F424232

General Info

Members Datasets Scaffolds Average Seq Length
367 290 296 263

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10114530|Ga0065704_101145302
Length 301
Sequence MFFLIENRNRIDMDNFKFEMKILRFVFSKFEADNFFAMQNYLDLLQHILDNGTDKTDRTGTGTRSVFGYQLRYDLSKGFPLVTTKKVHLKSIIYELLWFIKGDTNTKYLKDNGVSIWDEWADENGNLGPVYGAQWRSWNGANGKVVDQFSDVIEQIKKNPDSRRLIVSAWNAAEIPNMALAPCHALFQFYVADGKLSLQLYQRSADVFLGVPFNIASYALLLMMVAQVTGLEVGDYVHTFGDVHIYNNHFEQVQKQLSRAPRALPKMKLNPEIKDIFDFDFEDFTLENYDPHPGIKAPVAI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
7 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
8 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
9 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
10 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
11 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
12 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
13 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
14 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
15 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
16 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
17 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
18 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
19 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
20 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
21 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
22 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
23 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
24 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
25 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
26 2643221580 Devosia sp. Root635 Isolate Unclassified
27 2643221615 Nocardioides sp. Root224 Isolate Unclassified
28 2643221641 Nocardioides sp. Root122 Isolate Unclassified
29 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
30 2643221674 Devosia sp. Root436 Isolate Unclassified
31 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
32 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
33 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
34 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
35 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
36 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
37 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
38 2738541305 Nocardioides sp. CF167 Isolate Unclassified
39 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
40 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
41 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
42 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
43 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
44 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
45 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
46 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
47 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
48 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
49 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
50 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
51 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
52 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
53 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
54 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
55 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
56 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
57 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
58 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
59 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
60 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
61 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
62 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
63 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
64 2932401849 Devosia sp. 2618 Isolate Rhizosphere
65 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
66 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
67 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
68 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
69 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
70 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
71 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
72 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
73 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
76 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
77 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
80 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
81 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
82 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
83 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
87 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
88 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
89 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
90 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
91 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
94 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
97 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
201 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
210 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
211 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
216 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
227 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
266 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
286 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
290 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.65
Metatranscriptomes 0
Isolates 19.35

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 12.53
Nodule 1.09
Rhizoplane 1.09
Rhizosphere 70.03
Stem 0
Stem Tuber 0
Unclassified 14.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_750015 2162886007 Bacteria 2158
2 JGI24739J22299_10107228 3300001989 Bacteria 840
3 JGI25151J46595_10001824 3300003187 Bacteria 13733
4 JGI25151J46595_10013385 3300003187 Bacteria 3692
5 rootH1_10054680 3300003323 Bacteria 8196
6 Ga0055532_1000064 3300003758 Bacteria 143144
7 Ga0055525_1000021 3300003759 Bacteria 370802
8 Ga0055527_1000685 3300003760 Bacteria 10030
9 Ga0055535_1001814 3300003761 Bacteria 9257
10 Ga0055542_1001646 3300003762 Bacteria 10030
11 Ga0055529_1000388 3300003763 Bacteria 47502
12 Ga0055524_1007380 3300003775 Bacteria 4674
13 Ga0055530_10001698 3300003791 Bacteria 15597
14 Ga0065714_10065189 3300005288 Bacteria 12111
15 Ga0065704_10074612 3300005289 Bacteria 6137
16 Ga0065704_10074747 3300005289 Bacteria 6041
17 Ga0065704_10114530 3300005289 Bacteria 1889
18 Ga0070658_10108996 3300005327 Bacteria 2292
19 Ga0070683_100001412 3300005329 Bacteria 18434
20 Ga0070683_100442482 3300005329 Bacteria 1240
21 Ga0070682_100000005 3300005337 Bacteria 386439
22 Ga0070682_100000238 3300005337 Bacteria 39996
23 Ga0070682_100017081 3300005337 Bacteria 4227
24 Ga0068868_100204626 3300005338 Bacteria 1647
25 Ga0070660_100034428 3300005339 Bacteria 3827
26 Ga0070689_100372382 3300005340 Bacteria 1202
27 Ga0070668_100039712 3300005347 Bacteria 3599
28 Ga0070668_100094610 3300005347 Bacteria 2359
29 Ga0070667_100153116 3300005367 Bacteria 2027
30 Ga0070711_100366113 3300005439 Bacteria 1162
31 Ga0070700_100471067 3300005441 Bacteria 960
32 Ga0070663_100202714 3300005455 Bacteria 1549
33 Ga0070681_10148686 3300005458 Bacteria 2270
34 Ga0068867_100098223 3300005459 Bacteria 2232
35 Ga0070679_100005027 3300005530 Bacteria 12206
36 Ga0070679_100041314 3300005530 Bacteria 4590
37 Ga0070679_100493433 3300005530 Bacteria 1169
38 Ga0070684_100046851 3300005535 Bacteria 3746
39 Ga0068853_100153789 3300005539 Bacteria 2072
40 Ga0070672_100441089 3300005543 Bacteria 1120
41 Ga0070665_100312549 3300005548 Bacteria 1575
42 Ga0068855_100022034 3300005563 Bacteria 7638
43 Ga0068854_100111733 3300005578 Bacteria 2062
44 Ga0070702_100023774 3300005615 Bacteria 3260
45 Ga0068852_100010167 3300005616 Bacteria 7011
46 Ga0068852_100048097 3300005616 Bacteria 3643
47 Ga0068859_100000522 3300005617 Bacteria 38186
48 Ga0068864_100089505 3300005618 Bacteria 2712
49 Ga0068851_10105916 3300005834 Bacteria 1497
50 Ga0068860_100002199 3300005843 Bacteria 20515
51 Ga0075365_10005655 3300006038 Bacteria 6770
52 Ga0075365_10022323 3300006038 Bacteria 3964
53 Ga0075368_10018688 3300006042 Bacteria 2607
54 Ga0075363_100002471 3300006048 Bacteria 7560
55 Ga0075364_10119037 3300006051 Bacteria 1767
56 Ga0075369_10011520 3300006186 Bacteria 3481
57 Ga0075370_10010103 3300006353 Bacteria 4923
58 Ga0075428_100000205 3300006844 Bacteria 56652
59 Ga0075431_100000119 3300006847 Bacteria 51177
60 Ga0075434_100244923 3300006871 Bacteria 1813
61 Ga0075429_100001803 3300006880 Bacteria 17742
62 Ga0075429_100228962 3300006880 Bacteria 1628
63 Ga0097620_100000522 3300006931 Bacteria 38186
64 Ga0105244_10000001 3300009036 Bacteria 1034899
65 Ga0111539_10001586 3300009094 Bacteria 30280
66 Ga0111539_10043635 3300009094 Bacteria 5374
67 Ga0114129_10000640 3300009147 Bacteria 43706
68 Ga0105243_10002198 3300009148 Bacteria 16443
69 Ga0105243_10182855 3300009148 Bacteria 1825
70 Ga0105241_10072493 3300009174 Bacteria 2677
71 Ga0105237_10020546 3300009545 Bacteria 6805
72 Ga0105239_10276836 3300010375 Bacteria 1888
73 Ga0157373_10000004 3300013100 Bacteria 275553
74 Ga0157371_10000201 3300013102 Bacteria 87780
75 Ga0157371_10144213 3300013102 Bacteria 1697
76 Ga0157370_10010456 3300013104 Bacteria 9777
77 Ga0157370_10042623 3300013104 Bacteria 4372
78 Ga0157370_10078585 3300013104 Bacteria 3107
79 Ga0157370_10211808 3300013104 Bacteria 1796
80 Ga0157370_10212102 3300013104 Bacteria 1795
81 Ga0157369_10000815 3300013105 Bacteria 39822
82 Ga0157369_10051022 3300013105 Bacteria 4478
83 Ga0157369_10064575 3300013105 Bacteria 3942
84 Ga0157369_10099528 3300013105 Bacteria 3099
85 Ga0163162_10335495 3300013306 Bacteria 1644
86 Ga0157372_10041116 3300013307 Bacteria 5110
87 Ga0157375_10001608 3300013308 Bacteria 19412
88 Ga0157375_10035257 3300013308 Bacteria 4774
89 Ga0157375_10319052 3300013308 Bacteria 1718
90 Ga0157375_10866636 3300013308 Bacteria 1049
91 Ga0163163_10065261 3300014325 Bacteria 3613
92 Ga0163163_10206434 3300014325 Bacteria 2013
93 Ga0182008_10000007 3300014497 Bacteria 372461
94 Ga0182006_1000003 3300015261 Bacteria 826681
95 Ga0163161_10000884 3300017792 Bacteria 23288
96 Ga0163161_10008842 3300017792 Bacteria 6965
97 Ga0209672_100005 3300025228 Bacteria 1069303
98 Ga0209147_100014 3300025229 Bacteria 597841
99 Ga0209563_100005 3300025230 Bacteria 1774893
100 Ga0209563_100023 3300025230 Bacteria 636844
101 Ga0209258_100006 3300025242 Bacteria 1069303
102 Ga0209148_1000012 3300025254 Bacteria 1069303
103 Ga0209455_1000008 3300025272 Bacteria 1069303
104 Ga0209675_1000057 3300025291 Bacteria 185467
105 Ga0209676_1009066 3300025292 Bacteria 4343
106 Ga0209025_1000564 3300025294 Bacteria 67936
107 Ga0209025_1001125 3300025294 Bacteria 38283
108 Ga0209564_1018170 3300025295 Bacteria 2695
109 Ga0209256_1008122 3300025299 Bacteria 4945
110 Ga0209051_1031992 3300025303 Bacteria 2014
111 Ga0209257_1004746 3300025304 Bacteria 10154
112 Ga0207655_1000013 3300025728 Bacteria 637510
113 Ga0207705_10057300 3300025909 Bacteria 2810
114 Ga0207707_10118402 3300025912 Bacteria 2315
115 Ga0207707_10323477 3300025912 Bacteria 1331
116 Ga0207695_10026281 3300025913 Bacteria 6498
117 Ga0207695_10047555 3300025913 Bacteria 4539
118 Ga0207657_10043680 3300025919 Bacteria 3946
119 Ga0207657_10073406 3300025919 Bacteria 2891
120 Ga0207652_10001352 3300025921 Bacteria 21786
121 Ga0207652_10032499 3300025921 Bacteria 4388
122 Ga0207650_10281908 3300025925 Bacteria 1353
123 Ga0207709_10000149 3300025935 Bacteria 96374
124 Ga0207709_10117270 3300025935 Bacteria 1791
125 Ga0207670_10313864 3300025936 Bacteria 1232
126 Ga0207661_10001192 3300025944 Bacteria 17402
127 Ga0207667_10035659 3300025949 Bacteria 5336
128 Ga0207668_10029234 3300025972 Bacteria 3611
129 Ga0207668_10088378 3300025972 Bacteria 2269
130 Ga0207658_10162654 3300025986 Bacteria 1831
131 Ga0207639_10131546 3300026041 Bacteria 2072
132 Ga0207678_10394465 3300026067 Bacteria 1198
133 Ga0207648_10097844 3300026089 Bacteria 2568
134 Ga0207676_10049085 3300026095 Bacteria 3281
135 Ga0207698_10002164 3300026142 Bacteria 11607
136 Ga0209969_1005687 3300027360 Bacteria 1753
137 Ga0209967_1001865 3300027364 Bacteria 2708
138 Ga0209984_1002993 3300027424 Bacteria 1910
139 Ga0210000_1006946 3300027462 Bacteria 1652
140 Ga0209995_1028714 3300027471 Bacteria 929
141 Ga0209999_1003781 3300027543 Bacteria 2715
142 Ga0209982_1000931 3300027552 Bacteria 3856
143 Ga0209983_1000298 3300027665 Bacteria 10335
144 Ga0209971_1000333 3300027682 Bacteria 13030
145 Ga0209974_10001733 3300027876 Bacteria 7924
146 Ga0268266_10265505 3300028379 Bacteria 1592
147 Ga0268265_10099440 3300028380 Bacteria 2345
148 Ga0268265_10814625 3300028380 Bacteria 911
149 Ga0265331_10021642 3300031250 Bacteria 3288
150 Ga0265327_10000139 3300031251 Bacteria 159492
151 Ga0316579_10094330 3300031691 Bacteria 1430
152 Ga0316578_10147716 3300031728 Bacteria 1416
153 Ga0307516_10314317 3300031730 Bacteria 1239
154 Ga0307405_10361931 3300031731 Bacteria 1123
155 Ga0316577_10044102 3300031733 Bacteria 2494
156 Ga0307413_10151011 3300031824 Bacteria 1619
157 Ga0307410_10339557 3300031852 Bacteria 1197
158 Ga0307406_10311482 3300031901 Bacteria 1214
159 Ga0307407_10221075 3300031903 Bacteria 1281
160 Ga0307407_10399579 3300031903 Bacteria 985
161 Ga0307412_10000102 3300031911 Bacteria 69906
162 Ga0307412_10000900 3300031911 Bacteria 17099
163 Ga0307412_10003100 3300031911 Bacteria 9229
164 Ga0307412_10165057 3300031911 Bacteria 1650
165 Ga0307412_10342098 3300031911 Bacteria 1198
166 Ga0307409_100789405 3300031995 Bacteria 956
167 Ga0307409_101076733 3300031995 Bacteria 824
168 Ga0307416_100000031 3300032002 Bacteria 159059
169 Ga0307416_100387855 3300032002 Bacteria 1430
170 Ga0307416_100570074 3300032002 Bacteria 1208
171 Ga0307414_10000010 3300032004 Bacteria 357863
172 Ga0307414_10005674 3300032004 Bacteria 6889
173 Ga0307414_10006175 3300032004 Bacteria 6660
174 Ga0307414_10189866 3300032004 Bacteria 1661
175 Ga0307414_10401427 3300032004 Bacteria 1191
176 Ga0307414_10452263 3300032004 Bacteria 1126
177 Ga0307411_10221589 3300032005 Bacteria 1468
178 Ga0307411_10406625 3300032005 Bacteria 1127
179 Ga0307415_100499543 3300032126 Bacteria 1063
180 Ga0316583_10003601 3300032133 Bacteria 5472
181 Ga0316580_10040752 3300032139 Bacteria 1435
182 Ga0316582_0067957 3300036647 Bacteria 2300
183 Ga0316584_0083544 3300036712 Bacteria 2392
184 Ga0316584_0113145 3300036712 Bacteria 2031
185 Ga0395900_0025688 3300037418 Bacteria 6030
186 Ga0395898_0190338 3300037466 Bacteria 1960
187 Ga0395901_0500181 3300038443 Bacteria 1237
188 Ga0436365_0691100 3300039437 Bacteria 2328
189 Ga0439465_0002051 3300041413 Bacteria 6606
190 Ga0451795_1594654 3300041456 Bacteria 1162
191 Ga0451837_0842085 3300041494 Bacteria 1204
192 Ga0451839_1056440 3300041496 Bacteria 3048
193 Ga0451853_0562319 3300041512 Bacteria 1757
194 Ga0439445_0000217 3300042004 Bacteria 10610
195 Ga0439449_0015560 3300042007 Bacteria 2859
196 Ga0439457_035726 3300042014 Bacteria 1105
197 Ga0450904_005604 3300042139 Bacteria 1265
198 Ga0451577_0153059 3300042876 Bacteria 2075
199 Ga0466977_0011435 3300044666 Bacteria 5108
200 Ga0466965_0033666 3300044683 Bacteria 2505
201 Ga0453684_0011922 3300044712 Bacteria 14473
202 Ga0453684_0178840 3300044712 Bacteria 2492
203 Ga0466970_0054057 3300044765 Bacteria 2144
204 Ga0466970_0152458 3300044765 Bacteria 1276
205 Ga0466960_0036091 3300044901 Bacteria 2314
206 Ga0466959_0307950 3300045049 Bacteria 1084
207 Ga0451576_0507370 3300045051 Bacteria 1267
208 Ga0466967_0030255 3300045976 Bacteria 4542
209 Ga0495627_000002 3300046453 Bacteria 903861
210 Ga0495590_0069190 3300046457 Bacteria 1237
211 Ga0495596_0010040 3300046500 Bacteria 4140
212 Ga0495610_0000006 3300046512 Bacteria 856822
213 Ga0495663_0000128 3300046525 Bacteria 31809
214 Ga0495654_0000006 3300046530 Bacteria 451432
215 Ga0495609_0000047 3300046538 Bacteria 156247
216 Ga0495633_0000003 3300046558 Bacteria 472476
217 Ga0495633_0002315 3300046558 Bacteria 13577
218 Ga0495668_0000301 3300046616 Bacteria 68097
219 Ga0495625_0003536 3300046660 Bacteria 15468
220 Ga0495625_0079656 3300046660 Bacteria 2283
221 Ga0495661_0001246 3300046665 Bacteria 21980
222 Ga0495672_0070231 3300047320 Bacteria 1985
223 Ga0495686_0000017 3300047472 Bacteria 435554
224 Ga0495686_0000206 3300047472 Bacteria 110350
225 Ga0495686_0002572 3300047472 Bacteria 16900
226 Ga0496101_0052223 3300048904 Bacteria 2947
227 Ga0496110_0236253 3300048913 Bacteria 1663
228 Ga0496116_0000006 3300048919 Bacteria 811937
229 Ga0496117_0000027 3300048920 Bacteria 412234
230 Ga0496117_0034182 3300048920 Bacteria 3835
231 Ga0496118_0001435 3300048921 Bacteria 35889
232 Ga0496118_0002826 3300048921 Bacteria 22723
233 Ga0496119_0000205 3300048922 Bacteria 84036
234 Ga0496120_0115313 3300048923 Bacteria 1397
235 Ga0496121_0150624 3300048924 Bacteria 1712
236 Ga0496122_0000073 3300048925 Bacteria 222403
237 Ga0496122_0001327 3300048925 Bacteria 40506
238 Ga0496122_0001417 3300048925 Bacteria 38842
239 Ga0496122_0006041 3300048925 Bacteria 14120
240 Ga0496122_0032228 3300048925 Bacteria 4339
241 Ga0496123_0001190 3300048926 Bacteria 38293
242 Ga0496123_0022199 3300048926 Bacteria 4900
243 Ga0496123_0095077 3300048926 Bacteria 1754
244 Ga0496123_0114216 3300048926 Bacteria 1536
245 Ga0496124_0001294 3300048927 Bacteria 37979
246 Ga0496125_0000180 3300048928 Bacteria 138952
247 Ga0496125_0000622 3300048928 Bacteria 59554
248 Ga0496125_0001900 3300048928 Bacteria 28607
249 Ga0496126_0005470 3300048929 Bacteria 14481
250 Ga0501032_0043979 3300049569 Bacteria 3023
251 Ga0501033_0090126 3300049570 Bacteria 2243
252 Ga0501034_0011801 3300049571 Bacteria 9042
253 Ga0501034_0036479 3300049571 Bacteria 4980
254 Ga0501034_0214131 3300049571 Bacteria 1881
255 Ga0501034_0512978 3300049571 Bacteria 1111
256 Ga0501036_0339764 3300049572 Bacteria 1254
257 Ga0501038_0078944 3300049574 Bacteria 2776
258 Ga0501039_0019458 3300049575 Bacteria 5206
259 Ga0501040_0107162 3300049576 Bacteria 1953
260 Ga0501040_0177089 3300049576 Bacteria 1511
261 Ga0501042_0164670 3300049578 Bacteria 1600
262 Ga0501043_0161206 3300049579 Bacteria 1752
263 Ga0501048_0237222 3300049582 Bacteria 1294
264 Ga0501048_0297976 3300049582 Bacteria 1147
265 Ga0501067_0125367 3300049583 Bacteria 1429
266 Ga0501076_0589352 3300049592 Bacteria 917
267 Ga0501081_0049145 3300049743 Bacteria 2904
268 Ga0501241_000399 3300049758 Bacteria 9520
269 Ga0501269_000428 3300049766 Bacteria 9482
270 Ga0501035_0161106 3300049822 Bacteria 1942
271 Ga0501045_0211563 3300049824 Bacteria 1444
272 nmdc:mga03683_110172_c1 3300050489 Bacteria 1216
273 nmdc:mga03n38_74446_c1 3300050490 Bacteria 1579
274 nmdc:mga03n38_9544_c1 3300050490 Bacteria 3536
275 nmdc:mga00v17_16395_c1 3300050491 Bacteria 4175
276 nmdc:mga00v17_42556_c1 3300050491 Bacteria 2733
277 nmdc:mga0yw44_106931_c1 3300050492 Bacteria 1789
278 nmdc:mga04h51_31155_c1 3300050495 Bacteria 1684
279 nmdc:mga07m45_10552_c1 3300050496 Bacteria 4829
280 nmdc:mga05p37_1058783_c1 3300050507 Bacteria 854
281 nmdc:mga05p37_504_c1 3300050507 Bacteria 43013
282 nmdc:mga09592_74915_c1 3300050508 Bacteria 2877
283 nmdc:mga0qj67_50560_c1 3300050509 Bacteria 3287
284 nmdc:mga06r32_64_c1 3300050510 Bacteria 67984
285 nmdc:mga08y16_102203_c1 3300050511 Bacteria 2984
286 nmdc:mga08y16_906_c1 3300050511 Bacteria 28665
287 nmdc:mga0n895_95950_c1 3300050512 Bacteria 2970
288 nmdc:mga0a205_305774_c1 3300050515 Bacteria 1462
289 nmdc:mga0sz30_5629_c1 3300050516 Bacteria 4604
290 Ga0495595_0188973 3300053084 Bacteria 1023
291 Ga0495619_0069461 3300053085 Bacteria 2355
292 Ga0500643_087433 3300053087 Bacteria 852
293 Ga0500556_0000513 3300053104 Bacteria 26475
294 Ga0500568_0056255 3300053139 Bacteria 1534
295 Ga0500604_0000235 3300053151 Bacteria 15825
296 Ga0500634_0000081 3300053161 Bacteria 37292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100442482 Ga0070683_1004424822 246
2 3300005337 Ga0070682_100017081 Ga0070682_1000170816 246
3 3300005439 Ga0070711_100366113 Ga0070711_1003661131 246
4 3300005458 Ga0070681_10148686 Ga0070681_101486862 246
5 3300005530 Ga0070679_100041314 Ga0070679_1000413142 246
6 3300005539 Ga0068853_100153789 Ga0068853_1001537892 246
7 3300005563 Ga0068855_100022034 Ga0068855_1000220347 246
8 3300005578 Ga0068854_100111733 Ga0068854_1001117332 246
9 3300005616 Ga0068852_100010167 Ga0068852_1000101671 246
10 3300009174 Ga0105241_10072493 Ga0105241_100724932 246
11 3300009545 Ga0105237_10020546 Ga0105237_100205467 246
12 3300013105 Ga0157369_10064575 Ga0157369_100645755 246
13 3300025912 Ga0207707_10118402 Ga0207707_101184022 246
14 3300025913 Ga0207695_10047555 Ga0207695_100475556 246
15 3300025921 Ga0207652_10032499 Ga0207652_100324996 246
16 3300025949 Ga0207667_10035659 Ga0207667_100356593 246
17 3300026041 Ga0207639_10131546 Ga0207639_101315462 246
18 3300003759 Ga0055525_1000021 Ga0055525_100002148 250
19 3300025230 Ga0209563_100005 Ga0209563_100005279 250
20 3300003187 JGI25151J46595_10013385 JGI25151J46595_100133852 255
21 3300003775 Ga0055524_1007380 Ga0055524_10073803 255
22 3300013104 Ga0157370_10078585 Ga0157370_100785853 255
23 3300013105 Ga0157369_10051022 Ga0157369_100510226 255
24 3300013307 Ga0157372_10041116 Ga0157372_100411165 255
25 3300025292 Ga0209676_1009066 Ga0209676_10090663 255
26 3300025294 Ga0209025_1000564 Ga0209025_100056462 255
27 3300025295 Ga0209564_1018170 Ga0209564_10181702 255
28 3300025299 Ga0209256_1008122 Ga0209256_10081223 255
29 3300025303 Ga0209051_1031992 Ga0209051_10319923 255
30 3300025304 Ga0209257_1004746 Ga0209257_100474610 255
31 3300025909 Ga0207705_10057300 Ga0207705_100573002 255
32 3300025919 Ga0207657_10043680 Ga0207657_100436802 255
33 3300032004 Ga0307414_10005674 Ga0307414_100056742 255
34 3300032004 Ga0307414_10189866 Ga0307414_101898661 255
35 3300042007 Ga0439449_0015560 Ga0439449_0015560_1727_2521 255
36 3300042876 Ga0451577_0153059 Ga0451577_0153059_17_811 255
37 3300005347 Ga0070668_100094610 Ga0070668_1000946103 257
38 3300025972 Ga0207668_10088378 Ga0207668_100883783 257
39 3300048913 Ga0496110_0236253 Ga0496110_0236253_186_980 257
40 3300048925 Ga0496122_0032228 Ga0496122_0032228_1409_2182 257
41 3300048926 Ga0496123_0022199 Ga0496123_0022199_831_1604 257
42 3300048928 Ga0496125_0000180 Ga0496125_0000180_37249_38043 257
43 3300048928 Ga0496125_0001900 Ga0496125_0001900_18084_18857 257
44 3300050507 nmdc:mga05p37_1058783_c1 nmdc:mga05p37_1058783_c1_12_785 257
45 3300053161 Ga0500634_0000081 Ga0500634_0000081_26343_27137 257
46 3300005441 Ga0070700_100471067 Ga0070700_1004710671 258
47 3300031901 Ga0307406_10311482 Ga0307406_103114822 258
48 3300049571 Ga0501034_0036479 Ga0501034_0036479_3335_4129 258
49 3300049571 Ga0501034_0512978 Ga0501034_0512978_270_1064 258
50 iso_pu_bacteria 2511231000 2511232502 260
51 iso_pu_bacteria 2513237150 2513955927 260
52 iso_pu_bacteria 2513237165 2514043986 260
53 iso_pu_bacteria 2523231067 2523470787 260
54 iso_pu_bacteria 2523533629 2524006796 260
55 iso_pu_bacteria 2524614857 2526063574 260
56 iso_pu_bacteria 2582581278 2585143859 260
57 iso_pu_bacteria 2582581281 2585158708 260
58 iso_pu_bacteria 2582581282 2585162995 260
59 iso_pu_bacteria 2582581865 2585386559 260
60 iso_pu_bacteria 2582581873 2585424366 260
61 iso_pu_bacteria 2585428045 2587681341 260
62 iso_pu_bacteria 2585428060 2587745869 260
63 iso_pu_bacteria 2585428061 2587751065 260
64 iso_pu_bacteria 2585428095 2587865273 260
65 iso_pu_bacteria 2585428115 2587944127 260
66 iso_pu_bacteria 2585428182 2588210067 260
67 iso_pu_bacteria 2585428183 2588214730 260
68 iso_pu_bacteria 2585428184 2588217958 260
69 iso_pu_bacteria 2585428185 2588222839 260
70 iso_pu_bacteria 2585428187 2588231325 260
71 iso_pu_bacteria 2588253712 2588444388 260
72 iso_pu_bacteria 2588254255 2590601308 260
73 iso_pu_bacteria 2588254257 2590613238 260
74 iso_pu_bacteria 2643221580 2643911275 260
75 iso_pu_bacteria 2643221615 2644093626 260
76 iso_pu_bacteria 2643221641 2644230097 260
77 iso_pu_bacteria 2643221657 2644323468 260
78 iso_pu_bacteria 2643221674 2644411337 260
79 iso_pu_bacteria 2643221681 2644456697 260
80 iso_pu_bacteria 2643221961 2645720083 260
81 iso_pu_bacteria 2643221962 2645726940 260
82 iso_pu_bacteria 2671180139 2671693326 260
83 iso_pu_bacteria 2711768088 2712196632 260
84 iso_pu_bacteria 2728369107 2729199788 260
85 iso_pu_bacteria 2738541273 2738699917 260
86 iso_pu_bacteria 2738541305 2738871840 260
87 iso_pu_bacteria 2738543014 2739253666 260
88 iso_pu_bacteria 2739367874 2740058809 260
89 iso_pu_bacteria 2739367875 2740061924 260
90 iso_pu_bacteria 2751185877 2753674335 260
91 iso_pu_bacteria 2757320391 2757565827 260
92 iso_pu_bacteria 2765235839 2765573971 260
93 iso_pu_bacteria 2772190705 2772605046 260
94 iso_pu_bacteria 2775506739 2775672130 260
95 iso_pu_bacteria 2816332188 2816874186 260
96 iso_pu_bacteria 2840677318 2840677412 260
97 iso_pu_bacteria 2842083920 2842086139 260
98 iso_pu_bacteria 2857481737 2857485708 260
99 iso_pu_bacteria 2871720351 2871720419 260
100 iso_pu_bacteria 2883068021 2883072843 260
101 iso_pu_bacteria 2889290771 2889295532 260
102 iso_pu_bacteria 2895498888 2895499573 260
103 iso_pu_bacteria 2895511927 2895512596 260
104 iso_pu_bacteria 2895522137 2895522610 260
105 iso_pu_bacteria 2895525241 2895525628 260
106 iso_pu_bacteria 2896085136 2896085230 260
107 iso_pu_bacteria 2905999023 2906002887 260
108 iso_pu_bacteria 2915606848 2915611705 260
109 iso_pu_bacteria 2919097161 2919100556 260
110 iso_pu_bacteria 2919399522 2919401073 260
111 iso_pu_bacteria 2932401849 2932402752 260
112 iso_pu_bacteria 2945924605 2945926184 260
113 iso_pu_bacteria 2946019816 2946022435 260
114 iso_pu_bacteria 2977243572 2977245168 260
115 iso_pu_bacteria 2984572630 2984572921 260
116 iso_pu_bacteria 2984606641 2984610370 260
117 iso_pu_bacteria 2993372514 2993374466 260
118 iso_pu_bacteria 2993480792 2993481352 260
119 iso_pu_bacteria 643348564 643598469 260
120 3300005530 Ga0070679_100493433 Ga0070679_1004934331 263
121 3300025912 Ga0207707_10323477 Ga0207707_103234771 263
122 3300053085 Ga0495619_0069461 Ga0495619_0069461_674_1465 263
123 2162886007 SwRhRL2b_contig_750015 SwRhRL2b_0227.00005470 264
124 3300001989 JGI24739J22299_10107228 JGI24739J22299_101072281 264
125 3300003187 JGI25151J46595_10001824 JGI25151J46595_100018248 264
126 3300003323 rootH1_10054680 rootH1_100546803 264
127 3300003758 Ga0055532_1000064 Ga0055532_1000064102 264
128 3300003760 Ga0055527_1000685 Ga0055527_10006855 264
129 3300003761 Ga0055535_1001814 Ga0055535_10018146 264
130 3300003762 Ga0055542_1001646 Ga0055542_10016465 264
131 3300003763 Ga0055529_1000388 Ga0055529_100038836 264
132 3300003791 Ga0055530_10001698 Ga0055530_100016983 264
133 3300005288 Ga0065714_10065189 Ga0065714_100651895 264
134 3300005289 Ga0065704_10074612 Ga0065704_100746124 264
135 3300005289 Ga0065704_10074747 Ga0065704_100747476 264
136 3300005289 Ga0065704_10114530 Ga0065704_101145302 264
137 3300005327 Ga0070658_10108996 Ga0070658_101089963 264
138 3300005329 Ga0070683_100001412 Ga0070683_10000141212 264
139 3300005337 Ga0070682_100000005 Ga0070682_100000005160 264
140 3300005337 Ga0070682_100000238 Ga0070682_1000002383 264
141 3300005338 Ga0068868_100204626 Ga0068868_1002046262 264
142 3300005339 Ga0070660_100034428 Ga0070660_1000344283 264
143 3300005340 Ga0070689_100372382 Ga0070689_1003723822 264
144 3300005347 Ga0070668_100039712 Ga0070668_1000397122 264
145 3300005367 Ga0070667_100153116 Ga0070667_1001531162 264
146 3300005455 Ga0070663_100202714 Ga0070663_1002027143 264
147 3300005459 Ga0068867_100098223 Ga0068867_1000982232 264
148 3300005530 Ga0070679_100005027 Ga0070679_10000502713 264
149 3300005535 Ga0070684_100046851 Ga0070684_1000468515 264
150 3300005543 Ga0070672_100441089 Ga0070672_1004410891 264
151 3300005548 Ga0070665_100312549 Ga0070665_1003125492 264
152 3300005615 Ga0070702_100023774 Ga0070702_1000237743 264
153 3300005616 Ga0068852_100048097 Ga0068852_1000480971 264
154 3300005617 Ga0068859_100000522 Ga0068859_1000005222 264
155 3300005618 Ga0068864_100089505 Ga0068864_1000895052 264
156 3300005834 Ga0068851_10105916 Ga0068851_101059162 264
157 3300005843 Ga0068860_100002199 Ga0068860_10000219916 264
158 3300006038 Ga0075365_10005655 Ga0075365_100056555 264
159 3300006038 Ga0075365_10022323 Ga0075365_100223232 264
160 3300006042 Ga0075368_10018688 Ga0075368_100186883 264
161 3300006048 Ga0075363_100002471 Ga0075363_1000024714 264
162 3300006051 Ga0075364_10119037 Ga0075364_101190373 264
163 3300006186 Ga0075369_10011520 Ga0075369_100115202 264
164 3300006353 Ga0075370_10010103 Ga0075370_100101034 264
165 3300006844 Ga0075428_100000205 Ga0075428_10000020531 264
166 3300006847 Ga0075431_100000119 Ga0075431_10000011950 264
167 3300006871 Ga0075434_100244923 Ga0075434_1002449232 264
168 3300006880 Ga0075429_100001803 Ga0075429_10000180312 264
169 3300006880 Ga0075429_100228962 Ga0075429_1002289622 264
170 3300006931 Ga0097620_100000522 Ga0097620_10000052236 264
171 3300009036 Ga0105244_10000001 Ga0105244_10000001151 264
172 3300009094 Ga0111539_10001586 Ga0111539_1000158616 264
173 3300009094 Ga0111539_10043635 Ga0111539_100436356 264
174 3300009147 Ga0114129_10000640 Ga0114129_1000064036 264
175 3300009148 Ga0105243_10002198 Ga0105243_100021989 264
176 3300009148 Ga0105243_10182855 Ga0105243_101828551 264
177 3300010375 Ga0105239_10276836 Ga0105239_102768363 264
178 3300013100 Ga0157373_10000004 Ga0157373_10000004203 264
179 3300013102 Ga0157371_10000201 Ga0157371_1000020130 264
180 3300013102 Ga0157371_10144213 Ga0157371_101442132 264
181 3300013104 Ga0157370_10010456 Ga0157370_100104566 264
182 3300013104 Ga0157370_10042623 Ga0157370_100426231 264
183 3300013104 Ga0157370_10211808 Ga0157370_102118083 264
184 3300013104 Ga0157370_10212102 Ga0157370_102121023 264
185 3300013105 Ga0157369_10000815 Ga0157369_100008157 264
186 3300013105 Ga0157369_10099528 Ga0157369_100995282 264
187 3300013306 Ga0163162_10335495 Ga0163162_103354952 264
188 3300013308 Ga0157375_10001608 Ga0157375_1000160815 264
189 3300013308 Ga0157375_10035257 Ga0157375_100352573 264
190 3300013308 Ga0157375_10319052 Ga0157375_103190522 264
191 3300013308 Ga0157375_10866636 Ga0157375_108666362 264
192 3300014325 Ga0163163_10065261 Ga0163163_100652612 264
193 3300014325 Ga0163163_10206434 Ga0163163_102064342 264
194 3300014497 Ga0182008_10000007 Ga0182008_10000007193 264
195 3300015261 Ga0182006_1000003 Ga0182006_100000399 264
196 3300017792 Ga0163161_10000884 Ga0163161_1000088414 264
197 3300017792 Ga0163161_10008842 Ga0163161_100088422 264
198 3300025228 Ga0209672_100005 Ga0209672_100005366 264
199 3300025229 Ga0209147_100014 Ga0209147_100014624 264
200 3300025230 Ga0209563_100023 Ga0209563_10002322 264
201 3300025242 Ga0209258_100006 Ga0209258_100006366 264
202 3300025254 Ga0209148_1000012 Ga0209148_1000012366 264
203 3300025272 Ga0209455_1000008 Ga0209455_1000008366 264
204 3300025291 Ga0209675_1000057 Ga0209675_100005797 264
205 3300025294 Ga0209025_1001125 Ga0209025_100112527 264
206 3300025728 Ga0207655_1000013 Ga0207655_1000013276 264
207 3300025913 Ga0207695_10026281 Ga0207695_100262815 264
208 3300025919 Ga0207657_10073406 Ga0207657_100734063 264
209 3300025921 Ga0207652_10001352 Ga0207652_100013522 264
210 3300025925 Ga0207650_10281908 Ga0207650_102819081 264
211 3300025935 Ga0207709_10000149 Ga0207709_1000014967 264
212 3300025935 Ga0207709_10117270 Ga0207709_101172702 264
213 3300025936 Ga0207670_10313864 Ga0207670_103138642 264
214 3300025944 Ga0207661_10001192 Ga0207661_100011925 264
215 3300025972 Ga0207668_10029234 Ga0207668_100292345 264
216 3300025986 Ga0207658_10162654 Ga0207658_101626542 264
217 3300026067 Ga0207678_10394465 Ga0207678_103944652 264
218 3300026089 Ga0207648_10097844 Ga0207648_100978442 264
219 3300026095 Ga0207676_10049085 Ga0207676_100490852 264
220 3300026142 Ga0207698_10002164 Ga0207698_100021644 264
221 3300027360 Ga0209969_1005687 Ga0209969_10056872 264
222 3300027364 Ga0209967_1001865 Ga0209967_10018652 264
223 3300027424 Ga0209984_1002993 Ga0209984_10029932 264
224 3300027462 Ga0210000_1006946 Ga0210000_10069462 264
225 3300027471 Ga0209995_1028714 Ga0209995_10287142 264
226 3300027543 Ga0209999_1003781 Ga0209999_10037812 264
227 3300027552 Ga0209982_1000931 Ga0209982_10009316 264
228 3300027665 Ga0209983_1000298 Ga0209983_10002982 264
229 3300027682 Ga0209971_1000333 Ga0209971_100033310 264
230 3300027876 Ga0209974_10001733 Ga0209974_100017332 264
231 3300028379 Ga0268266_10265505 Ga0268266_102655052 264
232 3300028380 Ga0268265_10099440 Ga0268265_100994402 264
233 3300028380 Ga0268265_10814625 Ga0268265_108146251 264
234 3300031250 Ga0265331_10021642 Ga0265331_100216424 264
235 3300031251 Ga0265327_10000139 Ga0265327_1000013978 264
236 3300031691 Ga0316579_10094330 Ga0316579_100943302 264
237 3300031728 Ga0316578_10147716 Ga0316578_101477161 264
238 3300031730 Ga0307516_10314317 Ga0307516_103143172 264
239 3300031731 Ga0307405_10361931 Ga0307405_103619312 264
240 3300031733 Ga0316577_10044102 Ga0316577_100441023 264
241 3300031824 Ga0307413_10151011 Ga0307413_101510114 264
242 3300031852 Ga0307410_10339557 Ga0307410_103395572 264
243 3300031903 Ga0307407_10221075 Ga0307407_102210752 264
244 3300031903 Ga0307407_10399579 Ga0307407_103995791 264
245 3300031911 Ga0307412_10000102 Ga0307412_1000010241 264
246 3300031911 Ga0307412_10000900 Ga0307412_1000090010 264
247 3300031911 Ga0307412_10003100 Ga0307412_100031006 264
248 3300031911 Ga0307412_10165057 Ga0307412_101650572 264
249 3300031911 Ga0307412_10342098 Ga0307412_103420982 264
250 3300031995 Ga0307409_100789405 Ga0307409_1007894052 264
251 3300031995 Ga0307409_101076733 Ga0307409_1010767331 264
252 3300032002 Ga0307416_100000031 Ga0307416_100000031107 264
253 3300032002 Ga0307416_100387855 Ga0307416_1003878552 264
254 3300032002 Ga0307416_100570074 Ga0307416_1005700742 264
255 3300032004 Ga0307414_10000010 Ga0307414_10000010174 264
256 3300032004 Ga0307414_10006175 Ga0307414_100061757 264
257 3300032004 Ga0307414_10401427 Ga0307414_104014273 264
258 3300032004 Ga0307414_10452263 Ga0307414_104522632 264
259 3300032005 Ga0307411_10221589 Ga0307411_102215892 264
260 3300032005 Ga0307411_10406625 Ga0307411_104066251 264
261 3300032126 Ga0307415_100499543 Ga0307415_1004995431 264
262 3300032133 Ga0316583_10003601 Ga0316583_100036013 264
263 3300032139 Ga0316580_10040752 Ga0316580_100407522 264
264 3300036647 Ga0316582_0067957 Ga0316582_0067957_263_1057 264
265 3300036712 Ga0316584_0083544 Ga0316584_0083544_451_1245 264
266 3300036712 Ga0316584_0113145 Ga0316584_0113145_82_906 264
267 3300037418 Ga0395900_0025688 Ga0395900_0025688_4411_5205 264
268 3300037466 Ga0395898_0190338 Ga0395898_0190338_858_1652 264
269 3300038443 Ga0395901_0500181 Ga0395901_0500181_289_1083 264
270 3300039437 Ga0436365_0691100 Ga0436365_0691100_332_1126 264
271 3300041413 Ga0439465_0002051 Ga0439465_0002051_2083_2877 264
272 3300041456 Ga0451795_1594654 Ga0451795_1594654_274_1068 264
273 3300041494 Ga0451837_0842085 Ga0451837_0842085_308_1102 264
274 3300041496 Ga0451839_1056440 Ga0451839_1056440_874_1668 264
275 3300041512 Ga0451853_0562319 Ga0451853_0562319_431_1225 264
276 3300042004 Ga0439445_0000217 Ga0439445_0000217_101_895 264
277 3300042014 Ga0439457_035726 Ga0439457_035726_295_1089 264
278 3300042139 Ga0450904_005604 Ga0450904_005604_279_1073 264
279 3300044666 Ga0466977_0011435 Ga0466977_0011435_936_1730 264
280 3300044683 Ga0466965_0033666 Ga0466965_0033666_1655_2449 264
281 3300044712 Ga0453684_0011922 Ga0453684_0011922_3310_4104 264
282 3300044712 Ga0453684_0178840 Ga0453684_0178840_1449_2243 264
283 3300044765 Ga0466970_0054057 Ga0466970_0054057_1153_1947 264
284 3300044765 Ga0466970_0152458 Ga0466970_0152458_157_951 264
285 3300044901 Ga0466960_0036091 Ga0466960_0036091_1321_2130 264
286 3300045049 Ga0466959_0307950 Ga0466959_0307950_207_1001 264
287 3300045051 Ga0451576_0507370 Ga0451576_0507370_262_1131 264
288 3300045976 Ga0466967_0030255 Ga0466967_0030255_355_1149 264
289 3300046453 Ga0495627_000002 Ga0495627_000002_642268_643062 264
290 3300046457 Ga0495590_0069190 Ga0495590_0069190_352_1146 264
291 3300046500 Ga0495596_0010040 Ga0495596_0010040_2931_3725 264
292 3300046512 Ga0495610_0000006 Ga0495610_0000006_766318_767112 264
293 3300046525 Ga0495663_0000128 Ga0495663_0000128_30491_31285 264
294 3300046530 Ga0495654_0000006 Ga0495654_0000006_335807_336601 264
295 3300046538 Ga0495609_0000047 Ga0495609_0000047_98676_99470 264
296 3300046558 Ga0495633_0000003 Ga0495633_0000003_167310_168104 264
297 3300046558 Ga0495633_0002315 Ga0495633_0002315_2131_2925 264
298 3300046616 Ga0495668_0000301 Ga0495668_0000301_5125_5934 264
299 3300046660 Ga0495625_0003536 Ga0495625_0003536_3049_3843 264
300 3300046660 Ga0495625_0079656 Ga0495625_0079656_578_1372 264
301 3300046665 Ga0495661_0001246 Ga0495661_0001246_6667_7506 264
302 3300047320 Ga0495672_0070231 Ga0495672_0070231_174_968 264
303 3300047472 Ga0495686_0000017 Ga0495686_0000017_371410_372204 264
304 3300047472 Ga0495686_0000206 Ga0495686_0000206_34679_35473 264
305 3300047472 Ga0495686_0002572 Ga0495686_0002572_7097_7891 264
306 3300048904 Ga0496101_0052223 Ga0496101_0052223_2107_2901 264
307 3300048919 Ga0496116_0000006 Ga0496116_0000006_322517_323311 264
308 3300048920 Ga0496117_0000027 Ga0496117_0000027_34425_35219 264
309 3300048920 Ga0496117_0034182 Ga0496117_0034182_2926_3720 264
310 3300048921 Ga0496118_0001435 Ga0496118_0001435_34397_35191 264
311 3300048921 Ga0496118_0002826 Ga0496118_0002826_2575_3369 264
312 3300048922 Ga0496119_0000205 Ga0496119_0000205_34425_35219 264
313 3300048923 Ga0496120_0115313 Ga0496120_0115313_346_1140 264
314 3300048924 Ga0496121_0150624 Ga0496121_0150624_420_1214 264
315 3300048925 Ga0496122_0000073 Ga0496122_0000073_77954_78748 264
316 3300048925 Ga0496122_0001327 Ga0496122_0001327_5286_6080 264
317 3300048925 Ga0496122_0001417 Ga0496122_0001417_33173_33967 264
318 3300048925 Ga0496122_0006041 Ga0496122_0006041_3310_4104 264
319 3300048926 Ga0496123_0001190 Ga0496123_0001190_19387_20181 264
320 3300048926 Ga0496123_0095077 Ga0496123_0095077_824_1618 264
321 3300048926 Ga0496123_0114216 Ga0496123_0114216_220_1014 264
322 3300048927 Ga0496124_0001294 Ga0496124_0001294_31374_32168 264
323 3300048928 Ga0496125_0000622 Ga0496125_0000622_16856_17650 264
324 3300048929 Ga0496126_0005470 Ga0496126_0005470_5928_6722 264
325 3300049569 Ga0501032_0043979 Ga0501032_0043979_252_1046 264
326 3300049570 Ga0501033_0090126 Ga0501033_0090126_1357_2151 264
327 3300049571 Ga0501034_0011801 Ga0501034_0011801_6910_7704 264
328 3300049571 Ga0501034_0214131 Ga0501034_0214131_642_1436 264
329 3300049572 Ga0501036_0339764 Ga0501036_0339764_70_864 264
330 3300049574 Ga0501038_0078944 Ga0501038_0078944_613_1407 264
331 3300049575 Ga0501039_0019458 Ga0501039_0019458_3520_4314 264
332 3300049576 Ga0501040_0107162 Ga0501040_0107162_872_1666 264
333 3300049576 Ga0501040_0177089 Ga0501040_0177089_220_1029 264
334 3300049578 Ga0501042_0164670 Ga0501042_0164670_46_840 264
335 3300049579 Ga0501043_0161206 Ga0501043_0161206_868_1662 264
336 3300049582 Ga0501048_0237222 Ga0501048_0237222_455_1249 264
337 3300049582 Ga0501048_0297976 Ga0501048_0297976_315_1112 264
338 3300049583 Ga0501067_0125367 Ga0501067_0125367_201_995 264
339 3300049592 Ga0501076_0589352 Ga0501076_0589352_22_816 264
340 3300049743 Ga0501081_0049145 Ga0501081_0049145_31_825 264
341 3300049758 Ga0501241_000399 Ga0501241_000399_2345_3139 264
342 3300049766 Ga0501269_000428 Ga0501269_000428_2175_3026 264
343 3300049822 Ga0501035_0161106 Ga0501035_0161106_291_1085 264
344 3300049824 Ga0501045_0211563 Ga0501045_0211563_22_816 264
345 3300050489 nmdc:mga03683_110172_c1 nmdc:mga03683_110172_c1_403_1197 264
346 3300050490 nmdc:mga03n38_74446_c1 nmdc:mga03n38_74446_c1_32_826 264
347 3300050490 nmdc:mga03n38_9544_c1 nmdc:mga03n38_9544_c1_1343_2137 264
348 3300050491 nmdc:mga00v17_16395_c1 nmdc:mga00v17_16395_c1_1416_2210 264
349 3300050491 nmdc:mga00v17_42556_c1 nmdc:mga00v17_42556_c1_857_1651 264
350 3300050492 nmdc:mga0yw44_106931_c1 nmdc:mga0yw44_106931_c1_740_1534 264
351 3300050495 nmdc:mga04h51_31155_c1 nmdc:mga04h51_31155_c1_378_1172 264
352 3300050496 nmdc:mga07m45_10552_c1 nmdc:mga07m45_10552_c1_925_1719 264
353 3300050507 nmdc:mga05p37_504_c1 nmdc:mga05p37_504_c1_5803_6597 264
354 3300050508 nmdc:mga09592_74915_c1 nmdc:mga09592_74915_c1_1421_2215 264
355 3300050509 nmdc:mga0qj67_50560_c1 nmdc:mga0qj67_50560_c1_537_1331 264
356 3300050510 nmdc:mga06r32_64_c1 nmdc:mga06r32_64_c1_41082_41876 264
357 3300050511 nmdc:mga08y16_102203_c1 nmdc:mga08y16_102203_c1_408_1202 264
358 3300050511 nmdc:mga08y16_906_c1 nmdc:mga08y16_906_c1_26817_27611 264
359 3300050512 nmdc:mga0n895_95950_c1 nmdc:mga0n895_95950_c1_409_1203 264
360 3300050515 nmdc:mga0a205_305774_c1 nmdc:mga0a205_305774_c1_173_967 264
361 3300050516 nmdc:mga0sz30_5629_c1 nmdc:mga0sz30_5629_c1_3652_4446 264
362 3300053084 Ga0495595_0188973 Ga0495595_0188973_40_834 264
363 3300053087 Ga0500643_087433 Ga0500643_087433_28_822 264
364 3300053104 Ga0500556_0000513 Ga0500556_0000513_12969_13763 264
365 3300053139 Ga0500568_0056255 Ga0500568_0056255_486_1280 264
366 3300053151 Ga0500604_0000235 Ga0500604_0000235_13779_14573 264
367 iso_pu_bacteria 2858438669 2858439149 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

39

301

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bfi-assembly1.cif.gz_A-2 e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump 0.9922 3 264
3qj7-assembly2.cif.gz_B crystal structure of the mycobacterium tuberculosis thymidylate synthase (thya) bound to dump 0.9919 1 261
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.9915 4 262
1nce-assembly1.cif.gz_B crystal structure of a ternary complex of e. coli thymidylate synthase d169c with dump and the antifolate cb3717 0.9909 4 264
4fog-assembly2.cif.gz_B crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid 0.9909 1 261
ID Description Score Start End Superfamily
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9753 2 264 3.30.572.10
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9751 2 251 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.968 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9623 2 262 3.30.572.10
3dgaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9619 2 259 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A059X1I7-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9989 29 209 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A528BC42-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9986 49 237 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A059WML7-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9978 1 205 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A059WVQ7-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9978 29 201 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A2J0MA32-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9977 1 228 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Feature Viewer

pLDDT pTM Quality
95.37 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map