F424437

General Info

Members Datasets Scaffolds Average Seq Length
367 207 734 273

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0032008|Ga0466959_0032008_1051_1911
Length 286
Sequence MKVAALQMTSGPDVAANLRQAEPLLEDAAARGASLAALPENFAFMGLHDADKRAVAESDGDGPIQDFLASSALRLHMTVVGGTVPLRAGADGRVAAASLVYGPDGRRLARYDKIHLFDVDIPGRANTAGANAERYRESAHVAPGSQAAVVDTPVGRLGLSVCYDVRFPELFRALSASGAQLLTIPSAFTGPTGRAHWETLLRARAIENLCYVIAPAQSGFHPSGRETYGDTMIVDYWGRVLQRLPRGRGCVVADIDLEAQAEVRNNFPALQHRAFGATVPVQPKID

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
201 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 5.45
Rhizosphere 81.74
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0032008 3300045049 Bacteria 3892
2 Ga0058862_12287919 3300004803 Bacteria 2387
3 Ga0065707_10084801 3300005295 Bacteria 6768
4 Ga0070683_100053916 3300005329 Bacteria 3727
5 Ga0070690_100002892 3300005330 Bacteria 9260
6 Ga0070666_10001276 3300005335 Bacteria 15248
7 Ga0070680_100008924 3300005336 Bacteria 7689
8 Ga0070680_100051417 3300005336 Bacteria 3362
9 Ga0070680_100054694 3300005336 Bacteria 3260
10 Ga0068868_100103918 3300005338 Bacteria 2302
11 Ga0070660_100141540 3300005339 Bacteria 1930
12 Ga0070671_100003643 3300005355 Bacteria 12065
13 Ga0070671_100007529 3300005355 Bacteria 8708
14 Ga0070673_100011065 3300005364 Bacteria 6147
15 Ga0070667_100007800 3300005367 Bacteria 8875
16 Ga0070667_100013317 3300005367 Bacteria 6794
17 Ga0070709_10002317 3300005434 Bacteria 10326
18 Ga0070713_100014784 3300005436 Bacteria 5809
19 Ga0070713_100048038 3300005436 Bacteria 3512
20 Ga0070713_100060186 3300005436 Bacteria 3174
21 Ga0070713_100063530 3300005436 Bacteria 3096
22 Ga0070710_10047797 3300005437 Bacteria 2388
23 Ga0070711_100046387 3300005439 Bacteria 2960
24 Ga0070663_100046875 3300005455 Bacteria 3060
25 Ga0070678_100002790 3300005456 Bacteria 9651
26 Ga0070681_10009789 3300005458 Bacteria 9434
27 Ga0070681_10035688 3300005458 Bacteria 4993
28 Ga0070681_10035992 3300005458 Bacteria 4973
29 Ga0070681_10066958 3300005458 Bacteria 3560
30 Ga0070681_10071592 3300005458 Bacteria 3431
31 Ga0070681_10090166 3300005458 Bacteria 3016
32 Ga0070681_10176705 3300005458 Bacteria 2057
33 Ga0070699_100129436 3300005518 Bacteria 2225
34 Ga0070679_100000534 3300005530 Bacteria 32328
35 Ga0070679_100150980 3300005530 Bacteria 2300
36 Ga0070679_100239043 3300005530 Bacteria 1774
37 Ga0070684_100257296 3300005535 Bacteria 1596
38 Ga0070672_100223691 3300005543 Bacteria 1579
39 Ga0070695_100068401 3300005545 Bacteria 2319
40 Ga0070665_100001700 3300005548 Bacteria 25288
41 Ga0070665_100009634 3300005548 Bacteria 9770
42 Ga0070665_100016429 3300005548 Bacteria 7422
43 Ga0070665_100021569 3300005548 Bacteria 6476
44 Ga0068855_100036973 3300005563 Bacteria 5809
45 Ga0068855_100127358 3300005563 Bacteria 2910
46 Ga0068855_100200228 3300005563 Bacteria 2248
47 Ga0068856_100310065 3300005614 Bacteria 1596
48 Ga0068852_100058616 3300005616 Bacteria 3336
49 Ga0068859_100001039 3300005617 Bacteria 28434
50 Ga0068859_100139097 3300005617 Bacteria 2502
51 Ga0068859_100189295 3300005617 Bacteria 2142
52 Ga0068864_100037600 3300005618 Bacteria 4132
53 Ga0068866_10038909 3300005718 Bacteria 2345
54 Ga0068861_100191506 3300005719 Bacteria 1710
55 Ga0068863_100008891 3300005841 Bacteria 9808
56 Ga0068863_100014447 3300005841 Bacteria 7605
57 Ga0068863_100017277 3300005841 Bacteria 6920
58 Ga0068858_100000125 3300005842 Bacteria 79795
59 Ga0068858_100013756 3300005842 Bacteria 7639
60 Ga0068858_100046875 3300005842 Bacteria 4007
61 Ga0068860_100001229 3300005843 Bacteria 27945
62 Ga0068860_100005076 3300005843 Bacteria 13390
63 Ga0068860_100068315 3300005843 Bacteria 3376
64 Ga0081455_10001331 3300005937 Bacteria 30542
65 Ga0081539_10000011 3300005985 Bacteria 461887
66 Ga0070717_10016763 3300006028 Bacteria 5687
67 Ga0070715_10037712 3300006163 Bacteria 2001
68 Ga0070715_10113709 3300006163 Bacteria 1281
69 Ga0070716_100001832 3300006173 Bacteria 9629
70 Ga0070716_100071446 3300006173 Bacteria 2040
71 Ga0070712_100009739 3300006175 Bacteria 6058
72 Ga0070712_100136799 3300006175 Bacteria 1864
73 Ga0070712_100251777 3300006175 Bacteria 1412
74 Ga0097621_100001749 3300006237 Bacteria 14875
75 Ga0068871_100050114 3300006358 Bacteria 3377
76 Ga0068871_100206127 3300006358 Bacteria 1699
77 Ga0068865_100003110 3300006881 Bacteria 9925
78 Ga0097620_100001039 3300006931 Bacteria 28434
79 Ga0097620_100139103 3300006931 Bacteria 2502
80 Ga0097620_100189306 3300006931 Bacteria 2142
81 Ga0099795_10028688 3300007788 Bacteria 1895
82 Ga0105240_10000901 3300009093 Bacteria 53028
83 Ga0105240_10012526 3300009093 Bacteria 11700
84 Ga0105240_10081690 3300009093 Bacteria 3970
85 Ga0105240_10100843 3300009093 Bacteria 3513
86 Ga0105240_10106947 3300009093 Bacteria 3392
87 Ga0105240_10172784 3300009093 Bacteria 2557
88 Ga0105240_10309044 3300009093 Bacteria 1806
89 Ga0105240_10856507 3300009093 Bacteria 980
90 Ga0105245_10030550 3300009098 Bacteria 4764
91 Ga0105245_10651923 3300009098 Bacteria 1083
92 Ga0105247_10000269 3300009101 Bacteria 48237
93 Ga0105247_10340033 3300009101 Bacteria 1052
94 Ga0105241_10077956 3300009174 Bacteria 2588
95 Ga0105248_10014619 3300009177 Bacteria 8637
96 Ga0105248_10068694 3300009177 Bacteria 3979
97 Ga0105237_10036797 3300009545 Bacteria 4951
98 Ga0105237_10102039 3300009545 Bacteria 2861
99 Ga0105237_10138899 3300009545 Bacteria 2424
100 Ga0105238_10007439 3300009551 Bacteria 10970
101 Ga0105238_10103223 3300009551 Bacteria 2832
102 Ga0105238_10159778 3300009551 Bacteria 2229
103 Ga0105238_10261273 3300009551 Bacteria 1711
104 Ga0105238_10435685 3300009551 Bacteria 1307
105 Ga0105249_10135887 3300009553 Bacteria 2352
106 Ga0105249_10293853 3300009553 Bacteria 1627
107 Ga0105249_10792457 3300009553 Bacteria 1011
108 Ga0099796_10024459 3300010159 Bacteria 1897
109 Ga0105239_10066206 3300010375 Bacteria 3969
110 Ga0105239_10136499 3300010375 Bacteria 2731
111 Ga0157370_10008821 3300013104 Bacteria 10836
112 Ga0157370_10095917 3300013104 Bacteria 2782
113 Ga0157370_10771798 3300013104 Bacteria 875
114 Ga0157369_10069896 3300013105 Bacteria 3772
115 Ga0157369_10138153 3300013105 Bacteria 2579
116 Ga0157369_10199654 3300013105 Bacteria 2100
117 Ga0157369_10302642 3300013105 Bacteria 1663
118 Ga0157369_10533486 3300013105 Bacteria 1213
119 Ga0157374_10001720 3300013296 Bacteria 18374
120 Ga0157378_10003340 3300013297 Bacteria 14274
121 Ga0163162_10006541 3300013306 Bacteria 11289
122 Ga0163162_10335621 3300013306 Bacteria 1644
123 Ga0157372_10534628 3300013307 Bacteria 1366
124 Ga0157375_10248996 3300013308 Bacteria 1937
125 Ga0157379_10003724 3300014968 Bacteria 12970
126 Ga0157379_10029405 3300014968 Bacteria 4887
127 Ga0157379_10039474 3300014968 Bacteria 4211
128 Ga0157379_10043511 3300014968 Bacteria 4009
129 Ga0157379_10220066 3300014968 Bacteria 1720
130 Ga0157379_10669220 3300014968 Bacteria 973
131 Ga0213874_10005386 3300021377 Bacteria 2978
132 Ga0213871_10000873 3300021441 Bacteria 4583
133 Ga0224712_10014800 3300022467 Bacteria 2522
134 Ga0207692_10107832 3300025898 Bacteria 1540
135 Ga0207642_10062571 3300025899 Bacteria 1736
136 Ga0207710_10001594 3300025900 Bacteria 11112
137 Ga0207710_10061006 3300025900 Bacteria 1711
138 Ga0207680_10005249 3300025903 Bacteria 6179
139 Ga0207685_10035702 3300025905 Bacteria 1816
140 Ga0207699_10001696 3300025906 Bacteria 10423
141 Ga0207699_10015238 3300025906 Bacteria 3989
142 Ga0207699_10202266 3300025906 Bacteria 1347
143 Ga0207707_10004120 3300025912 Bacteria 12885
144 Ga0207707_10006475 3300025912 Bacteria 10225
145 Ga0207707_10019586 3300025912 Bacteria 5905
146 Ga0207707_10027294 3300025912 Bacteria 4993
147 Ga0207707_10055875 3300025912 Bacteria 3434
148 Ga0207707_10067054 3300025912 Bacteria 3126
149 Ga0207707_10182843 3300025912 Bacteria 1830
150 Ga0207695_10003807 3300025913 Bacteria 20912
151 Ga0207695_10005812 3300025913 Bacteria 16234
152 Ga0207695_10012588 3300025913 Bacteria 10139
153 Ga0207695_10050099 3300025913 Bacteria 4396
154 Ga0207695_10078699 3300025913 Bacteria 3344
155 Ga0207695_10098982 3300025913 Bacteria 2914
156 Ga0207695_10117038 3300025913 Bacteria 2638
157 Ga0207671_10020561 3300025914 Bacteria 5022
158 Ga0207671_10066054 3300025914 Bacteria 2692
159 Ga0207693_10000503 3300025915 Bacteria 35359
160 Ga0207663_10149640 3300025916 Bacteria 1636
161 Ga0207660_10002958 3300025917 Bacteria 11113
162 Ga0207660_10054156 3300025917 Bacteria 2862
163 Ga0207660_10062251 3300025917 Bacteria 2688
164 Ga0207660_10205907 3300025917 Bacteria 1538
165 Ga0207657_10212642 3300025919 Bacteria 1551
166 Ga0207652_10003120 3300025921 Bacteria 13816
167 Ga0207652_10042444 3300025921 Bacteria 3871
168 Ga0207652_10092440 3300025921 Bacteria 2661
169 Ga0207652_10097451 3300025921 Bacteria 2592
170 Ga0207694_10013303 3300025924 Bacteria 6196
171 Ga0207687_10019802 3300025927 Bacteria 4461
172 Ga0207700_10015118 3300025928 Bacteria 5078
173 Ga0207700_10053060 3300025928 Bacteria 3035
174 Ga0207700_10075256 3300025928 Bacteria 2616
175 Ga0207664_10034955 3300025929 Bacteria 3874
176 Ga0207644_10083853 3300025931 Bacteria 2361
177 Ga0207644_10148725 3300025931 Bacteria 1811
178 Ga0207686_10015574 3300025934 Bacteria 4253
179 Ga0207704_10440935 3300025938 Bacteria 1037
180 Ga0207665_10001006 3300025939 Bacteria 19021
181 Ga0207665_10092711 3300025939 Bacteria 2096
182 Ga0207665_10185213 3300025939 Bacteria 1510
183 Ga0207711_10740953 3300025941 Bacteria 916
184 Ga0207661_10020523 3300025944 Bacteria 4940
185 Ga0207661_10067983 3300025944 Bacteria 2900
186 Ga0207667_10003042 3300025949 Bacteria 20811
187 Ga0207667_10135779 3300025949 Bacteria 2533
188 Ga0207712_10329528 3300025961 Bacteria 1262
189 Ga0207658_10005547 3300025986 Bacteria 8643
190 Ga0207658_10011290 3300025986 Bacteria 6083
191 Ga0207658_10017775 3300025986 Bacteria 4899
192 Ga0207703_10001542 3300026035 Bacteria 20908
193 Ga0207703_10002350 3300026035 Bacteria 16484
194 Ga0207639_10122621 3300026041 Bacteria 2138
195 Ga0207678_10591195 3300026067 Bacteria 973
196 Ga0207702_10045819 3300026078 Bacteria 3679
197 Ga0207702_10151036 3300026078 Bacteria 2113
198 Ga0207641_10001631 3300026088 Bacteria 21877
199 Ga0207641_10014136 3300026088 Bacteria 6542
200 Ga0207648_10025545 3300026089 Bacteria 5260
201 Ga0207676_10063663 3300026095 Bacteria 2930
202 Ga0207675_100077284 3300026118 Bacteria 3118
203 Ga0207683_10004435 3300026121 Bacteria 12129
204 Ga0268266_10001105 3300028379 Bacteria 33805
205 Ga0268266_10004428 3300028379 Bacteria 13451
206 Ga0268266_10030319 3300028379 Bacteria 4595
207 Ga0268266_10392674 3300028379 Bacteria 1310
208 Ga0268266_10565389 3300028379 Bacteria 1090
209 Ga0268265_10430596 3300028380 Bacteria 1227
210 Ga0268264_10000102 3300028381 Bacteria 222526
211 Ga0265334_10088636 3300028573 Bacteria 1131
212 Ga0307515_10286017 3300028794 Bacteria 1350
213 Ga0307511_10000235 3300030521 Bacteria 56564
214 Ga0307511_10037057 3300030521 Bacteria 4222
215 Ga0265331_10006916 3300031250 Bacteria 6625
216 Ga0307509_10000987 3300031507 Bacteria 48811
217 Ga0307508_10116823 3300031616 Unclassified 2269
218 Ga0316575_10101741 3300031665 Bacteria 1169
219 Ga0316576_10020944 3300031727 Bacteria 4512
220 Ga0307518_10278300 3300031838 Bacteria 1038
221 Ga0307510_10000006 3300033180 Bacteria 566474
222 Ga0307510_10001491 3300033180 Bacteria 25837
223 Ga0373936_0004491 3300035113 Bacteria 5278
224 Ga0373954_0042666 3300035118 Bacteria 2115
225 Ga0373956_0076002 3300035119 Bacteria 1536
226 Ga0373943_0007932 3300035170 Bacteria 4766
227 Ga0373955_0102074 3300035172 Bacteria 1648
228 Ga0316574_0064359 3300035398 Bacteria 2307
229 Ga0373935_0128234 3300035692 Bacteria 1702
230 Ga0373927_0081843 3300035695 Bacteria 2092
231 Ga0373947_0071479 3300035725 Bacteria 2128
232 Ga0395900_0222468 3300037418 Bacteria 1902
233 Ga0395901_0465662 3300038443 Bacteria 1291
234 Ga0436365_0424052 3300039437 Bacteria 4005
235 Ga0436365_1478453 3300039437 Bacteria 1231
236 Ga0436360_0671062 3300039438 Bacteria 18814
237 Ga0436360_0784778 3300039438 Bacteria 2916
238 Ga0436363_0656721 3300039450 Bacteria 1165
239 Ga0436363_1197813 3300039450 Bacteria 4326
240 Ga0436363_1513388 3300039450 Bacteria 2279
241 Ga0436363_1581361 3300039450 Bacteria 1200
242 Ga0436362_0134511 3300039453 Bacteria 1647
243 Ga0436362_1161498 3300039453 Bacteria 1333
244 Ga0436362_1242266 3300039453 Bacteria 1118
245 Ga0466969_0014231 3300044656 Bacteria 4181
246 Ga0466969_0016815 3300044656 Bacteria 3825
247 Ga0466969_0081003 3300044656 Bacteria 1550
248 Ga0466965_0030965 3300044683 Bacteria 2608
249 Ga0466966_0001231 3300044684 Bacteria 16430
250 Ga0466966_0003082 3300044684 Bacteria 10981
251 Ga0466966_0054933 3300044684 Bacteria 2523
252 Ga0466964_0007360 3300044706 Bacteria 4115
253 Ga0466970_0011621 3300044765 Bacteria 4491
254 Ga0466960_0022188 3300044901 Bacteria 2835
255 Ga0466959_0017609 3300045049 Bacteria 5238
256 Ga0466959_0070709 3300045049 Bacteria 2528
257 Ga0466959_0163452 3300045049 Bacteria 1564
258 Ga0466958_0112400 3300045836 Bacteria 1701
259 Ga0495629_0133226 3300046459 Bacteria 1731
260 Ga0495580_0003962 3300046472 Bacteria 12497
261 Ga0495580_0011229 3300046472 Bacteria 6930
262 Ga0495606_0060784 3300046507 Unclassified 2419
263 Ga0495630_0040274 3300046517 Bacteria 3492
264 Ga0495643_0079587 3300046522 Bacteria 1708
265 Ga0495587_0090860 3300046536 Bacteria 1764
266 Ga0495623_0104228 3300046679 Bacteria 1725
267 Ga0495658_0200109 3300046683 Bacteria 1245
268 Ga0495602_0137718 3300048088 Bacteria 1937
269 Ga0496100_0083209 3300048903 Bacteria 2166
270 Ga0496101_0002441 3300048904 Bacteria 11422
271 Ga0496102_0017987 3300048905 Bacteria 6202
272 Ga0496102_0023375 3300048905 Bacteria 5489
273 Ga0496104_0243206 3300048907 Bacteria 1712
274 Ga0496105_0104452 3300048908 Bacteria 2339
275 Ga0496106_0006238 3300048909 Bacteria 8822
276 Ga0496106_0092881 3300048909 Bacteria 2331
277 Ga0496107_0016738 3300048910 Bacteria 5154
278 Ga0496107_0155701 3300048910 Bacteria 1692
279 Ga0496108_0009024 3300048911 Bacteria 8079
280 Ga0496109_0002877 3300048912 Bacteria 14402
281 Ga0496110_0020129 3300048913 Bacteria 5629
282 Ga0496111_0001612 3300048914 Bacteria 13057
283 Ga0496112_0032696 3300048915 Bacteria 5051
284 Ga0496113_0016397 3300048916 Bacteria 5119
285 Ga0496114_0015435 3300048917 Bacteria 6144
286 Ga0496114_0372437 3300048917 Bacteria 1264
287 Ga0496115_0018865 3300048918 Bacteria 5303
288 Ga0496115_0101792 3300048918 Bacteria 2356
289 Ga0496117_0001307 3300048920 Bacteria 36670
290 Ga0496117_0241385 3300048920 Bacteria 992
291 Ga0496118_0000032 3300048921 Bacteria 330072
292 Ga0496118_0057712 3300048921 Bacteria 2907
293 Ga0496119_0006461 3300048922 Bacteria 10842
294 Ga0496119_0008002 3300048922 Bacteria 9397
295 Ga0496119_0045495 3300048922 Bacteria 2751
296 Ga0496120_0001131 3300048923 Bacteria 34451
297 Ga0496120_0055095 3300048923 Bacteria 2249
298 Ga0496120_0157597 3300048923 Bacteria 1135
299 Ga0496121_0000704 3300048924 Bacteria 62218
300 Ga0496121_0017510 3300048924 Bacteria 7312
301 Ga0496124_0056695 3300048927 Bacteria 3303
302 Ga0496125_0000324 3300048928 Bacteria 92755
303 Ga0496125_0027135 3300048928 Bacteria 5198
304 Ga0496125_0079434 3300048928 Bacteria 2516
305 Ga0496126_0004321 3300048929 Bacteria 17055
306 Ga0496126_0047720 3300048929 Bacteria 3919
307 Ga0496126_0086984 3300048929 Bacteria 2754
308 Ga0496126_0309556 3300048929 Bacteria 1301
309 Ga0496126_0330514 3300048929 Bacteria 1251
310 Ga0501033_0124517 3300049570 Bacteria 1869
311 Ga0501036_0015449 3300049572 Bacteria 6377
312 Ga0501036_0026505 3300049572 Bacteria 4893
313 Ga0501038_0312040 3300049574 Bacteria 1232
314 Ga0501039_0002672 3300049575 Bacteria 13300
315 Ga0501039_0058632 3300049575 Bacteria 2982
316 Ga0501040_0006256 3300049576 Bacteria 7727
317 Ga0501040_0219877 3300049576 Bacteria 1351
318 Ga0501041_0015467 3300049577 Bacteria 4530
319 Ga0501041_0063481 3300049577 Bacteria 2261
320 Ga0501041_0189219 3300049577 Bacteria 1289
321 Ga0501042_0189526 3300049578 Bacteria 1483
322 Ga0501046_0005283 3300049580 Bacteria 11553
323 Ga0501046_0060651 3300049580 Bacteria 2959
324 Ga0501048_0004946 3300049582 Bacteria 10166
325 Ga0501048_0049905 3300049582 Bacteria 2981
326 Ga0501068_0092584 3300049584 Bacteria 1866
327 Ga0501068_0114590 3300049584 Bacteria 1678
328 Ga0501071_0000220 3300049587 Bacteria 26239
329 Ga0501072_0000641 3300049588 Bacteria 25081
330 Ga0501072_0044376 3300049588 Bacteria 3496
331 Ga0501074_0086320 3300049590 Bacteria 2248
332 Ga0501075_0000398 3300049591 Bacteria 25242
333 Ga0501075_0003452 3300049591 Bacteria 10566
334 Ga0501076_0002362 3300049592 Bacteria 12913
335 Ga0501076_0053873 3300049592 Bacteria 3188
336 Ga0501077_0005145 3300049593 Bacteria 7945
337 Ga0501077_0008006 3300049593 Bacteria 6532
338 Ga0501079_0002385 3300049741 Bacteria 13631
339 Ga0501079_0026784 3300049741 Bacteria 4419
340 Ga0501080_0013159 3300049742 Bacteria 7601
341 Ga0501081_0000163 3300049743 Bacteria 30783
342 Ga0501081_0025067 3300049743 Bacteria 4009
343 Ga0501083_0271072 3300049744 Bacteria 1104
344 Ga0501035_0067720 3300049822 Bacteria 3167
345 Ga0501035_0156047 3300049822 Bacteria 1978
346 Ga0501045_0000537 3300049824 Bacteria 23761
347 Ga0501045_0004624 3300049824 Bacteria 9502
348 nmdc:mga0rr50_758161_c1 3300050513 Bacteria 828
349 nmdc:mga08x19_33559_c1 3300050514 Bacteria 3239
350 Ga0495619_0127893 3300053085 Bacteria 1745
351 Ga0500583_0083986 3300053092 Bacteria 1542
352 Ga0500583_0159749 3300053092 Bacteria 1122
353 Ga0500641_0018425 3300053096 Bacteria 2626
354 Ga0500595_044164 3300053119 Bacteria 1414
355 Ga0500617_065573 3300053124 Bacteria 1600
356 Ga0500642_0080704 3300053130 Bacteria 1494
357 Ga0500588_0005545 3300053146 Bacteria 2809
358 Ga0500616_0000193 3300053153 Bacteria 100119
359 Ga0500637_0006214 3300053178 Bacteria 5861
360 Ga0500637_0011849 3300053178 Bacteria 4525
361 Ga0500637_0043693 3300053178 Bacteria 2538
362 Ga0501084_0187730 3300054114 Bacteria 1744
363 Ga0501082_0015681 3300060353 Bacteria 6518
364 Ga0501082_0017929 3300060353 Bacteria 6098
365 Ga0466962_0000261 3300061719 Bacteria 22319
366 Ga0530510_0008091 3300061734 Bacteria 7331
367 Ga0530510_0023421 3300061734 Bacteria 4399
368 Ga0466959_0032008
369 Ga0058862_12287919
370 Ga0065707_10084801
371 Ga0070683_100053916
372 Ga0070690_100002892
373 Ga0070666_10001276
374 Ga0070680_100008924
375 Ga0070680_100051417
376 Ga0070680_100054694
377 Ga0068868_100103918
378 Ga0070660_100141540
379 Ga0070671_100003643
380 Ga0070671_100007529
381 Ga0070673_100011065
382 Ga0070667_100007800
383 Ga0070667_100013317
384 Ga0070709_10002317
385 Ga0070713_100014784
386 Ga0070713_100048038
387 Ga0070713_100060186
388 Ga0070713_100063530
389 Ga0070710_10047797
390 Ga0070711_100046387
391 Ga0070663_100046875
392 Ga0070678_100002790
393 Ga0070681_10009789
394 Ga0070681_10035688
395 Ga0070681_10035992
396 Ga0070681_10066958
397 Ga0070681_10071592
398 Ga0070681_10090166
399 Ga0070681_10176705
400 Ga0070699_100129436
401 Ga0070679_100000534
402 Ga0070679_100150980
403 Ga0070679_100239043
404 Ga0070684_100257296
405 Ga0070672_100223691
406 Ga0070695_100068401
407 Ga0070665_100001700
408 Ga0070665_100009634
409 Ga0070665_100016429
410 Ga0070665_100021569
411 Ga0068855_100036973
412 Ga0068855_100127358
413 Ga0068855_100200228
414 Ga0068856_100310065
415 Ga0068852_100058616
416 Ga0068859_100001039
417 Ga0068859_100139097
418 Ga0068859_100189295
419 Ga0068864_100037600
420 Ga0068866_10038909
421 Ga0068861_100191506
422 Ga0068863_100008891
423 Ga0068863_100014447
424 Ga0068863_100017277
425 Ga0068858_100000125
426 Ga0068858_100013756
427 Ga0068858_100046875
428 Ga0068860_100001229
429 Ga0068860_100005076
430 Ga0068860_100068315
431 Ga0081455_10001331
432 Ga0081539_10000011
433 Ga0070717_10016763
434 Ga0070715_10037712
435 Ga0070715_10113709
436 Ga0070716_100001832
437 Ga0070716_100071446
438 Ga0070712_100009739
439 Ga0070712_100136799
440 Ga0070712_100251777
441 Ga0097621_100001749
442 Ga0068871_100050114
443 Ga0068871_100206127
444 Ga0068865_100003110
445 Ga0097620_100001039
446 Ga0097620_100139103
447 Ga0097620_100189306
448 Ga0099795_10028688
449 Ga0105240_10000901
450 Ga0105240_10012526
451 Ga0105240_10081690
452 Ga0105240_10100843
453 Ga0105240_10106947
454 Ga0105240_10172784
455 Ga0105240_10309044
456 Ga0105240_10856507
457 Ga0105245_10030550
458 Ga0105245_10651923
459 Ga0105247_10000269
460 Ga0105247_10340033
461 Ga0105241_10077956
462 Ga0105248_10014619
463 Ga0105248_10068694
464 Ga0105237_10036797
465 Ga0105237_10102039
466 Ga0105237_10138899
467 Ga0105238_10007439
468 Ga0105238_10103223
469 Ga0105238_10159778
470 Ga0105238_10261273
471 Ga0105238_10435685
472 Ga0105249_10135887
473 Ga0105249_10293853
474 Ga0105249_10792457
475 Ga0099796_10024459
476 Ga0105239_10066206
477 Ga0105239_10136499
478 Ga0157370_10008821
479 Ga0157370_10095917
480 Ga0157370_10771798
481 Ga0157369_10069896
482 Ga0157369_10138153
483 Ga0157369_10199654
484 Ga0157369_10302642
485 Ga0157369_10533486
486 Ga0157374_10001720
487 Ga0157378_10003340
488 Ga0163162_10006541
489 Ga0163162_10335621
490 Ga0157372_10534628
491 Ga0157375_10248996
492 Ga0157379_10003724
493 Ga0157379_10029405
494 Ga0157379_10039474
495 Ga0157379_10043511
496 Ga0157379_10220066
497 Ga0157379_10669220
498 Ga0213874_10005386
499 Ga0213871_10000873
500 Ga0224712_10014800
501 Ga0207692_10107832
502 Ga0207642_10062571
503 Ga0207710_10001594
504 Ga0207710_10061006
505 Ga0207680_10005249
506 Ga0207685_10035702
507 Ga0207699_10001696
508 Ga0207699_10015238
509 Ga0207699_10202266
510 Ga0207707_10004120
511 Ga0207707_10006475
512 Ga0207707_10019586
513 Ga0207707_10027294
514 Ga0207707_10055875
515 Ga0207707_10067054
516 Ga0207707_10182843
517 Ga0207695_10003807
518 Ga0207695_10005812
519 Ga0207695_10012588
520 Ga0207695_10050099
521 Ga0207695_10078699
522 Ga0207695_10098982
523 Ga0207695_10117038
524 Ga0207671_10020561
525 Ga0207671_10066054
526 Ga0207693_10000503
527 Ga0207663_10149640
528 Ga0207660_10002958
529 Ga0207660_10054156
530 Ga0207660_10062251
531 Ga0207660_10205907
532 Ga0207657_10212642
533 Ga0207652_10003120
534 Ga0207652_10042444
535 Ga0207652_10092440
536 Ga0207652_10097451
537 Ga0207694_10013303
538 Ga0207687_10019802
539 Ga0207700_10015118
540 Ga0207700_10053060
541 Ga0207700_10075256
542 Ga0207664_10034955
543 Ga0207644_10083853
544 Ga0207644_10148725
545 Ga0207686_10015574
546 Ga0207704_10440935
547 Ga0207665_10001006
548 Ga0207665_10092711
549 Ga0207665_10185213
550 Ga0207711_10740953
551 Ga0207661_10020523
552 Ga0207661_10067983
553 Ga0207667_10003042
554 Ga0207667_10135779
555 Ga0207712_10329528
556 Ga0207658_10005547
557 Ga0207658_10011290
558 Ga0207658_10017775
559 Ga0207703_10001542
560 Ga0207703_10002350
561 Ga0207639_10122621
562 Ga0207678_10591195
563 Ga0207702_10045819
564 Ga0207702_10151036
565 Ga0207641_10001631
566 Ga0207641_10014136
567 Ga0207648_10025545
568 Ga0207676_10063663
569 Ga0207675_100077284
570 Ga0207683_10004435
571 Ga0268266_10001105
572 Ga0268266_10004428
573 Ga0268266_10030319
574 Ga0268266_10392674
575 Ga0268266_10565389
576 Ga0268265_10430596
577 Ga0268264_10000102
578 Ga0265334_10088636
579 Ga0307515_10286017
580 Ga0307511_10000235
581 Ga0307511_10037057
582 Ga0265331_10006916
583 Ga0307509_10000987
584 Ga0307508_10116823
585 Ga0316575_10101741
586 Ga0316576_10020944
587 Ga0307518_10278300
588 Ga0307510_10000006
589 Ga0307510_10001491
590 Ga0373936_0004491
591 Ga0373954_0042666
592 Ga0373956_0076002
593 Ga0373943_0007932
594 Ga0373955_0102074
595 Ga0316574_0064359
596 Ga0373935_0128234
597 Ga0373927_0081843
598 Ga0373947_0071479
599 Ga0395900_0222468
600 Ga0395901_0465662
601 Ga0436365_0424052
602 Ga0436365_1478453
603 Ga0436360_0671062
604 Ga0436360_0784778
605 Ga0436363_0656721
606 Ga0436363_1197813
607 Ga0436363_1513388
608 Ga0436363_1581361
609 Ga0436362_0134511
610 Ga0436362_1161498
611 Ga0436362_1242266
612 Ga0466969_0014231
613 Ga0466969_0016815
614 Ga0466969_0081003
615 Ga0466965_0030965
616 Ga0466966_0001231
617 Ga0466966_0003082
618 Ga0466966_0054933
619 Ga0466964_0007360
620 Ga0466970_0011621
621 Ga0466960_0022188
622 Ga0466959_0017609
623 Ga0466959_0070709
624 Ga0466959_0163452
625 Ga0466958_0112400
626 Ga0495629_0133226
627 Ga0495580_0003962
628 Ga0495580_0011229
629 Ga0495606_0060784
630 Ga0495630_0040274
631 Ga0495643_0079587
632 Ga0495587_0090860
633 Ga0495623_0104228
634 Ga0495658_0200109
635 Ga0495602_0137718
636 Ga0496100_0083209
637 Ga0496101_0002441
638 Ga0496102_0017987
639 Ga0496102_0023375
640 Ga0496104_0243206
641 Ga0496105_0104452
642 Ga0496106_0006238
643 Ga0496106_0092881
644 Ga0496107_0016738
645 Ga0496107_0155701
646 Ga0496108_0009024
647 Ga0496109_0002877
648 Ga0496110_0020129
649 Ga0496111_0001612
650 Ga0496112_0032696
651 Ga0496113_0016397
652 Ga0496114_0015435
653 Ga0496114_0372437
654 Ga0496115_0018865
655 Ga0496115_0101792
656 Ga0496117_0001307
657 Ga0496117_0241385
658 Ga0496118_0000032
659 Ga0496118_0057712
660 Ga0496119_0006461
661 Ga0496119_0008002
662 Ga0496119_0045495
663 Ga0496120_0001131
664 Ga0496120_0055095
665 Ga0496120_0157597
666 Ga0496121_0000704
667 Ga0496121_0017510
668 Ga0496124_0056695
669 Ga0496125_0000324
670 Ga0496125_0027135
671 Ga0496125_0079434
672 Ga0496126_0004321
673 Ga0496126_0047720
674 Ga0496126_0086984
675 Ga0496126_0309556
676 Ga0496126_0330514
677 Ga0501033_0124517
678 Ga0501036_0015449
679 Ga0501036_0026505
680 Ga0501038_0312040
681 Ga0501039_0002672
682 Ga0501039_0058632
683 Ga0501040_0006256
684 Ga0501040_0219877
685 Ga0501041_0015467
686 Ga0501041_0063481
687 Ga0501041_0189219
688 Ga0501042_0189526
689 Ga0501046_0005283
690 Ga0501046_0060651
691 Ga0501048_0004946
692 Ga0501048_0049905
693 Ga0501068_0092584
694 Ga0501068_0114590
695 Ga0501071_0000220
696 Ga0501072_0000641
697 Ga0501072_0044376
698 Ga0501074_0086320
699 Ga0501075_0000398
700 Ga0501075_0003452
701 Ga0501076_0002362
702 Ga0501076_0053873
703 Ga0501077_0005145
704 Ga0501077_0008006
705 Ga0501079_0002385
706 Ga0501079_0026784
707 Ga0501080_0013159
708 Ga0501081_0000163
709 Ga0501081_0025067
710 Ga0501083_0271072
711 Ga0501035_0067720
712 Ga0501035_0156047
713 Ga0501045_0000537
714 Ga0501045_0004624
715 nmdc:mga0rr50_758161_c1
716 nmdc:mga08x19_33559_c1
717 Ga0495619_0127893
718 Ga0500583_0083986
719 Ga0500583_0159749
720 Ga0500641_0018425
721 Ga0500595_044164
722 Ga0500617_065573
723 Ga0500642_0080704
724 Ga0500588_0005545
725 Ga0500616_0000193
726 Ga0500637_0006214
727 Ga0500637_0011849
728 Ga0500637_0043693
729 Ga0501084_0187730
730 Ga0501082_0015681
731 Ga0501082_0017929
732 Ga0466962_0000261
733 Ga0530510_0008091
734 Ga0530510_0023421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

2

265

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ovg-assembly1.cif.gz_B the c146a variant of an amidase from pyrococcus horikoshii with bound acetamide 0.9233 1 254
3iw3-assembly1.cif.gz_B crystal structure of hyperthermophilic nitrilase 0.9214 1 253
1j31-assembly2.cif.gz_D crystal structure of hypothetical protein ph0642 from pyrococcus horikoshii 0.9204 1 254
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.9151 2 267
3p8k-assembly1.cif.gz_B crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus 0.9143 1 261
ID Description Score Start End Superfamily
af_Q8VDK1_45_315_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9506 4 266 3.60.110.10
af_Q557J5_4_291_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9472 2 267 3.60.110.10
af_Q94JV5_26_305_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9411 1 266 3.60.110.10
af_O94660_4_273_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9333 4 266 3.60.110.10
af_O59829_1_271_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9258 2 263 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A519ZBH0-F1-model_v4 Carbon-nitrogen hydrolase family protein 0.9835 1 103 GO:0016787
AF-A0A534D7R2-F1-model_v4 Carbon-nitrogen hydrolase family protein 0.9668 1 153 GO:0016787
AF-A0A519ZBH0-F1-model_v4 Carbon-nitrogen hydrolase family protein 0.9649 1 103 GO:0016787
AF-A0A2E7JZS8-F1-model_v4 Amidohydrolase 0.9645 1 265 GO:0016811
AF-A0A498E3D3-F1-model_v4 Carbon-nitrogen hydrolase family protein 0.9633 1 266 GO:0016811

Map