Bacteria 1907
122 Ga0105243_10909585 3300009148 Bacteria 876
123 Ga0105243_11015718 3300009148 Bacteria 833
124 Ga0105248_10463414 3300009177 Bacteria 1428
125 Ga0105238_10046817 3300009551 Bacteria 4362
126 Ga0105238_10735895 3300009551 Bacteria 999
127 Ga0105249_10781802 3300009553 Bacteria 1018
128 Ga0105249_11082575 3300009553 Bacteria 871
129 Ga0157370_10535362 3300013104 Bacteria 1074
130 Ga0157369_10002433 3300013105 Bacteria 22368
131 Ga0157369_10203432 3300013105 Bacteria 2078
132 Ga0157369_10875838 3300013105 Bacteria 921
133 Ga0157372_10002758 3300013307 Bacteria 18990
134 Ga0163163_10107556 3300014325 Bacteria 2816
135 Ga0157376_10081875 3300014969 Bacteria 2772
136 Ga0206356_11554248 3300020070 Bacteria 1173
137 Ga0206354_10591667 3300020081 Bacteria 1033
138 Ga0207692_10010893 3300025898 Bacteria 3848
139 Ga0207710_10007458 3300025900 Bacteria 4632
140 Ga0207685_10000417 3300025905 Bacteria 7044
141 Ga0207685_10003592 3300025905 Bacteria 3795
142 Ga0207643_10210768 3300025908 Bacteria 1186
143 Ga0207705_10103593 3300025909 Bacteria 2096
144 Ga0207705_10147076 3300025909 Bacteria 1763
145 Ga0207707_10086394 3300025912 Bacteria 2741
146 Ga0207695_10042918 3300025913 Bacteria 4824
147 Ga0207660_10161748 3300025917 Bacteria 1728
148 Ga0207657_10092151 3300025919 Bacteria 2526
149 Ga0207657_10111337 3300025919 Bacteria 2260
150 Ga0207652_10269148 3300025921 Bacteria 1537
151 Ga0207652_10519601 3300025921 Unclassified 1071
152 Ga0207694_10125023 3300025924 Bacteria 2057
153 Ga0207650_10564491 3300025925 Bacteria 955
154 Ga0207700_10375357 3300025928 Unclassified 1242
155 Ga0207664_10038246 3300025929 Bacteria 3719
156 Ga0207644_10292608 3300025931 Bacteria 1310
157 Ga0207644_10388622 3300025931 Bacteria 1139
158 Ga0207690_10151019 3300025932 Bacteria 1722
159 Ga0207706_10380240 3300025933 Bacteria 1225
160 Ga0207686_10270110 3300025934 Bacteria 1251
161 Ga0207670_10652136 3300025936 Bacteria 868
162 Ga0207665_10000597 3300025939 Bacteria 24250
163 Ga0207689_10026667 3300025942 Bacteria 4839
164 Ga0207661_10013381 3300025944 Bacteria 5993
165 Ga0207661_10428077 3300025944 Bacteria 1203
166 Ga0207667_10025825 3300025949 Bacteria 6426
167 Ga0207667_10026654 3300025949 Bacteria 6308
168 Ga0207667_10077292 3300025949 Bacteria 3452
169 Ga0207667_10287124 3300025949 Bacteria 1681
170 Ga0207640_10082961 3300025981 Bacteria 2196
171 Ga0207640_10177443 3300025981 Bacteria 1594
172 Ga0207678_10079345 3300026067 Bacteria 2811
173 Ga0207702_10169427 3300026078 Bacteria 2001
174 Ga0207702_10718471 3300026078 Bacteria 985
175 Ga0207641_10138624 3300026088 Bacteria 2192
176 Ga0207674_10173351 3300026116 Bacteria 2110
177 Ga0207698_10001300 3300026142 Bacteria 14558
178 Ga0207698_10007051 3300026142 Bacteria 7037
179 Ga0207698_10708453 3300026142 Bacteria 1002
180 Ga0209999_1036649 3300027543 Unclassified 916
181 Ga0209971_1008750 3300027682 Bacteria 2401
182 Ga0209971_1032513 3300027682 Unclassified 1252
183 Ga0209974_10083500 3300027876 Bacteria 1102
184 Ga0207428_10000115 3300027907 Bacteria 109072
185 Ga0207428_10001431 3300027907 Bacteria 25080
186 Ga0207428_10002833 3300027907 Bacteria 17208
187 Ga0265318_10017659 3300028577 Bacteria 2925
188 Ga0265338_10019532 3300028800 Bacteria 7181
189 Ga0265338_10193920 3300028800 Bacteria 1537
190 Ga0265330_10054302 3300031235 Bacteria 1751
191 Ga0265328_10071544 3300031239 Bacteria 1275
192 Ga0265320_10054884 3300031240 Bacteria 1920
193 Ga0265325_10039297 3300031241 Bacteria 2492
194 Ga0265340_10018151 3300031247 Bacteria 3633
195 Ga0265340_10026557 3300031247 Bacteria 2925
196 Ga0265340_10039946 3300031247 Bacteria 2312
197 Ga0265340_10075844 3300031247 Bacteria 1588
198 Ga0265340_10154522 3300031247 Bacteria 1044
199 Ga0265339_10130279 3300031249 Bacteria 1287
200 Ga0265339_10216930 3300031249 Bacteria 937
201 Ga0265331_10030576 3300031250 Bacteria 2681
202 Ga0265316_10044018 3300031344 Bacteria 3552
203 Ga0265313_10030678 3300031595 Bacteria 2763
204 Ga0265313_10092016 3300031595 Bacteria 1360
205 Ga0316579_10041036 3300031691 Bacteria 2147
206 Ga0265314_10018652 3300031711 Bacteria 5403
207 Ga0265342_10010304 3300031712 Bacteria 6502
208 Ga0265342_10046243 3300031712 Bacteria 2616
209 Ga0265342_10173085 3300031712 Bacteria 1186
210 Ga0316578_10342721 3300031728 Bacteria 890
211 Ga0316577_10031846 3300031733 Bacteria 2946
212 Ga0307416_100085802 3300032002 Bacteria 2681
213 Ga0307414_10012408 3300032004 Bacteria 5037
214 Ga0316583_10002355 3300032133 Bacteria 6526
215 Ga0316580_10013364 3300032139 Unclassified 2503
216 Ga0316593_10068683 3300032168 Bacteria 1223
217 Ga0373923_0079432 3300035111 Bacteria 1421
218 Ga0373955_0023581 3300035172 Bacteria 3136
219 Ga0373961_0031857 3300035241 Bacteria 1475
220 Ga0316574_0029987 3300035398 Bacteria 3290
221 Ga0373931_0030477 3300035691 Bacteria 2777
222 Ga0373933_0008978 3300035724 Bacteria 5454
223 Ga0373937_0066412 3300036401 Bacteria 3321
224 Ga0316582_0006585 3300036647 Bacteria 6117
225 Ga0316582_0123750 3300036647 Bacteria 1733
226 Ga0316582_0630090 3300036647 Bacteria 738
227 Ga0316584_0120596 3300036712 Bacteria 1960
228 Ga0395899_0011715 3300037312 Bacteria 6713
229 Ga0395899_0051390 3300037312 Bacteria 3059
230 Ga0395900_0007859 3300037418 Bacteria 10990
231 Ga0395900_0013887 3300037418 Bacteria 8218
232 Ga0395900_0389406 3300037418 Bacteria 1360
233 Ga0395900_0560758 3300037418 Bacteria 1086
234 Ga0395898_0019918 3300037466 Bacteria 6822
235 Ga0395898_0024508 3300037466 Bacteria 6085
236 Ga0395898_0052445 3300037466 Bacteria 3985
237 Ga0316581_0025319 3300037588 Bacteria 1765
238 Ga0395901_0020504 3300038443 Bacteria 6765
239 Ga0395901_0032303 3300038443 Bacteria 5401
240 Ga0395901_0305460 3300038443 Bacteria 1649
241 Ga0395901_0526685 3300038443 Bacteria 1200
242 Ga0400484_15289 3300038725 Bacteria 3434
243 Ga0400483_063712 3300039062 Bacteria 1356
244 Ga0400483_280548 3300039062 Bacteria 12355
245 Ga0439461_0004955 3300041410 Bacteria 2249
246 Ga0439446_0001775 3300042156 Bacteria 5028
247 Ga0439434_0000074 3300042435 Bacteria 24821
248 Ga0439435_0000063 3300042436 Bacteria 12691
249 Ga0439435_0008666 3300042436 Bacteria 2364
250 Ga0451577_0000100 3300042876 Bacteria 191528
251 Ga0451577_0000133 3300042876 Bacteria 166977
252 Ga0451577_0259691 3300042876 Bacteria 1573
253 Ga0453684_0000180 3300044712 Bacteria 279345
254 Ga0453684_0001630 3300044712 Bacteria 61213
255 Ga0451576_0879835 3300045051 Unclassified 940
256 Ga0495638_0030828 3300046460 Bacteria 3448
257 Ga0495605_0107099 3300046474 Bacteria 1279
258 Ga0495608_0026247 3300046511 Bacteria 3972
259 Ga0495635_0038950 3300046663 Bacteria 3291
260 Ga0495604_0093021 3300047317 Bacteria 2232
261 Ga0495672_0124856 3300047320 Unclassified 1363
262 Ga0495672_0235441 3300047320 Bacteria 897
263 Ga0495602_0154946 3300048088 Bacteria 1795
264 Ga0496102_0215763 3300048905 Bacteria 1809
265 Ga0496110_0101320 3300048913 Bacteria 2582
266 Ga0501031_0015277 3300049568 Bacteria 4986
267 Ga0501031_0039771 3300049568 Bacteria 3069
268 Ga0501032_0332023 3300049569 Bacteria 980
269 Ga0501033_0001405 3300049570 Bacteria 21382
270 Ga0501033_0046357 3300049570 Bacteria 3232
271 Ga0501034_0053726 3300049571 Bacteria 4056
272 Ga0501034_0202517 3300049571 Bacteria 1942
273 Ga0501036_0000361 3300049572 Bacteria 32186
274 Ga0501036_0075408 3300049572 Bacteria 2852
275 Ga0501036_0395230 3300049572 Bacteria 1153
276 Ga0501037_0151471 3300049573 Unclassified 1657
277 Ga0501037_0155814 3300049573 Bacteria 1630
278 Ga0501038_0000897 3300049574 Bacteria 26352
279 Ga0501039_0005502 3300049575 Bacteria 9580
280 Ga0501039_0096043 3300049575 Bacteria 2311
281 Ga0501039_0820904 3300049575 Bacteria 725
282 Ga0501040_0001322 3300049576 Bacteria 15695
283 Ga0501041_0001118 3300049577 Bacteria 14698
284 Ga0501041_0449460 3300049577 Bacteria 818
285 Ga0501042_0005721 3300049578 Bacteria 8028
286 Ga0501043_0016730 3300049579 Bacteria 5747
287 Ga0501043_0305910 3300049579 Bacteria 1214
288 Ga0501046_0005036 3300049580 Bacteria 11861
289 Ga0501047_0020602 3300049581 Bacteria 6332
290 Ga0501047_0063378 3300049581 Bacteria 3566
291 Ga0501047_0282201 3300049581 Unclassified 1505
292 Ga0501047_0408527 3300049581 Bacteria 1190
293 Ga0501048_0000253 3300049582 Bacteria 35754
294 Ga0501068_0026056 3300049584 Bacteria 3442
295 Ga0501070_0020377 3300049586 Bacteria 5563
296 Ga0501070_0047052 3300049586 Bacteria 3587
297 Ga0501070_0276568 3300049586 Unclassified 1370
298 Ga0501070_0780317 3300049586 Bacteria 751
299 Ga0501071_0011754 3300049587 Bacteria 5908
300 Ga0501071_0045072 3300049587 Bacteria 3165
301 Ga0501071_0566292 3300049587 Bacteria 873
302 Ga0501072_0002948 3300049588 Bacteria 12810
303 Ga0501072_0099698 3300049588 Bacteria 2309
304 Ga0501072_0400783 3300049588 Bacteria 1088
305 Ga0501073_0030183 3300049589 Bacteria 3872
306 Ga0501074_0010737 3300049590 Bacteria 6654
307 Ga0501075_0025315 3300049591 Bacteria 4360
308 Ga0501076_0020232 3300049592 Bacteria 5092
309 Ga0501076_0359911 3300049592 Bacteria 1195
310 Ga0501076_0472953 3300049592 Unclassified 1032
311 Ga0501077_0001816 3300049593 Bacteria 12899
312 Ga0501079_0001297 3300049741 Bacteria 17577
313 Ga0501080_0031807 3300049742 Bacteria 4917
314 Ga0501080_0229855 3300049742 Bacteria 1695
315 Ga0501080_0355719 3300049742 Bacteria 1322
316 Ga0501081_0000207 3300049743 Bacteria 28882
317 Ga0501081_0208644 3300049743 Bacteria 1418
318 Ga0501035_0005796 3300049822 Bacteria 11645
319 Ga0501035_0329871 3300049822 Bacteria 1280
320 Ga0501044_0164882 3300049823 Bacteria 2190
321 Ga0501044_0215771 3300049823 Bacteria 1871
322 Ga0501044_0478066 3300049823 Bacteria 1149
323 Ga0501045_0008456 3300049824 Bacteria 7173
324 nmdc:mga03683_77053_c1 3300050489 Bacteria 853
325 nmdc:mga00v17_47153_c1 3300050491 Bacteria 2609
326 nmdc:mga0yw44_23092_c1 3300050492 Bacteria 3500
327 nmdc:mga05p37_146_c2 3300050507 Bacteria 39342
328 nmdc:mga05p37_159688_c1 3300050507 Bacteria 2753
329 nmdc:mga05p37_505_c1 3300050507 Bacteria 42970
330 nmdc:mga05p37_9120_c1 3300050507 Bacteria 11724
331 nmdc:mga09592_309_c1 3300050508 Bacteria 35745
332 nmdc:mga09592_34475_c1 3300050508 Bacteria 4231
333 nmdc:mga09592_387468_c1 3300050508 Bacteria 1208
334 nmdc:mga09592_53260_c1 3300050508 Bacteria 3417
335 nmdc:mga09592_772_c1 3300050508 Bacteria 24711
336 nmdc:mga0qj67_165_c1 3300050509 Bacteria 44307
337 nmdc:mga0qj67_20554_c1 3300050509 Bacteria 5057
338 nmdc:mga0qj67_66953_c1 3300050509 Bacteria 2861
339 nmdc:mga06r32_149808_c1 3300050510 Bacteria 2311
340 nmdc:mga06r32_24270_c1 3300050510 Bacteria 5624
341 nmdc:mga06r32_28386_c1 3300050510 Bacteria 5235
342 nmdc:mga06r32_285183_c1 3300050510 Unclassified 1638
343 nmdc:mga06r32_296_c1 3300050510 Bacteria 41448
344 nmdc:mga06r32_6147_c1 3300050510 Bacteria 10781
345 nmdc:mga08y16_1223_c1 3300050511 Bacteria 25402
346 nmdc:mga08y16_2844_c1 3300050511 Bacteria 17794
347 nmdc:mga08y16_7806_c1 3300050511 Bacteria 11209
348 nmdc:mga0n895_2649_c1 3300050512 Bacteria 14116
349 nmdc:mga0n895_74630_c1 3300050512 Bacteria 3369
350 nmdc:mga0n895_76480_c1 3300050512 Bacteria 3329
351 nmdc:mga0rr50_16037_c1 3300050513 Bacteria 4108
352 nmdc:mga0rr50_17607_c1 3300050513 Bacteria 4775
353 nmdc:mga0rr50_7226_c1 3300050513 Bacteria 6829
354 nmdc:mga08x19_181474_c1 3300050514 Bacteria 1437
355 nmdc:mga08x19_240539_c1 3300050514 Bacteria 1248
356 nmdc:mga0a205_347950_c1 3300050515 Bacteria 1350
357 Ga0495601_0036696 3300053077 Bacteria 3062
358 Ga0495612_0008176 3300053078 Bacteria 4251
359 Ga0500646_0115769 3300053090 Bacteria 857
360 Ga0500641_0009807 3300053096 Bacteria 3448
361 Ga0501084_0009030 3300054114 Bacteria 8251
362 Ga0501082_0000106 3300060353 Bacteria 65983
363 Ga0501082_0008770 3300060353 Bacteria 8717
364 Ga0501082_0088446 3300060353 Unclassified 2673
365 Ga0501082_0154530 3300060353 Bacteria 1994
366 Ga0530510_0004102 3300061734 Bacteria 10056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0879835 Ga0451576_0879835_30_581 182
2 3300025934 Ga0207686_10270110 Ga0207686_102701102 192
3 3300009148 Ga0105243_11015718 Ga0105243_110157181 205
4 3300009553 Ga0105249_11082575 Ga0105249_110825751 205
5 3300027682 Ga0209971_1008750 Ga0209971_10087503 206
6 3300027876 Ga0209974_10083500 Ga0209974_100835002 206
7 3300013105 Ga0157369_10875838 Ga0157369_108758382 210
8 3300037312 Ga0395899_0051390 Ga0395899_0051390_149_832 210
9 3300037418 Ga0395900_0007859 Ga0395900_0007859_1208_1891 210
10 3300037466 Ga0395898_0019918 Ga0395898_0019918_1902_2585 210
11 3300038443 Ga0395901_0032303 Ga0395901_0032303_1315_1998 210
12 3300005329 Ga0070683_100021378 Ga0070683_1000213782 212
13 3300005343 Ga0070687_100154083 Ga0070687_1001540831 212
14 3300005355 Ga0070671_100178733 Ga0070671_1001787332 212
15 3300006237 Ga0097621_100001554 Ga0097621_10000155413 212
16 3300009177 Ga0105248_10463414 Ga0105248_104634142 212
17 3300025931 Ga0207644_10388622 Ga0207644_103886222 212
18 3300025944 Ga0207661_10013381 Ga0207661_100133817 212
19 3300035241 Ga0373961_0031857 Ga0373961_0031857_818_1465 214
20 3300035111 Ga0373923_0079432 Ga0373923_0079432_535_1215 215
21 3300035172 Ga0373955_0023581 Ga0373955_0023581_69_749 215
22 3300035724 Ga0373933_0008978 Ga0373933_0008978_2826_3506 215
23 3300036401 Ga0373937_0066412 Ga0373937_0066412_461_1141 215
24 3300046511 Ga0495608_0026247 Ga0495608_0026247_2213_2893 215
25 3300046663 Ga0495635_0038950 Ga0495635_0038950_557_1237 215
26 3300047317 Ga0495604_0093021 Ga0495604_0093021_68_748 215
27 3300048088 Ga0495602_0154946 Ga0495602_0154946_68_748 215
28 3300053077 Ga0495601_0036696 Ga0495601_0036696_1400_2080 215
29 3300053078 Ga0495612_0008176 Ga0495612_0008176_2501_3181 215
30 3300005354 Ga0070675_100379154 Ga0070675_1003791542 216
31 3300005356 Ga0070674_100098109 Ga0070674_1000981091 216
32 3300006846 Ga0075430_100005251 Ga0075430_1000052515 217
33 3300006847 Ga0075431_100008882 Ga0075431_1000088823 217
34 3300032002 Ga0307416_100085802 Ga0307416_1000858023 217
35 3300049589 Ga0501073_0030183 Ga0501073_0030183_1529_2185 217
36 3300050510 nmdc:mga06r32_24270_c1 nmdc:mga06r32_24270_c1_341_997 217
37 3300006163 Ga0070715_10082067 Ga0070715_100820672 219
38 3300006173 Ga0070716_100078407 Ga0070716_1000784071 219
39 3300025905 Ga0207685_10003592 Ga0207685_100035922 219
40 3300049568 Ga0501031_0015277 Ga0501031_0015277_1717_2379 219
41 3300049570 Ga0501033_0001405 Ga0501033_0001405_20031_20693 219
42 3300049572 Ga0501036_0000361 Ga0501036_0000361_29989_30651 219
43 3300049573 Ga0501037_0151471 Ga0501037_0151471_455_1117 219
44 3300049574 Ga0501038_0000897 Ga0501038_0000897_18909_19571 219
45 3300049575 Ga0501039_0005502 Ga0501039_0005502_1515_2177 219
46 3300049575 Ga0501039_0820904 Ga0501039_0820904_50_712 219
47 3300049576 Ga0501040_0001322 Ga0501040_0001322_4403_5065 219
48 3300049577 Ga0501041_0001118 Ga0501041_0001118_3411_4073 219
49 3300049578 Ga0501042_0005721 Ga0501042_0005721_1669_2331 219
50 3300049579 Ga0501043_0016730 Ga0501043_0016730_2654_3316 219
51 3300049580 Ga0501046_0005036 Ga0501046_0005036_5122_5784 219
52 3300049581 Ga0501047_0408527 Ga0501047_0408527_374_1036 219
53 3300049582 Ga0501048_0000253 Ga0501048_0000253_34940_35602 219
54 3300049584 Ga0501068_0026056 Ga0501068_0026056_1924_2586 219
55 3300049586 Ga0501070_0276568 Ga0501070_0276568_151_813 219
56 3300049587 Ga0501071_0011754 Ga0501071_0011754_5009_5671 219
57 3300049588 Ga0501072_0002948 Ga0501072_0002948_3982_4644 219
58 3300049590 Ga0501074_0010737 Ga0501074_0010737_3661_4323 219
59 3300049591 Ga0501075_0025315 Ga0501075_0025315_3576_4238 219
60 3300049592 Ga0501076_0020232 Ga0501076_0020232_1641_2303 219
61 3300049593 Ga0501077_0001816 Ga0501077_0001816_7922_8584 219
62 3300049741 Ga0501079_0001297 Ga0501079_0001297_3624_4286 219
63 3300049742 Ga0501080_0229855 Ga0501080_0229855_677_1339 219
64 3300049743 Ga0501081_0000207 Ga0501081_0000207_23475_24137 219
65 3300049822 Ga0501035_0005796 Ga0501035_0005796_4975_5637 219
66 3300049824 Ga0501045_0008456 Ga0501045_0008456_2109_2771 219
67 3300054114 Ga0501084_0009030 Ga0501084_0009030_843_1505 219
68 3300060353 Ga0501082_0008770 Ga0501082_0008770_4290_4952 219
69 3300061734 Ga0530510_0004102 Ga0530510_0004102_2616_3278 219
70 3300036712 Ga0316584_0120596 Ga0316584_0120596_912_1598 220
71 3300006846 Ga0075430_100139021 Ga0075430_1001390211 221
72 3300014969 Ga0157376_10081875 Ga0157376_100818754 221
73 3300035691 Ga0373931_0030477 Ga0373931_0030477_639_1361 221
74 3300039062 Ga0400483_063712 Ga0400483_063712_518_1186 221
75 3300005545 Ga0070695_100108766 Ga0070695_1001087662 222
76 3300005546 Ga0070696_100008106 Ga0070696_1000081064 222
77 3300006844 Ga0075428_100142639 Ga0075428_1001426393 222
78 3300007076 Ga0075435_100001332 Ga0075435_10000133216 222
79 3300041410 Ga0439461_0004955 Ga0439461_0004955_538_1209 222
80 3300042156 Ga0439446_0001775 Ga0439446_0001775_2955_3626 222
81 3300042435 Ga0439434_0000074 Ga0439434_0000074_20292_20963 222
82 3300042436 Ga0439435_0000063 Ga0439435_0000063_1645_2316 222
83 3300049579 Ga0501043_0305910 Ga0501043_0305910_68_739 222
84 3300049743 Ga0501081_0208644 Ga0501081_0208644_469_1140 222
85 3300050510 nmdc:mga06r32_28386_c1 nmdc:mga06r32_28386_c1_357_1028 222
86 3300050513 nmdc:mga0rr50_17607_c1 nmdc:mga0rr50_17607_c1_4093_4764 222
87 3300050515 nmdc:mga0a205_347950_c1 nmdc:mga0a205_347950_c1_370_1041 222
88 3300005458 Ga0070681_10268599 Ga0070681_102685992 223
89 3300006914 Ga0075436_100260898 Ga0075436_1002608982 223
90 3300050514 nmdc:mga08x19_240539_c1 nmdc:mga08x19_240539_c1_246_920 223
91 iso_pu_bacteria 2808606379 2808939263 223
92 3300005536 Ga0070697_100004435 Ga0070697_1000044352 224
93 3300006844 Ga0075428_100001689 Ga0075428_10000168913 224
94 3300006880 Ga0075429_100028413 Ga0075429_1000284133 224
95 3300007265 Ga0099794_10044525 Ga0099794_100445253 224
96 3300009094 Ga0111539_10000486 Ga0111539_1000048613 224
97 3300009147 Ga0114129_10334730 Ga0114129_103347302 224
98 3300027907 Ga0207428_10002833 Ga0207428_100028339 224
99 3300049742 Ga0501080_0031807 Ga0501080_0031807_224_946 224
100 3300050507 nmdc:mga05p37_159688_c1 nmdc:mga05p37_159688_c1_791_1468 224
101 3300050508 nmdc:mga09592_53260_c1 nmdc:mga09592_53260_c1_593_1270 224
102 3300050511 nmdc:mga08y16_7806_c1 nmdc:mga08y16_7806_c1_197_874 224
103 3300005327 Ga0070658_10063817 Ga0070658_100638173 225
104 3300005329 Ga0070683_100356928 Ga0070683_1003569281 225
105 3300005339 Ga0070660_100177668 Ga0070660_1001776682 225
106 3300005344 Ga0070661_100262242 Ga0070661_1002622421 225
107 3300005355 Ga0070671_100429321 Ga0070671_1004293212 225
108 3300005366 Ga0070659_100262575 Ga0070659_1002625752 225
109 3300005435 Ga0070714_100075474 Ga0070714_1000754744 225
110 3300005436 Ga0070713_100350268 Ga0070713_1003502682 225
111 3300005455 Ga0070663_100155455 Ga0070663_1001554552 225
112 3300005457 Ga0070662_100358374 Ga0070662_1003583742 225
113 3300005530 Ga0070679_100279043 Ga0070679_1002790432 225
114 3300005563 Ga0068855_100010956 Ga0068855_10001095610 225
115 3300005616 Ga0068852_100131557 Ga0068852_1001315573 225
116 3300009551 Ga0105238_10046817 Ga0105238_100468173 225
117 3300013105 Ga0157369_10203432 Ga0157369_102034322 225
118 3300025909 Ga0207705_10103593 Ga0207705_101035932 225
119 3300025917 Ga0207660_10161748 Ga0207660_101617481 225
120 3300025919 Ga0207657_10092151 Ga0207657_100921512 225
121 3300025924 Ga0207694_10125023 Ga0207694_101250233 225
122 3300025931 Ga0207644_10292608 Ga0207644_102926082 225
123 3300025933 Ga0207706_10380240 Ga0207706_103802402 225
124 3300025944 Ga0207661_10428077 Ga0207661_104280772 225
125 3300025949 Ga0207667_10025825 Ga0207667_100258252 225
126 3300026067 Ga0207678_10079345 Ga0207678_100793452 225
127 3300026078 Ga0207702_10718471 Ga0207702_107184712 225
128 3300026142 Ga0207698_10007051 Ga0207698_100070512 225
129 3300031691 Ga0316579_10041036 Ga0316579_100410362 225
130 3300031728 Ga0316578_10342721 Ga0316578_103427211 225
131 3300031733 Ga0316577_10031846 Ga0316577_100318463 225
132 3300032139 Ga0316580_10013364 Ga0316580_100133642 225
133 3300035398 Ga0316574_0029987 Ga0316574_0029987_1878_2558 225
134 3300036647 Ga0316582_0006585 Ga0316582_0006585_948_1649 225
135 3300036647 Ga0316582_0123750 Ga0316582_0123750_844_1524 225
136 3300037588 Ga0316581_0025319 Ga0316581_0025319_421_1122 225
137 3300047320 Ga0495672_0124856 Ga0495672_0124856_239_919 225
138 3300049568 Ga0501031_0039771 Ga0501031_0039771_1340_2017 225
139 3300049569 Ga0501032_0332023 Ga0501032_0332023_92_769 225
140 3300049570 Ga0501033_0046357 Ga0501033_0046357_363_1040 225
141 3300049571 Ga0501034_0053726 Ga0501034_0053726_2555_3232 225
142 3300049571 Ga0501034_0202517 Ga0501034_0202517_205_882 225
143 3300049572 Ga0501036_0075408 Ga0501036_0075408_504_1181 225
144 3300049572 Ga0501036_0395230 Ga0501036_0395230_284_961 225
145 3300049573 Ga0501037_0155814 Ga0501037_0155814_156_833 225
146 3300049575 Ga0501039_0096043 Ga0501039_0096043_103_780 225
147 3300049581 Ga0501047_0020602 Ga0501047_0020602_3523_4200 225
148 3300049581 Ga0501047_0282201 Ga0501047_0282201_314_991 225
149 3300049586 Ga0501070_0020377 Ga0501070_0020377_541_1218 225
150 3300049586 Ga0501070_0047052 Ga0501070_0047052_1795_2472 225
151 3300049586 Ga0501070_0780317 Ga0501070_0780317_17_694 225
152 3300049587 Ga0501071_0045072 Ga0501071_0045072_615_1292 225
153 3300049822 Ga0501035_0329871 Ga0501035_0329871_170_847 225
154 3300049823 Ga0501044_0164882 Ga0501044_0164882_926_1603 225
155 3300049823 Ga0501044_0478066 Ga0501044_0478066_399_1076 225
156 3300060353 Ga0501082_0088446 Ga0501082_0088446_306_983 225
157 3300005327 Ga0070658_10202619 Ga0070658_102026192 226
158 3300005331 Ga0070670_100064464 Ga0070670_1000644643 226
159 3300005339 Ga0070660_100034522 Ga0070660_1000345223 226
160 3300005366 Ga0070659_100412824 Ga0070659_1004128241 226
161 3300005435 Ga0070714_100019705 Ga0070714_1000197053 226
162 3300005435 Ga0070714_100024794 Ga0070714_1000247945 226
163 3300005436 Ga0070713_100003525 Ga0070713_1000035256 226
164 3300005458 Ga0070681_10478189 Ga0070681_104781892 226
165 3300005530 Ga0070679_100815204 Ga0070679_1008152042 226
166 3300005563 Ga0068855_100046787 Ga0068855_1000467875 226
167 3300005563 Ga0068855_100163660 Ga0068855_1001636602 226
168 3300005578 Ga0068854_100145170 Ga0068854_1001451702 226
169 3300005614 Ga0068856_100362229 Ga0068856_1003622292 226
170 3300005617 Ga0068859_100076247 Ga0068859_1000762472 226
171 3300005841 Ga0068863_100304413 Ga0068863_1003044132 226
172 3300005937 Ga0081455_10004490 Ga0081455_100044904 226
173 3300005937 Ga0081455_10009018 Ga0081455_100090184 226
174 3300005983 Ga0081540_1004153 Ga0081540_10041533 226
175 3300006028 Ga0070717_10010435 Ga0070717_100104355 226
176 3300006038 Ga0075365_10022333 Ga0075365_100223333 226
177 3300006058 Ga0075432_10010366 Ga0075432_100103664 226
178 3300006163 Ga0070715_10006599 Ga0070715_100065991 226
179 3300006173 Ga0070716_100036436 Ga0070716_1000364362 226
180 3300006177 Ga0075362_10064685 Ga0075362_100646852 226
181 3300006844 Ga0075428_100111419 Ga0075428_1001114193 226
182 3300006846 Ga0075430_100034877 Ga0075430_1000348775 226
183 3300006847 Ga0075431_100175918 Ga0075431_1001759182 226
184 3300006847 Ga0075431_100318117 Ga0075431_1003181172 226
185 3300006871 Ga0075434_100055217 Ga0075434_1000552173 226
186 3300006931 Ga0097620_100076246 Ga0097620_1000762462 226
187 3300009093 Ga0105240_10044690 Ga0105240_100446904 226
188 3300009098 Ga0105245_10159140 Ga0105245_101591402 226
189 3300009101 Ga0105247_10042781 Ga0105247_100427812 226
190 3300009551 Ga0105238_10735895 Ga0105238_107358952 226
191 3300013104 Ga0157370_10535362 Ga0157370_105353621 226
192 3300014325 Ga0163163_10107556 Ga0163163_101075563 226
193 3300020070 Ga0206356_11554248 Ga0206356_115542481 226
194 3300020081 Ga0206354_10591667 Ga0206354_105916672 226
195 3300025898 Ga0207692_10010893 Ga0207692_100108932 226
196 3300025900 Ga0207710_10007458 Ga0207710_100074583 226
197 3300025905 Ga0207685_10000417 Ga0207685_100004176 226
198 3300025908 Ga0207643_10210768 Ga0207643_102107682 226
199 3300025909 Ga0207705_10147076 Ga0207705_101470762 226
200 3300025912 Ga0207707_10086394 Ga0207707_100863942 226
201 3300025913 Ga0207695_10042918 Ga0207695_100429184 226
202 3300025919 Ga0207657_10111337 Ga0207657_101113373 226
203 3300025921 Ga0207652_10519601 Ga0207652_105196012 226
204 3300025925 Ga0207650_10564491 Ga0207650_105644911 226
205 3300025928 Ga0207700_10375357 Ga0207700_103753572 226
206 3300025929 Ga0207664_10038246 Ga0207664_100382464 226
207 3300025939 Ga0207665_10000597 Ga0207665_1000059714 226
208 3300025942 Ga0207689_10026667 Ga0207689_100266672 226
209 3300025949 Ga0207667_10026654 Ga0207667_100266542 226
210 3300025949 Ga0207667_10287124 Ga0207667_102871243 226
211 3300025981 Ga0207640_10082961 Ga0207640_100829612 226
212 3300026088 Ga0207641_10138624 Ga0207641_101386242 226
213 3300026116 Ga0207674_10173351 Ga0207674_101733512 226
214 3300028800 Ga0265338_10019532 Ga0265338_100195325 226
215 3300028800 Ga0265338_10193920 Ga0265338_101939202 226
216 3300031247 Ga0265340_10075844 Ga0265340_100758442 226
217 3300031247 Ga0265340_10154522 Ga0265340_101545222 226
218 3300031249 Ga0265339_10130279 Ga0265339_101302792 226
219 3300031712 Ga0265342_10010304 Ga0265342_100103042 226
220 3300042876 Ga0451577_0000133 Ga0451577_0000133_65474_66157 226
221 3300044712 Ga0453684_0000180 Ga0453684_0000180_75624_76307 226
222 3300044712 Ga0453684_0001630 Ga0453684_0001630_4548_5231 226
223 3300046474 Ga0495605_0107099 Ga0495605_0107099_283_969 226
224 3300047320 Ga0495672_0235441 Ga0495672_0235441_76_762 226
225 3300048905 Ga0496102_0215763 Ga0496102_0215763_43_726 226
226 3300049577 Ga0501041_0449460 Ga0501041_0449460_98_781 226
227 3300049588 Ga0501072_0099698 Ga0501072_0099698_1472_2155 226
228 3300049742 Ga0501080_0355719 Ga0501080_0355719_54_737 226
229 3300050489 nmdc:mga03683_77053_c1 nmdc:mga03683_77053_c1_111_794 226
230 3300050492 nmdc:mga0yw44_23092_c1 nmdc:mga0yw44_23092_c1_1026_1709 226
231 3300050509 nmdc:mga0qj67_66953_c1 nmdc:mga0qj67_66953_c1_1273_1956 226
232 3300050510 nmdc:mga06r32_149808_c1 nmdc:mga06r32_149808_c1_406_1089 226
233 3300050512 nmdc:mga0n895_74630_c1 nmdc:mga0n895_74630_c1_131_814 226
234 3300060353 Ga0501082_0154530 Ga0501082_0154530_704_1387 226
235 3300005336 Ga0070680_100393264 Ga0070680_1003932642 227
236 3300005458 Ga0070681_10554399 Ga0070681_105543992 227
237 3300005466 Ga0070685_10249198 Ga0070685_102491982 227
238 3300005518 Ga0070699_100452604 Ga0070699_1004526041 227
239 3300006880 Ga0075429_100406724 Ga0075429_1004067242 227
240 3300009553 Ga0105249_10781802 Ga0105249_107818022 227
241 3300027543 Ga0209999_1036649 Ga0209999_10366491 227
242 3300027682 Ga0209971_1032513 Ga0209971_10325132 227
243 3300032004 Ga0307414_10012408 Ga0307414_100124087 227
244 3300037312 Ga0395899_0011715 Ga0395899_0011715_630_1313 227
245 3300037418 Ga0395900_0013887 Ga0395900_0013887_5592_6275 227
246 3300037418 Ga0395900_0389406 Ga0395900_0389406_244_927 227
247 3300037418 Ga0395900_0560758 Ga0395900_0560758_340_1023 227
248 3300037466 Ga0395898_0024508 Ga0395898_0024508_37_720 227
249 3300037466 Ga0395898_0052445 Ga0395898_0052445_830_1513 227
250 3300038443 Ga0395901_0020504 Ga0395901_0020504_5345_6028 227
251 3300038443 Ga0395901_0305460 Ga0395901_0305460_697_1380 227
252 3300038443 Ga0395901_0526685 Ga0395901_0526685_213_896 227
253 3300042876 Ga0451577_0000100 Ga0451577_0000100_69810_70523 227
254 3300049587 Ga0501071_0566292 Ga0501071_0566292_14_703 227
255 3300049592 Ga0501076_0472953 Ga0501076_0472953_41_748 227
256 3300050508 nmdc:mga09592_387468_c1 nmdc:mga09592_387468_c1_227_916 227
257 3300053096 Ga0500641_0009807 Ga0500641_0009807_441_1124 227
258 3300005340 Ga0070689_100841534 Ga0070689_1008415341 228
259 3300005544 Ga0070686_100490149 Ga0070686_1004901492 228
260 3300005578 Ga0068854_100133983 Ga0068854_1001339832 228
261 3300005844 Ga0068862_100326953 Ga0068862_1003269531 228
262 3300009147 Ga0114129_10366069 Ga0114129_103660692 228
263 3300025936 Ga0207670_10652136 Ga0207670_106521362 228
264 3300025981 Ga0207640_10177443 Ga0207640_101774432 228
265 3300026142 Ga0207698_10708453 Ga0207698_107084532 228
266 3300028577 Ga0265318_10017659 Ga0265318_100176592 228
267 3300031235 Ga0265330_10054302 Ga0265330_100543022 228
268 3300031239 Ga0265328_10071544 Ga0265328_100715442 228
269 3300031240 Ga0265320_10054884 Ga0265320_100548842 228
270 3300031241 Ga0265325_10039297 Ga0265325_100392972 228
271 3300031247 Ga0265340_10026557 Ga0265340_100265572 228
272 3300031247 Ga0265340_10039946 Ga0265340_100399462 228
273 3300031249 Ga0265339_10216930 Ga0265339_102169302 228
274 3300031250 Ga0265331_10030576 Ga0265331_100305763 228
275 3300031344 Ga0265316_10044018 Ga0265316_100440183 228
276 3300031595 Ga0265313_10030678 Ga0265313_100306783 228
277 3300031595 Ga0265313_10092016 Ga0265313_100920162 228
278 3300031711 Ga0265314_10018652 Ga0265314_100186524 228
279 3300031712 Ga0265342_10046243 Ga0265342_100462432 228
280 3300031712 Ga0265342_10173085 Ga0265342_101730852 228
281 3300032168 Ga0316593_10068683 Ga0316593_100686832 228
282 3300036647 Ga0316582_0630090 Ga0316582_0630090_26_715 228
283 3300042436 Ga0439435_0008666 Ga0439435_0008666_1311_2009 228
284 3300048913 Ga0496110_0101320 Ga0496110_0101320_703_1392 228
285 3300049581 Ga0501047_0063378 Ga0501047_0063378_2512_3201 228
286 3300050510 nmdc:mga06r32_285183_c1 nmdc:mga06r32_285183_c1_711_1484 228
287 3300006048 Ga0075363_100023185 Ga0075363_1000231853 229
288 3300006051 Ga0075364_10016544 Ga0075364_100165445 229
289 3300006195 Ga0075366_10077152 Ga0075366_100771522 229
290 3300006844 Ga0075428_100131922 Ga0075428_1001319222 229
291 3300032133 Ga0316583_10002355 Ga0316583_100023556 229
292 3300038725 Ga0400484_15289 Ga0400484_15289_2161_2856 229
293 3300039062 Ga0400483_280548 Ga0400483_280548_4490_5185 229
294 3300046460 Ga0495638_0030828 Ga0495638_0030828_826_1539 229
295 3300050491 nmdc:mga00v17_47153_c1 nmdc:mga00v17_47153_c1_906_1607 229
296 3300050508 nmdc:mga09592_34475_c1 nmdc:mga09592_34475_c1_673_1365 229
297 3300005356 Ga0070674_100130949 Ga0070674_1001309492 230
298 3300005458 Ga0070681_10622892 Ga0070681_106228922 230
299 3300005547 Ga0070693_100242568 Ga0070693_1002425681 230
300 3300006195 Ga0075366_10001869 Ga0075366_100018693 230
301 3300006844 Ga0075428_100014282 Ga0075428_1000142824 230
302 3300006846 Ga0075430_100028930 Ga0075430_1000289304 230
303 3300006847 Ga0075431_100001296 Ga0075431_10000129614 230
304 3300006880 Ga0075429_100002571 Ga0075429_1000025718 230
305 3300009094 Ga0111539_10001004 Ga0111539_1000100418 230
306 3300009147 Ga0114129_10000717 Ga0114129_1000071718 230
307 3300009148 Ga0105243_10909585 Ga0105243_109095851 230
308 3300027907 Ga0207428_10001431 Ga0207428_1000143113 230
309 3300049823 Ga0501044_0215771 Ga0501044_0215771_299_1057 230
310 3300050507 nmdc:mga05p37_146_c2 nmdc:mga05p37_146_c2_35305_36000 230
311 3300050508 nmdc:mga09592_309_c1 nmdc:mga09592_309_c1_21039_21734 230
312 3300050509 nmdc:mga0qj67_20554_c1 nmdc:mga0qj67_20554_c1_2853_3548 230
313 3300050510 nmdc:mga06r32_296_c1 nmdc:mga06r32_296_c1_15612_16307 230
314 3300050511 nmdc:mga08y16_1223_c1 nmdc:mga08y16_1223_c1_10894_11589 230
315 3300053090 Ga0500646_0115769 Ga0500646_0115769_43_762 230
316 3300005530 Ga0070679_100232279 Ga0070679_1002322792 231
317 3300025921 Ga0207652_10269148 Ga0207652_102691482 231
318 3300049588 Ga0501072_0400783 Ga0501072_0400783_50_754 231
319 3300049592 Ga0501076_0359911 Ga0501076_0359911_106_810 231
320 3300060353 Ga0501082_0000106 Ga0501082_0000106_48958_49659 231
321 3300003911 JGI25405J52794_10007520 JGI25405J52794_100075202 232
322 3300005329 Ga0070683_100090504 Ga0070683_1000905043 232
323 3300005366 Ga0070659_100145027 Ga0070659_1001450272 232
324 3300005435 Ga0070714_100068448 Ga0070714_1000684483 232
325 3300005563 Ga0068855_100073129 Ga0068855_1000731293 232
326 3300005614 Ga0068856_100149649 Ga0068856_1001496492 232
327 3300005616 Ga0068852_100012983 Ga0068852_1000129832 232
328 3300005937 Ga0081455_10001479 Ga0081455_100014793 232
329 3300005937 Ga0081455_10018296 Ga0081455_100182969 232
330 3300005983 Ga0081540_1018108 Ga0081540_10181085 232
331 3300006058 Ga0075432_10000272 Ga0075432_100002725 232
332 3300006194 Ga0075427_10001521 Ga0075427_100015213 232
333 3300006844 Ga0075428_100003180 Ga0075428_10000318017 232
334 3300006844 Ga0075428_100468270 Ga0075428_1004682702 232
335 3300006846 Ga0075430_100000201 Ga0075430_10000020142 232
336 3300006847 Ga0075431_100000260 Ga0075431_10000026042 232
337 3300006852 Ga0075433_10000007 Ga0075433_1000000736 232
338 3300006871 Ga0075434_100000091 Ga0075434_1000000914 232
339 3300006871 Ga0075434_100074129 Ga0075434_1000741293 232
340 3300006880 Ga0075429_100001824 Ga0075429_10000182417 232
341 3300006880 Ga0075429_100317176 Ga0075429_1003171762 232
342 3300006914 Ga0075436_100231730 Ga0075436_1002317302 232
343 3300007076 Ga0075435_100005192 Ga0075435_1000051922 232
344 3300007076 Ga0075435_100017727 Ga0075435_1000177274 232
345 3300009094 Ga0111539_10001672 Ga0111539_1000167218 232
346 3300009147 Ga0114129_10001111 Ga0114129_1000111140 232
347 3300009147 Ga0114129_10069532 Ga0114129_100695324 232
348 3300013105 Ga0157369_10002433 Ga0157369_1000243320 232
349 3300013307 Ga0157372_10002758 Ga0157372_100027587 232
350 3300025932 Ga0207690_10151019 Ga0207690_101510192 232
351 3300025949 Ga0207667_10077292 Ga0207667_100772923 232
352 3300026078 Ga0207702_10169427 Ga0207702_101694272 232
353 3300026142 Ga0207698_10001300 Ga0207698_100013009 232
354 3300027907 Ga0207428_10000115 Ga0207428_1000011546 232
355 3300031247 Ga0265340_10018151 Ga0265340_100181513 232
356 3300042876 Ga0451577_0259691 Ga0451577_0259691_391_1116 232
357 3300050507 nmdc:mga05p37_505_c1 nmdc:mga05p37_505_c1_30712_31410 232
358 3300050507 nmdc:mga05p37_9120_c1 nmdc:mga05p37_9120_c1_8329_9027 232
359 3300050508 nmdc:mga09592_772_c1 nmdc:mga09592_772_c1_9604_10302 232
360 3300050509 nmdc:mga0qj67_165_c1 nmdc:mga0qj67_165_c1_38078_38776 232
361 3300050510 nmdc:mga06r32_6147_c1 nmdc:mga06r32_6147_c1_4804_5502 232
362 3300050511 nmdc:mga08y16_2844_c1 nmdc:mga08y16_2844_c1_11689_12387 232
363 3300050512 nmdc:mga0n895_2649_c1 nmdc:mga0n895_2649_c1_2451_3149 232
364 3300050512 nmdc:mga0n895_76480_c1 nmdc:mga0n895_76480_c1_225_923 232
365 3300050513 nmdc:mga0rr50_16037_c1 nmdc:mga0rr50_16037_c1_2363_3061 232
366 3300050513 nmdc:mga0rr50_7226_c1 nmdc:mga0rr50_7226_c1_405_1103 232
367 3300050514 nmdc:mga08x19_181474_c1 nmdc:mga08x19_181474_c1_258_956 232
368 iso_pu_bacteria 2842324504 2842331937 232
369 iso_pu_bacteria 2842348783 2842353783 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

34

186

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z86-assembly1.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.8221 1 189
2z87-assembly2.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.8018 4 189
5tzj-assembly1.cif.gz_C crystal structure of s. aureus tars 1-349 in complex with udp-glcnac 0.7995 5 189
2z87-assembly3.cif.gz_B crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.7992 4 189
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7872 3 189
ID Description Score Start End Superfamily
af_Q9RQP9_29_257_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8693 2 189 3.90.550.10
af_P37653_262_483_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8431 2 190 3.90.550.10
af_P75905_64_287_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8394 1 189 3.90.550.10
2z86A02 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8269 1 189 3.90.550.10
af_Q2FV58_23_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8131 1 173 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A538PJD8-F1-model_v4 Glycosyltransferase 0.9865 3 201 GO:0016757
AF-A0A1J5R0G8-F1-model_v4 Poly-beta-1,6-N-acetyl-D-glucosamine synthase (EC 2.4.1.-) 0.9842 1 232 GO:0016757
AF-A0A0F9Z383-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9815 3 227 GO:0016757
AF-A0A536VXT1-F1-model_v4 Glycosyltransferase 0.9814 3 225 GO:0016757
AF-A0A1J5R0G8-F1-model_v4 Poly-beta-1,6-N-acetyl-D-glucosamine synthase (EC 2.4.1.-) 0.98 1 232 GO:0016757

Feature Viewer

pLDDT pTM Quality
89.52 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map