F424693

General Info

Members Datasets Scaffolds Average Seq Length
368 237 337 235

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10204546|Ga0105237_102045462
Length 283
Sequence MCQQNNRFFDNPANIIRYIIPPYYKFYFAFTTGLRVYANFALSKERENMKIEIWSDVMCPFCYIGKRRFEDALQQSGHREQVEIEWKSFQLNPDIKTDPSININQYLADAKGWTLDYAAQLNDHVTQMAAEVGLTYNMDRAIVANSFNAHRFTHLAKKHGLGDAAEEALFKAYFTEGLNMDDNDTLIKLGTGIGLDAAEVKQVLESDVYADEVKYDIAQAQQLGIRGVPFFVMNNKYGVSGAQAVPVFLETIEKSFTEWQQENKKPSLTIIEGESCSPDGDCG

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
7 2818991444 Filimonas endophytica 3197 Isolate Unclassified
8 2818991459 Paenibacillus sp. 597 Isolate Unclassified
9 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
10 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
11 2842682962 Bacillus sp. R-72492 Isolate Unclassified
12 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
13 2849139964 Bacillus sp. R-71875 Isolate Unclassified
14 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
15 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
16 2857581216 Bacillus sp. R-71922 Isolate Unclassified
17 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
18 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
19 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
20 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
21 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
22 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
23 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
24 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
25 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
26 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
27 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
28 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
29 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
30 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
36 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
42 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
43 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
207 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
218 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
219 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
222 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
225 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
226 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
233 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
236 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
237 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.77
Metatranscriptomes 3.8
Isolates 8.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 14.67
Nodule 0
Rhizoplane 1.09
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10048678 3300001979 Bacteria 1230
2 JGI24739J22299_10009576 3300001989 Bacteria 3606
3 JGI24739J22299_10020055 3300001989 Bacteria 2389
4 JGI24737J22298_10002562 3300001990 Bacteria 6450
5 JGI24735J21928_10000168 3300002067 Bacteria 23435
6 JGI25162J39368_1000047 3300002737 Viruses 167507
7 JGI25162J39368_1000183 3300002737 Bacteria 67086
8 JGI25162J39368_1000354 3300002737 Bacteria 39303
9 JGI25164J39214_1002052 3300002772 Bacteria 3496
10 JGI25165J46597_1003847 3300003214 Bacteria 3496
11 rootH2_10023142 3300003320 Bacteria 8829
12 rootL2_10127154 3300003322 Bacteria 2054
13 rootL2_10159056 3300003322 Unclassified 1251
14 rootH1_10000536 3300003323 Bacteria 87102
15 rootH1_10047748 3300003323 Bacteria 6319
16 rootH1_10217645 3300003323 Bacteria 2256
17 Ga0055535_1006151 3300003761 Bacteria 2485
18 Ga0055542_1008724 3300003762 Bacteria 1962
19 Ga0065714_10066462 3300005288 Bacteria 6804
20 Ga0070676_10191785 3300005328 Bacteria 1335
21 Ga0070690_100020467 3300005330 Bacteria 4031
22 Ga0068869_100139491 3300005334 Bacteria 1871
23 Ga0070682_100470617 3300005337 Bacteria 967
24 Ga0070669_100066339 3300005353 Bacteria 2660
25 Ga0070671_100012478 3300005355 Bacteria 6841
26 Ga0070674_100061430 3300005356 Bacteria 2622
27 Ga0070674_100115589 3300005356 Bacteria 1978
28 Ga0070673_100041724 3300005364 Bacteria 3532
29 Ga0070659_100044353 3300005366 Bacteria 3481
30 Ga0068867_100013944 3300005459 Bacteria 5689
31 Ga0068867_100043982 3300005459 Unclassified 3271
32 Ga0068853_100355702 3300005539 Bacteria 1363
33 Ga0070665_100296981 3300005548 Bacteria 1618
34 Ga0068855_100000354 3300005563 Bacteria 56753
35 Ga0068855_100038551 3300005563 Bacteria 5678
36 Ga0068855_100100270 3300005563 Bacteria 3335
37 Ga0068855_100153710 3300005563 Bacteria 2615
38 Ga0068855_100567191 3300005563 Unclassified 1227
39 Ga0068857_100006130 3300005577 Bacteria 10273
40 Ga0068854_100153777 3300005578 Bacteria 1776
41 Ga0068856_100007355 3300005614 Bacteria 10749
42 Ga0068856_100015584 3300005614 Bacteria 7349
43 Ga0068863_100204936 3300005841 Bacteria 1898
44 Ga0068860_100150787 3300005843 Bacteria 2239
45 Ga0075366_10014186 3300006195 Bacteria 4549
46 Ga0075366_10116570 3300006195 Bacteria 1608
47 Ga0075366_10268503 3300006195 Bacteria 1042
48 Ga0068871_100185125 3300006358 Bacteria 1791
49 Ga0068871_100305516 3300006358 Bacteria 1397
50 Ga0068871_100754917 3300006358 Unclassified 894
51 Ga0105240_10004395 3300009093 Bacteria 21507
52 Ga0105240_10034396 3300009093 Bacteria 6536
53 Ga0105240_10100919 3300009093 Bacteria 3511
54 Ga0105240_10304684 3300009093 Bacteria 1821
55 Ga0114129_10000949 3300009147 Bacteria 37836
56 Ga0105241_10056410 3300009174 Bacteria 3011
57 Ga0105242_10499810 3300009176 Unclassified 1156
58 Ga0105237_10001669 3300009545 Bacteria 28718
59 Ga0105237_10005136 3300009545 Bacteria 14826
60 Ga0105237_10038975 3300009545 Bacteria 4798
61 Ga0105237_10204546 3300009545 Bacteria 1975
62 Ga0105237_10252817 3300009545 Bacteria 1764
63 Ga0105238_10159389 3300009551 Bacteria 2232
64 Ga0105249_10347273 3300009553 Unclassified 1502
65 Ga0105239_10000001 3300010375 Bacteria 617353
66 Ga0105239_10000009 3300010375 Bacteria 361182
67 Ga0105239_10000280 3300010375 Bacteria 75222
68 Ga0105239_10001876 3300010375 Bacteria 27527
69 Ga0105239_10445516 3300010375 Bacteria 1469
70 Ga0105239_11047379 3300010375 Bacteria 939
71 Ga0105246_10145232 3300011119 Bacteria 1789
72 Ga0157373_10000265 3300013100 Bacteria 42223
73 Ga0157373_10000677 3300013100 Bacteria 26683
74 Ga0157371_10001407 3300013102 Bacteria 25067
75 Ga0157371_10009488 3300013102 Bacteria 7654
76 Ga0157371_10187792 3300013102 Bacteria 1479
77 Ga0157371_10402572 3300013102 Bacteria 1002
78 Ga0157370_10091404 3300013104 Bacteria 2857
79 Ga0157370_10108385 3300013104 Bacteria 2597
80 Ga0157370_10443935 3300013104 Bacteria 1193
81 Ga0157369_10001726 3300013105 Bacteria 26600
82 Ga0157369_10067628 3300013105 Bacteria 3840
83 Ga0157369_10170383 3300013105 Bacteria 2294
84 Ga0157369_10447110 3300013105 Bacteria 1338
85 Ga0157374_10098377 3300013296 Bacteria 2801
86 Ga0157378_10002605 3300013297 Bacteria 16048
87 Ga0157378_10310912 3300013297 Bacteria 1528
88 Ga0163162_10194846 3300013306 Bacteria 2155
89 Ga0163162_10991542 3300013306 Bacteria 950
90 Ga0157372_10000071 3300013307 Bacteria 109638
91 Ga0157372_10000286 3300013307 Bacteria 56140
92 Ga0157372_10009804 3300013307 Bacteria 10187
93 Ga0157372_10015619 3300013307 Bacteria 8142
94 Ga0157372_10493151 3300013307 Bacteria 1428
95 Ga0157372_10494711 3300013307 Bacteria 1426
96 Ga0157372_10720265 3300013307 Bacteria 1161
97 Ga0157375_10026364 3300013308 Bacteria 5414
98 Ga0206351_10207955 3300020077 Bacteria 2380
99 Ga0206351_10226389 3300020077 Bacteria 1708
100 Ga0206350_10092879 3300020080 Bacteria 819
101 Ga0206350_10272693 3300020080 Bacteria 1075
102 Ga0209563_112543 3300025230 Bacteria 1155
103 Ga0207427_100025 3300025231 Bacteria 433726
104 Ga0209437_100010 3300025233 Bacteria 838447
105 Ga0209437_100089 3300025233 Bacteria 250476
106 Ga0209258_100036 3300025242 Bacteria 428859
107 Ga0209646_1001805 3300025246 Bacteria 5318
108 Ga0209148_1000139 3300025254 Bacteria 167011
109 Ga0209233_1000017 3300025261 Bacteria 898076
110 Ga0209233_1006629 3300025261 Bacteria 3717
111 Ga0209233_1044691 3300025261 Bacteria 936
112 Ga0209455_1004216 3300025272 Bacteria 4793
113 Ga0209455_1005188 3300025272 Bacteria 4082
114 Ga0209676_1000351 3300025292 Bacteria 87135
115 Ga0207688_10066846 3300025901 Bacteria 2034
116 Ga0207647_10000154 3300025904 Bacteria 54378
117 Ga0207647_10155494 3300025904 Bacteria 1335
118 Ga0207654_10005692 3300025911 Bacteria 6298
119 Ga0207695_10000019 3300025913 Bacteria 732137
120 Ga0207695_10046587 3300025913 Bacteria 4596
121 Ga0207695_10206208 3300025913 Bacteria 1878
122 Ga0207695_10264124 3300025913 Bacteria 1618
123 Ga0207695_10409156 3300025913 Bacteria 1241
124 Ga0207671_10001553 3300025914 Bacteria 26274
125 Ga0207671_10002497 3300025914 Bacteria 19633
126 Ga0207671_10004541 3300025914 Bacteria 13186
127 Ga0207671_10015286 3300025914 Bacteria 6022
128 Ga0207671_10021404 3300025914 Bacteria 4906
129 Ga0207681_10044287 3300025923 Bacteria 2982
130 Ga0207694_10117555 3300025924 Bacteria 2120
131 Ga0207644_10203295 3300025931 Bacteria 1563
132 Ga0207690_10015942 3300025932 Bacteria 4564
133 Ga0207686_10387682 3300025934 Bacteria 1061
134 Ga0207689_10063128 3300025942 Bacteria 3047
135 Ga0207667_10002952 3300025949 Bacteria 21103
136 Ga0207667_10040683 3300025949 Bacteria 4949
137 Ga0207667_10539895 3300025949 Unclassified 1180
138 Ga0207651_10029911 3300025960 Bacteria 3460
139 Ga0207640_10013937 3300025981 Bacteria 4616
140 Ga0207640_10204681 3300025981 Bacteria 1498
141 Ga0207640_10557319 3300025981 Bacteria 964
142 Ga0207639_10116351 3300026041 Bacteria 2189
143 Ga0207639_10220483 3300026041 Bacteria 1638
144 Ga0207702_10010674 3300026078 Bacteria 7674
145 Ga0207702_10015931 3300026078 Bacteria 6224
146 Ga0207641_10231168 3300026088 Bacteria 1719
147 Ga0207648_10075986 3300026089 Bacteria 2928
148 Ga0207648_10148184 3300026089 Bacteria 2070
149 Ga0207676_10200800 3300026095 Bacteria 1762
150 Ga0268266_10630186 3300028379 Bacteria 1031
151 Ga0268264_10034789 3300028381 Bacteria 4146
152 Ga0268264_10125752 3300028381 Bacteria 2265
153 Ga0265337_1003334 3300028556 Bacteria 7000
154 Ga0265326_10003302 3300028558 Bacteria 5315
155 Ga0265319_1000472 3300028563 Bacteria 28452
156 Ga0265334_10000987 3300028573 Bacteria 14101
157 Ga0265318_10004116 3300028577 Bacteria 7124
158 Ga0265322_10003102 3300028654 Bacteria 5062
159 Ga0265322_10004862 3300028654 Unclassified 3983
160 Ga0265322_10101369 3300028654 Bacteria 819
161 Ga0265336_10000072 3300028666 Bacteria 84279
162 Ga0307515_10000376 3300028794 Bacteria 109190
163 Ga0307515_10001287 3300028794 Bacteria 56974
164 Ga0265338_10000610 3300028800 Bacteria 62626
165 Ga0265338_10005582 3300028800 Bacteria 16364
166 Ga0265338_10018795 3300028800 Bacteria 7373
167 Ga0265338_10065692 3300028800 Bacteria 3145
168 Ga0265324_10000867 3300029957 Bacteria 19424
169 Ga0265324_10001358 3300029957 Bacteria 14245
170 Ga0316183_1211687 3300030742 Bacteria 37631
171 Ga0316181_1006235 3300030744 Bacteria 22254
172 Ga0265330_10098771 3300031235 Unclassified 1251
173 Ga0265332_10023316 3300031238 Unclassified 2729
174 Ga0265332_10090860 3300031238 Unclassified 1291
175 Ga0265320_10003439 3300031240 Bacteria 10647
176 Ga0265320_10008203 3300031240 Bacteria 6410
177 Ga0265325_10009747 3300031241 Bacteria 5598
178 Ga0265340_10088194 3300031247 Unclassified 1453
179 Ga0265339_10044990 3300031249 Unclassified 2432
180 Ga0265327_10026694 3300031251 Bacteria 3340
181 Ga0265316_10009111 3300031344 Bacteria 9142
182 Ga0265316_10033244 3300031344 Bacteria 4202
183 Ga0265316_10243512 3300031344 Bacteria 1322
184 Ga0265316_10661734 3300031344 Bacteria 738
185 Ga0307513_10476284 3300031456 Bacteria 969
186 Ga0307509_10074702 3300031507 Bacteria 3524
187 Ga0307509_10105669 3300031507 Bacteria 2836
188 Ga0307408_100002516 3300031548 Bacteria 12815
189 Ga0307408_100009248 3300031548 Bacteria 6495
190 Ga0265313_10000454 3300031595 Bacteria 43333
191 Ga0265314_10020368 3300031711 Bacteria 5121
192 Ga0265342_10021246 3300031712 Bacteria 4149
193 Ga0265342_10025312 3300031712 Bacteria 3734
194 Ga0307412_10001805 3300031911 Bacteria 11838
195 Ga0307416_100026301 3300032002 Bacteria 4286
196 Ga0307414_10089080 3300032004 Bacteria 2286
197 Ga0307507_10000894 3300033179 Bacteria 66220
198 Ga0395899_0000002 3300037312 Bacteria 1324310
199 Ga0395899_0000434 3300037312 Bacteria 48146
200 Ga0395899_0215361 3300037312 Bacteria 1333
201 Ga0395900_0096637 3300037418 Bacteria 3035
202 Ga0395905_0083365 3300037471 Bacteria 2995
203 Ga0395905_0202400 3300037471 Unclassified 1861
204 Ga0395905_0298906 3300037471 Bacteria 1497
205 Ga0395901_0000406 3300038443 Bacteria 51197
206 Ga0395901_0044834 3300038443 Bacteria 4587
207 Ga0395901_0289337 3300038443 Bacteria 1701
208 Ga0439436_0006859 3300041404 Bacteria 3499
209 Ga0439439_0000270 3300041406 Bacteria 8151
210 Ga0439439_0037912 3300041406 Unclassified 1243
211 Ga0439439_0052324 3300041406 Bacteria 1072
212 Ga0439439_0098578 3300041406 Unclassified 803
213 Ga0451789_1232303 3300041443 Bacteria 1260
214 Ga0451802_0482519 3300041460 Bacteria 1579
215 Ga0451849_0800626 3300041505 Bacteria 1176
216 Ga0451853_1963454 3300041512 Bacteria 896
217 Ga0451853_2929054 3300041512 Bacteria 2828
218 Ga0439449_0007473 3300042007 Bacteria 4153
219 Ga0439449_0037413 3300042007 Bacteria 1805
220 Ga0439457_001498 3300042014 Bacteria 7001
221 Ga0439462_0000325 3300042015 Bacteria 8914
222 Ga0439462_0003747 3300042015 Bacteria 3667
223 Ga0451577_0009135 3300042876 Bacteria 9565
224 Ga0466969_0000533 3300044656 Bacteria 20932
225 Ga0466972_0000032 3300044658 Bacteria 159445
226 Ga0466972_0003078 3300044658 Bacteria 8263
227 Ga0466972_0014019 3300044658 Bacteria 4019
228 Ga0453683_0021309 3300044673 Bacteria 4139
229 Ga0453683_0025166 3300044673 Bacteria 3782
230 Ga0466966_0060451 3300044684 Bacteria 2391
231 Ga0466961_0122258 3300044693 Bacteria 1634
232 Ga0466964_0143050 3300044706 Bacteria 1101
233 Ga0453684_0002477 3300044712 Bacteria 44621
234 Ga0453684_0021879 3300044712 Bacteria 9517
235 Ga0453684_0473294 3300044712 Bacteria 1391
236 Ga0466957_0005672 3300044842 Bacteria 7017
237 Ga0466957_0011333 3300044842 Bacteria 5141
238 Ga0466959_0000050 3300045049 Bacteria 83281
239 Ga0451576_0069270 3300045051 Bacteria 3671
240 Ga0466958_0091197 3300045836 Bacteria 1886
241 Ga0495627_003314 3300046453 Bacteria 7184
242 Ga0495627_026070 3300046453 Unclassified 1889
243 Ga0495641_0191786 3300046461 Bacteria 916
244 Ga0495650_0000198 3300046471 Bacteria 130455
245 Ga0495585_0000305 3300046492 Bacteria 48998
246 Ga0495585_0000354 3300046492 Bacteria 44420
247 Ga0495583_0044725 3300046506 Bacteria 2052
248 Ga0495606_0000003 3300046507 Bacteria 449402
249 Ga0495606_0012899 3300046507 Bacteria 6651
250 Ga0495610_0000845 3300046512 Bacteria 28519
251 Ga0495616_0006908 3300046513 Bacteria 6835
252 Ga0495616_0008466 3300046513 Bacteria 6093
253 Ga0495648_0015304 3300046524 Bacteria 5576
254 Ga0495648_0060900 3300046524 Bacteria 2243
255 Ga0495648_0177404 3300046524 Bacteria 1086
256 Ga0495652_0496212 3300046529 Bacteria 847
257 Ga0495609_0011194 3300046538 Bacteria 4280
258 Ga0495622_0051558 3300046557 Bacteria 1909
259 Ga0495633_0000019 3300046558 Bacteria 233769
260 Ga0495633_0000273 3300046558 Bacteria 60402
261 Ga0495633_0002488 3300046558 Bacteria 12989
262 Ga0495668_0000010 3300046616 Bacteria 487308
263 Ga0495668_0134563 3300046616 Bacteria 1353
264 Ga0495625_0000932 3300046660 Bacteria 39330
265 Ga0495625_0002022 3300046660 Bacteria 22834
266 Ga0495625_0020041 3300046660 Bacteria 5169
267 Ga0495625_0052706 3300046660 Bacteria 2912
268 Ga0495661_0003432 3300046665 Bacteria 11697
269 Ga0495661_0004275 3300046665 Bacteria 10378
270 Ga0495661_0065435 3300046665 Bacteria 2142
271 Ga0495649_0000951 3300046694 Bacteria 22848
272 Ga0495600_0046841 3300046809 Bacteria 2820
273 Ga0495687_069759 3300047443 Bacteria 1413
274 Ga0495687_070221 3300047443 Bacteria 1407
275 Ga0495686_0000283 3300047472 Bacteria 89298
276 Ga0495686_0001745 3300047472 Bacteria 22306
277 Ga0495686_0089110 3300047472 Bacteria 1875
278 Ga0495686_0154737 3300047472 Bacteria 1344
279 Ga0495686_0185298 3300047472 Bacteria 1203
280 Ga0495614_0016986 3300048089 Bacteria 3163
281 Ga0496110_0003777 3300048913 Bacteria 11663
282 Ga0496124_0054700 3300048927 Bacteria 3377
283 Ga0501306_001070 3300049127 Bacteria 2440
284 Ga0501306_001160 3300049127 Bacteria 2385
285 Ga0501305_001234 3300049161 Bacteria 2453
286 Ga0501305_036683 3300049161 Bacteria 785
287 Ga0495678_003071 3300049459 Bacteria 10596
288 Ga0501312_004998 3300049528 Bacteria 1590
289 Ga0501313_001196 3300049529 Bacteria 2166
290 Ga0501314_003047 3300049530 Bacteria 1333
291 Ga0501316_010819 3300049532 Bacteria 1043
292 Ga0501334_01982 3300049550 Bacteria 1182
293 Ga0501335_000526 3300049551 Bacteria 2501
294 Ga0501033_0315011 3300049570 Unclassified 1100
295 Ga0501034_0020055 3300049571 Bacteria 6828
296 Ga0501034_0220185 3300049571 Bacteria 1851
297 Ga0501040_0144159 3300049576 Bacteria 1678
298 Ga0501043_0158586 3300049579 Bacteria 1769
299 Ga0501043_0188631 3300049579 Bacteria 1604
300 Ga0501047_0145183 3300049581 Bacteria 2250
301 Ga0501223_000535 3300049663 Bacteria 9165
302 Ga0501238_012714 3300049671 Bacteria 1142
303 Ga0501257_040495 3300049686 Bacteria 1143
304 Ga0501225_0003088 3300049705 Bacteria 5087
305 Ga0501044_0129517 3300049823 Bacteria 2518
306 nmdc:mga0k408_169753_c1 3300050493 Bacteria 1300
307 nmdc:mga0k408_18364_c1 3300050493 Bacteria 3903
308 nmdc:mga0k408_185466_c1 3300050493 Bacteria 1241
309 Ga0500635_0001000 3300053080 Bacteria 6779
310 Ga0500578_0000001 3300053086 Bacteria 317120
311 Ga0500578_0166045 3300053086 Bacteria 1367
312 Ga0500578_0369421 3300053086 Bacteria 834
313 Ga0500644_0000332 3300053088 Bacteria 24138
314 Ga0500583_0000013 3300053092 Bacteria 150087
315 Ga0500583_0013370 3300053092 Bacteria 3173
316 Ga0500651_0022475 3300053093 Unclassified 3939
317 Ga0500650_0097248 3300053098 Bacteria 1378
318 Ga0500555_013666 3300053103 Bacteria 2343
319 Ga0500556_0033747 3300053104 Bacteria 1757
320 Ga0500569_000892 3300053109 Bacteria 5328
321 Ga0500594_0010534 3300053118 Bacteria 2148
322 Ga0500608_029980 3300053122 Bacteria 2576
323 Ga0500614_013841 3300053123 Bacteria 1778
324 Ga0500618_000127 3300053125 Bacteria 62903
325 Ga0500658_0006478 3300053134 Bacteria 4341
326 Ga0500561_0014948 3300053137 Bacteria 1713
327 Ga0500577_0202126 3300053142 Bacteria 857
328 Ga0500590_156139 3300053148 Bacteria 1023
329 Ga0500604_0008241 3300053151 Bacteria 2763
330 Ga0500616_0018085 3300053153 Bacteria 3988
331 Ga0500622_0151392 3300053156 Bacteria 1096
332 Ga0500624_000407 3300053157 Bacteria 13297
333 Ga0500633_0002014 3300053160 Bacteria 4057
334 Ga0500636_0011690 3300053177 Bacteria 5139
335 Ga0500636_0218181 3300053177 Bacteria 996
336 Ga0500637_0362308 3300053178 Bacteria 767
337 Ga0500611_000314 3300053727 Bacteria 5061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10000610 Ga0265338_1000061015 205
2 3300029957 Ga0265324_10001358 Ga0265324_1000135810 205
3 3300028654 Ga0265322_10101369 Ga0265322_101013691 209
4 3300028556 Ga0265337_1003334 Ga0265337_10033347 210
5 3300028558 Ga0265326_10003302 Ga0265326_100033024 210
6 3300028563 Ga0265319_1000472 Ga0265319_10004724 210
7 3300028573 Ga0265334_10000987 Ga0265334_100009877 210
8 3300028577 Ga0265318_10004116 Ga0265318_100041166 210
9 3300028654 Ga0265322_10003102 Ga0265322_100031024 210
10 3300028666 Ga0265336_10000072 Ga0265336_1000007242 210
11 3300028800 Ga0265338_10018795 Ga0265338_100187956 210
12 3300029957 Ga0265324_10000867 Ga0265324_100008674 210
13 3300031235 Ga0265330_10098771 Ga0265330_100987712 210
14 3300031238 Ga0265332_10090860 Ga0265332_100908601 210
15 3300031240 Ga0265320_10008203 Ga0265320_100082036 210
16 3300031241 Ga0265325_10009747 Ga0265325_100097472 210
17 3300031247 Ga0265340_10088194 Ga0265340_100881942 210
18 3300031249 Ga0265339_10044990 Ga0265339_100449902 210
19 3300031344 Ga0265316_10033244 Ga0265316_100332444 210
20 3300031344 Ga0265316_10661734 Ga0265316_106617341 210
21 3300031595 Ga0265313_10000454 Ga0265313_1000045429 210
22 3300031712 Ga0265342_10021246 Ga0265342_100212464 210
23 iso_pu_bacteria 2839989709 2839990932 210
24 3300038443 Ga0395901_0000406 Ga0395901_0000406_12349_12996 213
25 3300031344 Ga0265316_10243512 Ga0265316_102435122 214
26 3300031711 Ga0265314_10020368 Ga0265314_100203684 214
27 3300053088 Ga0500644_0000332 Ga0500644_0000332_3734_4390 214
28 3300053160 Ga0500633_0002014 Ga0500633_0002014_698_1354 214
29 3300044712 Ga0453684_0021879 Ga0453684_0021879_3335_4006 216
30 3300031712 Ga0265342_10025312 Ga0265342_100253122 217
31 3300028654 Ga0265322_10004862 Ga0265322_100048623 220
32 3300028800 Ga0265338_10005582 Ga0265338_100055825 220
33 3300031238 Ga0265332_10023316 Ga0265332_100233162 220
34 3300031240 Ga0265320_10003439 Ga0265320_100034397 220
35 3300031344 Ga0265316_10009111 Ga0265316_100091115 220
36 iso_pu_bacteria 2971410472 2971412793 221
37 iso_pu_bacteria 2671180330 2672337445 222
38 iso_pu_bacteria 2816332186 2816862141 222
39 iso_pu_bacteria 2842682962 2842684947 222
40 iso_pu_bacteria 2849139964 2849141505 222
41 iso_pu_bacteria 2857453340 2857459678 222
42 iso_pu_bacteria 2857581216 2857584072 222
43 iso_pu_bacteria 2984527788 2984530008 222
44 iso_pu_bacteria 2984532647 2984536113 222
45 iso_pu_bacteria 8056533031 8056534894 222
46 iso_pu_bacteria 2911138879 2911139147 223
47 iso_pu_bacteria 2884933994 2884935830 224
48 3300046665 Ga0495661_0003432 Ga0495661_0003432_4921_5610 225
49 3300046665 Ga0495661_0065435 Ga0495661_0065435_277_966 225
50 iso_pu_bacteria 2818991459 2819673238 225
51 iso_pu_bacteria 2852623160 2852626993 225
52 3300013100 Ga0157373_10000265 Ga0157373_1000026538 226
53 3300013307 Ga0157372_10009804 Ga0157372_100098048 226
54 3300031251 Ga0265327_10026694 Ga0265327_100266943 226
55 3300032002 Ga0307416_100026301 Ga0307416_1000263012 226
56 3300037312 Ga0395899_0215361 Ga0395899_0215361_23_724 226
57 3300038443 Ga0395901_0044834 Ga0395901_0044834_1299_2000 226
58 3300041406 Ga0439439_0000270 Ga0439439_0000270_2570_3289 226
59 3300042015 Ga0439462_0000325 Ga0439462_0000325_934_1653 226
60 3300048913 Ga0496110_0003777 Ga0496110_0003777_9077_9787 226
61 3300049161 Ga0501305_036683 Ga0501305_036683_62_772 226
62 iso_pu_bacteria 2522125168 2522548256 226
63 iso_pu_bacteria 2524023129 2524190706 226
64 iso_pu_bacteria 2738541278 2738728769 226
65 iso_pu_bacteria 2818991444 2819585790 226
66 iso_pu_bacteria 2818991460 2819678089 226
67 iso_pu_bacteria 2884791551 2884792933 226
68 iso_pu_bacteria 2919437846 2919442672 226
69 iso_pu_bacteria 2945977869 2945983608 226
70 iso_pu_bacteria 2946013367 2946017004 226
71 iso_pu_bacteria 2977232053 2977233578 226
72 3300005356 Ga0070674_100115589 Ga0070674_1001155892 227
73 3300013307 Ga0157372_10493151 Ga0157372_104931512 227
74 3300031548 Ga0307408_100002516 Ga0307408_1000025167 227
75 3300037418 Ga0395900_0096637 Ga0395900_0096637_792_1487 227
76 3300037471 Ga0395905_0083365 Ga0395905_0083365_980_1675 227
77 3300046507 Ga0495606_0012899 Ga0495606_0012899_3593_4288 227
78 iso_pu_bacteria 2599185184 2599479041 227
79 iso_pu_bacteria 2928078545 2928082648 227
80 iso_pu_bacteria 2928147474 2928148769 227
81 iso_pu_bacteria 2932082852 2932086435 227
82 3300013307 Ga0157372_10015619 Ga0157372_100156195 228
83 3300020077 Ga0206351_10226389 Ga0206351_102263893 228
84 iso_pu_bacteria 2929239360 2929244146 228
85 3300005563 Ga0068855_100567191 Ga0068855_1005671912 229
86 3300005614 Ga0068856_100015584 Ga0068856_1000155847 229
87 3300025261 Ga0209233_1044691 Ga0209233_10446912 229
88 3300025949 Ga0207667_10539895 Ga0207667_105398952 229
89 3300026078 Ga0207702_10015931 Ga0207702_100159311 229
90 3300028800 Ga0265338_10065692 Ga0265338_100656922 229
91 3300037471 Ga0395905_0202400 Ga0395905_0202400_336_1052 229
92 3300047472 Ga0495686_0000283 Ga0495686_0000283_65981_66685 229
93 3300047472 Ga0495686_0089110 Ga0495686_0089110_342_1046 229
94 3300001979 JGI24740J21852_10048678 JGI24740J21852_100486782 230
95 3300001989 JGI24739J22299_10009576 JGI24739J22299_100095763 230
96 3300001989 JGI24739J22299_10020055 JGI24739J22299_100200552 230
97 3300001990 JGI24737J22298_10002562 JGI24737J22298_100025626 230
98 3300002067 JGI24735J21928_10000168 JGI24735J21928_1000016811 230
99 3300002737 JGI25162J39368_1000047 JGI25162J39368_100004714 230
100 3300002737 JGI25162J39368_1000183 JGI25162J39368_100018319 230
101 3300002737 JGI25162J39368_1000354 JGI25162J39368_10003543 230
102 3300002772 JGI25164J39214_1002052 JGI25164J39214_10020523 230
103 3300003214 JGI25165J46597_1003847 JGI25165J46597_10038472 230
104 3300003320 rootH2_10023142 rootH2_100231426 230
105 3300003322 rootL2_10127154 rootL2_101271542 230
106 3300003322 rootL2_10159056 rootL2_101590562 230
107 3300003323 rootH1_10000536 rootH1_1000053640 230
108 3300003323 rootH1_10047748 rootH1_100477484 230
109 3300003323 rootH1_10217645 rootH1_102176453 230
110 3300003761 Ga0055535_1006151 Ga0055535_10061512 230
111 3300003762 Ga0055542_1008724 Ga0055542_10087243 230
112 3300005288 Ga0065714_10066462 Ga0065714_100664626 230
113 3300005328 Ga0070676_10191785 Ga0070676_101917852 230
114 3300005330 Ga0070690_100020467 Ga0070690_1000204676 230
115 3300005334 Ga0068869_100139491 Ga0068869_1001394912 230
116 3300005337 Ga0070682_100470617 Ga0070682_1004706172 230
117 3300005353 Ga0070669_100066339 Ga0070669_1000663393 230
118 3300005355 Ga0070671_100012478 Ga0070671_10001247810 230
119 3300005356 Ga0070674_100061430 Ga0070674_1000614304 230
120 3300005364 Ga0070673_100041724 Ga0070673_1000417243 230
121 3300005366 Ga0070659_100044353 Ga0070659_1000443533 230
122 3300005459 Ga0068867_100013944 Ga0068867_1000139447 230
123 3300005459 Ga0068867_100043982 Ga0068867_1000439823 230
124 3300005539 Ga0068853_100355702 Ga0068853_1003557021 230
125 3300005548 Ga0070665_100296981 Ga0070665_1002969813 230
126 3300005563 Ga0068855_100000354 Ga0068855_10000035412 230
127 3300005563 Ga0068855_100038551 Ga0068855_1000385515 230
128 3300005563 Ga0068855_100100270 Ga0068855_1001002702 230
129 3300005563 Ga0068855_100153710 Ga0068855_1001537101 230
130 3300005577 Ga0068857_100006130 Ga0068857_10000613013 230
131 3300005578 Ga0068854_100153777 Ga0068854_1001537772 230
132 3300005614 Ga0068856_100007355 Ga0068856_1000073554 230
133 3300005841 Ga0068863_100204936 Ga0068863_1002049363 230
134 3300005843 Ga0068860_100150787 Ga0068860_1001507872 230
135 3300006195 Ga0075366_10014186 Ga0075366_100141863 230
136 3300006195 Ga0075366_10116570 Ga0075366_101165702 230
137 3300006195 Ga0075366_10268503 Ga0075366_102685032 230
138 3300006358 Ga0068871_100185125 Ga0068871_1001851253 230
139 3300006358 Ga0068871_100305516 Ga0068871_1003055161 230
140 3300006358 Ga0068871_100754917 Ga0068871_1007549171 230
141 3300009093 Ga0105240_10004395 Ga0105240_1000439523 230
142 3300009093 Ga0105240_10034396 Ga0105240_100343967 230
143 3300009093 Ga0105240_10100919 Ga0105240_101009194 230
144 3300009093 Ga0105240_10304684 Ga0105240_103046842 230
145 3300009147 Ga0114129_10000949 Ga0114129_100009499 230
146 3300009174 Ga0105241_10056410 Ga0105241_100564102 230
147 3300009176 Ga0105242_10499810 Ga0105242_104998102 230
148 3300009545 Ga0105237_10001669 Ga0105237_1000166924 230
149 3300009545 Ga0105237_10005136 Ga0105237_1000513613 230
150 3300009545 Ga0105237_10038975 Ga0105237_100389754 230
151 3300009545 Ga0105237_10204546 Ga0105237_102045462 230
152 3300009545 Ga0105237_10252817 Ga0105237_102528172 230
153 3300009551 Ga0105238_10159389 Ga0105238_101593891 230
154 3300009553 Ga0105249_10347273 Ga0105249_103472732 230
155 3300010375 Ga0105239_10000001 Ga0105239_10000001136 230
156 3300010375 Ga0105239_10000009 Ga0105239_10000009213 230
157 3300010375 Ga0105239_10000280 Ga0105239_1000028032 230
158 3300010375 Ga0105239_10001876 Ga0105239_1000187614 230
159 3300010375 Ga0105239_10445516 Ga0105239_104455162 230
160 3300010375 Ga0105239_11047379 Ga0105239_110473792 230
161 3300011119 Ga0105246_10145232 Ga0105246_101452322 230
162 3300013100 Ga0157373_10000677 Ga0157373_1000067718 230
163 3300013102 Ga0157371_10001407 Ga0157371_100014072 230
164 3300013102 Ga0157371_10009488 Ga0157371_100094884 230
165 3300013102 Ga0157371_10187792 Ga0157371_101877922 230
166 3300013102 Ga0157371_10402572 Ga0157371_104025721 230
167 3300013104 Ga0157370_10091404 Ga0157370_100914042 230
168 3300013104 Ga0157370_10108385 Ga0157370_101083853 230
169 3300013104 Ga0157370_10443935 Ga0157370_104439351 230
170 3300013105 Ga0157369_10001726 Ga0157369_1000172613 230
171 3300013105 Ga0157369_10067628 Ga0157369_100676282 230
172 3300013105 Ga0157369_10170383 Ga0157369_101703832 230
173 3300013105 Ga0157369_10447110 Ga0157369_104471102 230
174 3300013296 Ga0157374_10098377 Ga0157374_100983773 230
175 3300013297 Ga0157378_10002605 Ga0157378_100026056 230
176 3300013297 Ga0157378_10310912 Ga0157378_103109122 230
177 3300013306 Ga0163162_10194846 Ga0163162_101948462 230
178 3300013306 Ga0163162_10991542 Ga0163162_109915422 230
179 3300013307 Ga0157372_10000071 Ga0157372_1000007195 230
180 3300013307 Ga0157372_10000286 Ga0157372_1000028645 230
181 3300013307 Ga0157372_10494711 Ga0157372_104947111 230
182 3300013307 Ga0157372_10720265 Ga0157372_107202652 230
183 3300013308 Ga0157375_10026364 Ga0157375_100263643 230
184 3300020077 Ga0206351_10207955 Ga0206351_102079552 230
185 3300020080 Ga0206350_10092879 Ga0206350_100928791 230
186 3300020080 Ga0206350_10272693 Ga0206350_102726931 230
187 3300025230 Ga0209563_112543 Ga0209563_1125432 230
188 3300025231 Ga0207427_100025 Ga0207427_100025294 230
189 3300025233 Ga0209437_100010 Ga0209437_100010556 230
190 3300025233 Ga0209437_100089 Ga0209437_10008984 230
191 3300025242 Ga0209258_100036 Ga0209258_100036282 230
192 3300025246 Ga0209646_1001805 Ga0209646_10018056 230
193 3300025254 Ga0209148_1000139 Ga0209148_100013914 230
194 3300025261 Ga0209233_1000017 Ga0209233_1000017569 230
195 3300025261 Ga0209233_1006629 Ga0209233_10066292 230
196 3300025272 Ga0209455_1004216 Ga0209455_10042165 230
197 3300025272 Ga0209455_1005188 Ga0209455_10051883 230
198 3300025292 Ga0209676_1000351 Ga0209676_100035142 230
199 3300025901 Ga0207688_10066846 Ga0207688_100668462 230
200 3300025904 Ga0207647_10000154 Ga0207647_1000015419 230
201 3300025904 Ga0207647_10155494 Ga0207647_101554942 230
202 3300025911 Ga0207654_10005692 Ga0207654_100056926 230
203 3300025913 Ga0207695_10000019 Ga0207695_10000019588 230
204 3300025913 Ga0207695_10046587 Ga0207695_100465873 230
205 3300025913 Ga0207695_10206208 Ga0207695_102062082 230
206 3300025913 Ga0207695_10264124 Ga0207695_102641242 230
207 3300025913 Ga0207695_10409156 Ga0207695_104091562 230
208 3300025914 Ga0207671_10001553 Ga0207671_100015537 230
209 3300025914 Ga0207671_10002497 Ga0207671_1000249720 230
210 3300025914 Ga0207671_10004541 Ga0207671_1000454110 230
211 3300025914 Ga0207671_10015286 Ga0207671_100152862 230
212 3300025914 Ga0207671_10021404 Ga0207671_100214043 230
213 3300025923 Ga0207681_10044287 Ga0207681_100442873 230
214 3300025924 Ga0207694_10117555 Ga0207694_101175552 230
215 3300025931 Ga0207644_10203295 Ga0207644_102032952 230
216 3300025932 Ga0207690_10015942 Ga0207690_100159423 230
217 3300025934 Ga0207686_10387682 Ga0207686_103876821 230
218 3300025942 Ga0207689_10063128 Ga0207689_100631283 230
219 3300025949 Ga0207667_10002952 Ga0207667_1000295212 230
220 3300025949 Ga0207667_10040683 Ga0207667_100406833 230
221 3300025960 Ga0207651_10029911 Ga0207651_100299113 230
222 3300025981 Ga0207640_10013937 Ga0207640_100139375 230
223 3300025981 Ga0207640_10204681 Ga0207640_102046812 230
224 3300025981 Ga0207640_10557319 Ga0207640_105573191 230
225 3300026041 Ga0207639_10116351 Ga0207639_101163513 230
226 3300026041 Ga0207639_10220483 Ga0207639_102204832 230
227 3300026078 Ga0207702_10010674 Ga0207702_1001067410 230
228 3300026088 Ga0207641_10231168 Ga0207641_102311682 230
229 3300026089 Ga0207648_10075986 Ga0207648_100759862 230
230 3300026089 Ga0207648_10148184 Ga0207648_101481842 230
231 3300026095 Ga0207676_10200800 Ga0207676_102008002 230
232 3300028379 Ga0268266_10630186 Ga0268266_106301861 230
233 3300028381 Ga0268264_10034789 Ga0268264_100347893 230
234 3300028381 Ga0268264_10125752 Ga0268264_101257522 230
235 3300028794 Ga0307515_10000376 Ga0307515_1000037642 230
236 3300028794 Ga0307515_10001287 Ga0307515_1000128722 230
237 3300030742 Ga0316183_1211687 Ga0316183_121168731 230
238 3300030744 Ga0316181_1006235 Ga0316181_100623510 230
239 3300031456 Ga0307513_10476284 Ga0307513_104762841 230
240 3300031507 Ga0307509_10074702 Ga0307509_100747025 230
241 3300031507 Ga0307509_10105669 Ga0307509_101056695 230
242 3300031548 Ga0307408_100009248 Ga0307408_1000092482 230
243 3300031911 Ga0307412_10001805 Ga0307412_100018052 230
244 3300032004 Ga0307414_10089080 Ga0307414_100890802 230
245 3300033179 Ga0307507_10000894 Ga0307507_1000089426 230
246 3300037312 Ga0395899_0000002 Ga0395899_0000002_460384_461088 230
247 3300037312 Ga0395899_0000434 Ga0395899_0000434_18591_19283 230
248 3300037471 Ga0395905_0298906 Ga0395905_0298906_75_779 230
249 3300038443 Ga0395901_0289337 Ga0395901_0289337_78_770 230
250 3300041404 Ga0439436_0006859 Ga0439436_0006859_194_895 230
251 3300041406 Ga0439439_0037912 Ga0439439_0037912_450_1172 230
252 3300041406 Ga0439439_0052324 Ga0439439_0052324_171_872 230
253 3300041406 Ga0439439_0098578 Ga0439439_0098578_38_739 230
254 3300041443 Ga0451789_1232303 Ga0451789_1232303_437_1141 230
255 3300041460 Ga0451802_0482519 Ga0451802_0482519_474_1175 230
256 3300041505 Ga0451849_0800626 Ga0451849_0800626_129_830 230
257 3300041512 Ga0451853_1963454 Ga0451853_1963454_111_812 230
258 3300041512 Ga0451853_2929054 Ga0451853_2929054_1883_2584 230
259 3300042007 Ga0439449_0007473 Ga0439449_0007473_1569_2270 230
260 3300042007 Ga0439449_0037413 Ga0439449_0037413_871_1593 230
261 3300042014 Ga0439457_001498 Ga0439457_001498_3947_4648 230
262 3300042015 Ga0439462_0003747 Ga0439462_0003747_1785_2486 230
263 3300042876 Ga0451577_0009135 Ga0451577_0009135_6440_7156 230
264 3300044656 Ga0466969_0000533 Ga0466969_0000533_8044_8745 230
265 3300044658 Ga0466972_0000032 Ga0466972_0000032_4683_5384 230
266 3300044658 Ga0466972_0003078 Ga0466972_0003078_4664_5365 230
267 3300044658 Ga0466972_0014019 Ga0466972_0014019_808_1518 230
268 3300044673 Ga0453683_0021309 Ga0453683_0021309_2531_3256 230
269 3300044673 Ga0453683_0025166 Ga0453683_0025166_40_756 230
270 3300044684 Ga0466966_0060451 Ga0466966_0060451_1505_2206 230
271 3300044693 Ga0466961_0122258 Ga0466961_0122258_459_1151 230
272 3300044706 Ga0466964_0143050 Ga0466964_0143050_132_833 230
273 3300044712 Ga0453684_0002477 Ga0453684_0002477_20272_20988 230
274 3300044712 Ga0453684_0473294 Ga0453684_0473294_398_1105 230
275 3300044842 Ga0466957_0005672 Ga0466957_0005672_5682_6515 230
276 3300044842 Ga0466957_0011333 Ga0466957_0011333_2672_3373 230
277 3300045049 Ga0466959_0000050 Ga0466959_0000050_18940_19641 230
278 3300045051 Ga0451576_0069270 Ga0451576_0069270_2543_3268 230
279 3300045836 Ga0466958_0091197 Ga0466958_0091197_333_1025 230
280 3300046453 Ga0495627_003314 Ga0495627_003314_4104_4808 230
281 3300046453 Ga0495627_026070 Ga0495627_026070_860_1582 230
282 3300046461 Ga0495641_0191786 Ga0495641_0191786_133_843 230
283 3300046471 Ga0495650_0000198 Ga0495650_0000198_79541_80251 230
284 3300046492 Ga0495585_0000305 Ga0495585_0000305_44505_45215 230
285 3300046492 Ga0495585_0000354 Ga0495585_0000354_2511_3218 230
286 3300046506 Ga0495583_0044725 Ga0495583_0044725_237_947 230
287 3300046507 Ga0495606_0000003 Ga0495606_0000003_58233_58940 230
288 3300046512 Ga0495610_0000845 Ga0495610_0000845_3602_4309 230
289 3300046513 Ga0495616_0006908 Ga0495616_0006908_4146_4856 230
290 3300046513 Ga0495616_0008466 Ga0495616_0008466_3638_4345 230
291 3300046524 Ga0495648_0015304 Ga0495648_0015304_3507_4217 230
292 3300046524 Ga0495648_0060900 Ga0495648_0060900_100_810 230
293 3300046524 Ga0495648_0177404 Ga0495648_0177404_146_853 230
294 3300046529 Ga0495652_0496212 Ga0495652_0496212_89_796 230
295 3300046538 Ga0495609_0011194 Ga0495609_0011194_3511_4221 230
296 3300046557 Ga0495622_0051558 Ga0495622_0051558_496_1206 230
297 3300046558 Ga0495633_0000019 Ga0495633_0000019_85530_86252 230
298 3300046558 Ga0495633_0000273 Ga0495633_0000273_52544_53302 230
299 3300046558 Ga0495633_0002488 Ga0495633_0002488_10899_11606 230
300 3300046616 Ga0495668_0000010 Ga0495668_0000010_314016_314726 230
301 3300046616 Ga0495668_0134563 Ga0495668_0134563_380_1087 230
302 3300046660 Ga0495625_0000932 Ga0495625_0000932_35033_35743 230
303 3300046660 Ga0495625_0002022 Ga0495625_0002022_1966_2676 230
304 3300046660 Ga0495625_0020041 Ga0495625_0020041_3420_4127 230
305 3300046660 Ga0495625_0052706 Ga0495625_0052706_523_1230 230
306 3300046665 Ga0495661_0004275 Ga0495661_0004275_8837_9547 230
307 3300046694 Ga0495649_0000951 Ga0495649_0000951_20159_20869 230
308 3300046809 Ga0495600_0046841 Ga0495600_0046841_331_1041 230
309 3300047443 Ga0495687_069759 Ga0495687_069759_59_769 230
310 3300047443 Ga0495687_070221 Ga0495687_070221_639_1349 230
311 3300047472 Ga0495686_0001745 Ga0495686_0001745_9294_9998 230
312 3300047472 Ga0495686_0154737 Ga0495686_0154737_353_1057 230
313 3300047472 Ga0495686_0185298 Ga0495686_0185298_266_973 230
314 3300048089 Ga0495614_0016986 Ga0495614_0016986_697_1407 230
315 3300048927 Ga0496124_0054700 Ga0496124_0054700_339_1046 230
316 3300049127 Ga0501306_001070 Ga0501306_001070_381_1085 230
317 3300049127 Ga0501306_001160 Ga0501306_001160_1214_1915 230
318 3300049161 Ga0501305_001234 Ga0501305_001234_406_1110 230
319 3300049459 Ga0495678_003071 Ga0495678_003071_6422_7129 230
320 3300049528 Ga0501312_004998 Ga0501312_004998_269_973 230
321 3300049529 Ga0501313_001196 Ga0501313_001196_469_1173 230
322 3300049530 Ga0501314_003047 Ga0501314_003047_414_1118 230
323 3300049532 Ga0501316_010819 Ga0501316_010819_128_832 230
324 3300049550 Ga0501334_01982 Ga0501334_01982_47_754 230
325 3300049551 Ga0501335_000526 Ga0501335_000526_1339_2043 230
326 3300049570 Ga0501033_0315011 Ga0501033_0315011_134_838 230
327 3300049571 Ga0501034_0020055 Ga0501034_0020055_5149_5853 230
328 3300049571 Ga0501034_0220185 Ga0501034_0220185_53_754 230
329 3300049576 Ga0501040_0144159 Ga0501040_0144159_943_1647 230
330 3300049579 Ga0501043_0158586 Ga0501043_0158586_743_1444 230
331 3300049579 Ga0501043_0188631 Ga0501043_0188631_518_1222 230
332 3300049581 Ga0501047_0145183 Ga0501047_0145183_509_1210 230
333 3300049663 Ga0501223_000535 Ga0501223_000535_6742_7464 230
334 3300049671 Ga0501238_012714 Ga0501238_012714_363_1070 230
335 3300049686 Ga0501257_040495 Ga0501257_040495_316_1020 230
336 3300049705 Ga0501225_0003088 Ga0501225_0003088_2306_3007 230
337 3300049823 Ga0501044_0129517 Ga0501044_0129517_572_1273 230
338 3300050493 nmdc:mga0k408_169753_c1 nmdc:mga0k408_169753_c1_416_1117 230
339 3300050493 nmdc:mga0k408_18364_c1 nmdc:mga0k408_18364_c1_210_911 230
340 3300050493 nmdc:mga0k408_185466_c1 nmdc:mga0k408_185466_c1_42_743 230
341 3300053080 Ga0500635_0001000 Ga0500635_0001000_5030_5731 230
342 3300053086 Ga0500578_0000001 Ga0500578_0000001_177721_178422 230
343 3300053086 Ga0500578_0166045 Ga0500578_0166045_71_772 230
344 3300053086 Ga0500578_0369421 Ga0500578_0369421_34_735 230
345 3300053092 Ga0500583_0000013 Ga0500583_0000013_68526_69227 230
346 3300053092 Ga0500583_0013370 Ga0500583_0013370_12_725 230
347 3300053093 Ga0500651_0022475 Ga0500651_0022475_980_1702 230
348 3300053098 Ga0500650_0097248 Ga0500650_0097248_72_773 230
349 3300053103 Ga0500555_013666 Ga0500555_013666_1017_1718 230
350 3300053104 Ga0500556_0033747 Ga0500556_0033747_638_1339 230
351 3300053109 Ga0500569_000892 Ga0500569_000892_3340_4074 230
352 3300053118 Ga0500594_0010534 Ga0500594_0010534_291_992 230
353 3300053122 Ga0500608_029980 Ga0500608_029980_754_1461 230
354 3300053123 Ga0500614_013841 Ga0500614_013841_347_1057 230
355 3300053125 Ga0500618_000127 Ga0500618_000127_18212_18919 230
356 3300053134 Ga0500658_0006478 Ga0500658_0006478_697_1431 230
357 3300053137 Ga0500561_0014948 Ga0500561_0014948_665_1375 230
358 3300053142 Ga0500577_0202126 Ga0500577_0202126_15_728 230
359 3300053148 Ga0500590_156139 Ga0500590_156139_10_711 230
360 3300053151 Ga0500604_0008241 Ga0500604_0008241_1744_2445 230
361 3300053153 Ga0500616_0018085 Ga0500616_0018085_1520_2254 230
362 3300053156 Ga0500622_0151392 Ga0500622_0151392_44_745 230
363 3300053157 Ga0500624_000407 Ga0500624_000407_4022_4729 230
364 3300053177 Ga0500636_0011690 Ga0500636_0011690_4304_5020 230
365 3300053177 Ga0500636_0218181 Ga0500636_0218181_66_767 230
366 3300053178 Ga0500637_0362308 Ga0500637_0362308_39_740 230
367 3300053727 Ga0500611_000314 Ga0500611_000314_3746_4447 230
368 iso_pu_bacteria 2842903701 2842904691 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

50

253

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xwh-assembly1.cif.gz_A structure of frne, a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in the presence of gsh 0.9278 2 225
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.9258 2 225
5xwh-assembly1.cif.gz_A structure of frne, a novel disulfide oxidoreductase from deinococcus radiodurans crystallized in the presence of gsh 0.9079 2 225
5cnw-assembly1.cif.gz_A crystal structure of a novel disulfide oxidoreductase from deinococcus radiodurans 0.902 2 225
5y1a-assembly1.cif.gz_A hbp35 of porphyromonas gingivalis 0.9015 2 41
ID Description Score Start End Superfamily
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9788 2 206 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9558 2 206 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9132 1 207 3.40.30.10
3gl5A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9049 1 207 3.40.30.10
af_I1KWJ3_9_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8902 2 206 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Y8SHE3-F1-model_v4 DsbA family oxidoreductase 0.9991 1 214 GO:0016491
AF-A0A521G9U2-F1-model_v4 DsbA family oxidoreductase 0.9963 1 209 GO:0016491
AF-A0A0P0NH03-F1-model_v4 Disulfide bond formation protein DsbA 0.9947 1 210 GO:0016491
AF-A0A4Y8SHE3-F1-model_v4 DsbA family oxidoreductase 0.9944 1 214 GO:0016491
AF-A0A2T5JEQ9-F1-model_v4 Putative DsbA family dithiol-disulfide isomerase 0.9943 2 209 GO:0016491
GO:0016853

Feature Viewer

pLDDT pTM Quality
92.98 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map