F424222

General Info

Members Datasets Scaffolds Average Seq Length
367 237 344 160

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10202990|rootL2_102029903
Length 195
Sequence LHFEATTIHIAVLKIKGSLSPLPGGGIISPRMADNIAQKPFWETKTLEQMNPQEWESLCDGCGLCCLVRFEDEETLEVIPTRVHCKLFDPEKCACSDYANRKKHVPDCIKLTPRNIEALEWMPMSCAYRRLHEGKTLPAWHHLITGDRETVHRSGVSIRGQTISELALGDPEEALDFAAWDLSEDRSEWPAEDID

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2818991435 Caulobacter henricii 536 Isolate Unclassified
15 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
16 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
17 2849560528 Caulobacter zeae 410 Isolate Unclassified
18 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
19 2851153111 Caulobacter radicis 736 Isolate Unclassified
20 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
21 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
22 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
23 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
128 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
129 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
209 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
210 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
211 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
212 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
213 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
217 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
218 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
219 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
220 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
221 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
225 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
226 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
230 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
231 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
232 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
235 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
236 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.46
Metatranscriptomes 0.27
Isolates 6.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.97
Nodule 0
Rhizoplane 1.63
Rhizosphere 57.77
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10069759 3300003316 Bacteria 1679
2 rootH2_10015133 3300003320 Bacteria 2308
3 rootH2_10106815 3300003320 Bacteria 4058
4 rootH2_10232400 3300003320 Bacteria 1382
5 rootL2_10141283 3300003322 Bacteria 2588
6 rootL2_10202990 3300003322 Bacteria 2184
7 rootH1_10015152 3300003323 Bacteria 2489
8 rootH1_10082687 3300003323 Bacteria 8475
9 Ga0055526_1023515 3300003771 Bacteria 2053
10 Ga0055537_1000813 3300003773 Bacteria 15449
11 Ga0055524_1005450 3300003775 Bacteria 5685
12 Ga0055524_1066544 3300003775 Bacteria 715
13 Ga0055536_1005094 3300003781 Bacteria 6521
14 Ga0055536_1008341 3300003781 Bacteria 4471
15 Ga0055528_1013764 3300003790 Bacteria 3044
16 Ga0055530_10015556 3300003791 Bacteria 2475
17 Ga0055540_1052616 3300003792 Bacteria 836
18 Ga0055531_10001076 3300003794 Bacteria 21445
19 Ga0055531_10006484 3300003794 Bacteria 6636
20 Ga0055531_10055671 3300003794 Bacteria 1004
21 Ga0055531_10058243 3300003794 Bacteria 962
22 Ga0065165_1001226 3300005262 Bacteria 29422
23 Ga0065704_10114707 3300005289 Bacteria 1886
24 Ga0070676_10493879 3300005328 Bacteria 868
25 Ga0070680_100018377 3300005336 Bacteria 5523
26 Ga0070660_100053412 3300005339 Bacteria 3117
27 Ga0070660_100196468 3300005339 Bacteria 1635
28 Ga0070668_100004326 3300005347 Bacteria 10538
29 Ga0070659_100009652 3300005366 Bacteria 7094
30 Ga0070659_100090552 3300005366 Bacteria 2451
31 Ga0070659_100903898 3300005366 Bacteria 772
32 Ga0070662_100333415 3300005457 Bacteria 1240
33 Ga0070681_10019122 3300005458 Bacteria 6855
34 Ga0070679_100223963 3300005530 Bacteria 1841
35 Ga0068853_100040578 3300005539 Bacteria 3972
36 Ga0068853_100060359 3300005539 Bacteria 3276
37 Ga0070665_100001251 3300005548 Bacteria 30694
38 Ga0070665_100133841 3300005548 Bacteria 2481
39 Ga0068855_100015436 3300005563 Bacteria 9195
40 Ga0068856_100104372 3300005614 Bacteria 2828
41 Ga0068852_100783858 3300005616 Bacteria 967
42 Ga0068859_100000078 3300005617 Bacteria 91430
43 Ga0068864_100000038 3300005618 Bacteria 181005
44 Ga0068864_101307182 3300005618 Bacteria 725
45 Ga0068863_100000026 3300005841 Bacteria 185590
46 Ga0068863_100009509 3300005841 Bacteria 9482
47 Ga0068858_100000117 3300005842 Bacteria 83778
48 Ga0068858_100002020 3300005842 Bacteria 20733
49 Ga0068860_100024685 3300005843 Bacteria 5805
50 Ga0068862_100080950 3300005844 Bacteria 2817
51 Ga0075364_10000185 3300006051 Bacteria 28523
52 Ga0075367_10001931 3300006178 Bacteria 9196
53 Ga0075369_10067829 3300006186 Bacteria 1567
54 Ga0075366_10022642 3300006195 Bacteria 3657
55 Ga0075366_10034462 3300006195 Bacteria 2982
56 Ga0075370_10407953 3300006353 Bacteria 815
57 Ga0097620_100000078 3300006931 Bacteria 91430
58 Ga0105240_10944886 3300009093 Bacteria 925
59 Ga0105248_10001538 3300009177 Bacteria 25680
60 Ga0105248_10792514 3300009177 Bacteria 1069
61 Ga0105238_10088522 3300009551 Bacteria 3082
62 Ga0105238_10195393 3300009551 Bacteria 1999
63 Ga0105249_10177199 3300009553 Bacteria 2071
64 Ga0105249_10220062 3300009553 Bacteria 1868
65 Ga0105239_10122124 3300010375 Bacteria 2894
66 Ga0105239_10617243 3300010375 Bacteria 1237
67 Ga0157373_10006297 3300013100 Bacteria 8870
68 Ga0157373_10020344 3300013100 Bacteria 4824
69 Ga0157370_10134829 3300013104 Bacteria 2302
70 Ga0157374_10751392 3300013296 Bacteria 990
71 Ga0163162_10394891 3300013306 Bacteria 1516
72 Ga0157372_11347248 3300013307 Bacteria 823
73 Ga0163163_10060152 3300014325 Bacteria 3761
74 Ga0157376_11091786 3300014969 Bacteria 823
75 Ga0183365_10001 3300015684 Bacteria 2090444
76 Ga0209565_1000065 3300025263 Bacteria 178266
77 Ga0209673_1001555 3300025273 Bacteria 20684
78 Ga0209675_1032481 3300025291 Bacteria 1221
79 Ga0209676_1000163 3300025292 Bacteria 157845
80 Ga0209676_1000188 3300025292 Bacteria 141232
81 Ga0209564_1035890 3300025295 Bacteria 1427
82 Ga0209758_1001051 3300025297 Bacteria 36121
83 Ga0209758_1004825 3300025297 Bacteria 10881
84 Ga0209050_1001123 3300025298 Bacteria 32326
85 Ga0209050_1001523 3300025298 Bacteria 24437
86 Ga0209050_1054560 3300025298 Bacteria 985
87 Ga0209256_1002408 3300025299 Bacteria 15343
88 Ga0209256_1010683 3300025299 Bacteria 3801
89 Ga0209051_1003588 3300025303 Bacteria 10093
90 Ga0209257_1000074 3300025304 Bacteria 325641
91 Ga0209257_1000370 3300025304 Bacteria 90934
92 Ga0209257_1007513 3300025304 Bacteria 6555
93 Ga0207705_10003865 3300025909 Bacteria 11391
94 Ga0207654_10279496 3300025911 Bacteria 1129
95 Ga0207707_10025833 3300025912 Bacteria 5137
96 Ga0207660_10002714 3300025917 Bacteria 11597
97 Ga0207657_10001909 3300025919 Bacteria 22499
98 Ga0207652_10011944 3300025921 Bacteria 7009
99 Ga0207681_10127849 3300025923 Bacteria 1874
100 Ga0207694_10015154 3300025924 Bacteria 5814
101 Ga0207694_10809332 3300025924 Bacteria 791
102 Ga0207650_10007481 3300025925 Bacteria 7445
103 Ga0207650_10108709 3300025925 Bacteria 2144
104 Ga0207644_10006035 3300025931 Bacteria 7898
105 Ga0207690_10720911 3300025932 Bacteria 821
106 Ga0207690_10824685 3300025932 Bacteria 767
107 Ga0207704_10002124 3300025938 Bacteria 8885
108 Ga0207711_10011385 3300025941 Bacteria 7392
109 Ga0207711_10036056 3300025941 Bacteria 4195
110 Ga0207667_10005300 3300025949 Bacteria 15717
111 Ga0207712_10433392 3300025961 Bacteria 1111
112 Ga0207712_10565049 3300025961 Bacteria 980
113 Ga0207668_10003269 3300025972 Bacteria 9501
114 Ga0207658_10008295 3300025986 Bacteria 7077
115 Ga0207677_10495210 3300026023 Bacteria 1055
116 Ga0207703_10000087 3300026035 Bacteria 106113
117 Ga0207703_10002821 3300026035 Bacteria 14827
118 Ga0207639_10022246 3300026041 Bacteria 4565
119 Ga0207639_10265892 3300026041 Bacteria 1502
120 Ga0207641_10000005 3300026088 Bacteria 470841
121 Ga0207641_10008875 3300026088 Bacteria 8301
122 Ga0207676_10000145 3300026095 Bacteria 61785
123 Ga0207676_10177248 3300026095 Bacteria 1863
124 Ga0207676_10964805 3300026095 Bacteria 839
125 Ga0207698_11177130 3300026142 Bacteria 780
126 Ga0268266_10000005 3300028379 Bacteria 1448194
127 Ga0268266_10151261 3300028379 Bacteria 2092
128 Ga0268264_10084868 3300028381 Bacteria 2716
129 Ga0265318_10096391 3300028577 Bacteria 1089
130 Ga0307517_10002714 3300028786 Bacteria 28250
131 Ga0307517_10064161 3300028786 Bacteria 3419
132 Ga0307515_10051523 3300028794 Bacteria 6135
133 Ga0307515_10136418 3300028794 Bacteria 2665
134 Ga0265770_1056034 3300030878 Bacteria 724
135 Ga0265320_10198600 3300031240 Bacteria 896
136 Ga0265327_10000240 3300031251 Bacteria 109753
137 Ga0307513_10001882 3300031456 Bacteria 29803
138 Ga0307513_10012919 3300031456 Bacteria 10270
139 Ga0265314_10350066 3300031711 Bacteria 813
140 Ga0307414_10019515 3300032004 Bacteria 4203
141 Ga0395900_0000016 3300037418 Bacteria 382407
142 Ga0395898_0114378 3300037466 Bacteria 2585
143 Ga0395898_0171391 3300037466 Bacteria 2075
144 Ga0395905_0000070 3300037471 Bacteria 175662
145 Ga0395905_0008767 3300037471 Bacteria 9946
146 Ga0395905_0048442 3300037471 Bacteria 3982
147 Ga0395905_0181964 3300037471 Bacteria 1973
148 Ga0395905_0198484 3300037471 Bacteria 1881
149 Ga0395905_0552817 3300037471 Bacteria 1052
150 Ga0436364_0302255 3300037853 Bacteria 655
151 Ga0395901_0000022 3300038443 Bacteria 296356
152 Ga0395901_0026308 3300038443 Bacteria 5974
153 Ga0395901_0041275 3300038443 Bacteria 4781
154 Ga0436365_0705032 3300039437 Bacteria 4345
155 Ga0436360_0049903 3300039438 Bacteria 1020
156 Ga0439461_0045009 3300041410 Bacteria 964
157 Ga0439446_0052559 3300042156 Bacteria 1219
158 Ga0439459_0003468 3300042438 Bacteria 2507
159 Ga0466969_0041142 3300044656 Bacteria 2313
160 Ga0466966_0004209 3300044684 Bacteria 9492
161 Ga0466961_0034299 3300044693 Bacteria 3258
162 Ga0466961_0108904 3300044693 Bacteria 1744
163 Ga0466963_0294281 3300044694 Bacteria 1141
164 Ga0466964_0141775 3300044706 Bacteria 1105
165 Ga0466971_0033724 3300044719 Bacteria 2293
166 Ga0466970_0013076 3300044765 Bacteria 4253
167 Ga0466957_0232304 3300044842 Bacteria 1221
168 Ga0466959_0000443 3300045049 Bacteria 24143
169 Ga0466959_0150919 3300045049 Bacteria 1638
170 Ga0466958_0014359 3300045836 Bacteria 4522
171 Ga0495627_001241 3300046453 Bacteria 15869
172 Ga0495590_0002974 3300046457 Bacteria 6957
173 Ga0495629_0028529 3300046459 Bacteria 3962
174 Ga0495638_0000320 3300046460 Bacteria 61710
175 Ga0495638_0001983 3300046460 Bacteria 17473
176 Ga0495638_0006690 3300046460 Bacteria 8352
177 Ga0495638_0007487 3300046460 Bacteria 7825
178 Ga0495638_0071994 3300046460 Bacteria 2113
179 Ga0495638_0098427 3300046460 Bacteria 1752
180 Ga0495650_0000045 3300046471 Bacteria 346204
181 Ga0495583_0000005 3300046506 Bacteria 636894
182 Ga0495583_0035101 3300046506 Bacteria 2397
183 Ga0495583_0061777 3300046506 Bacteria 1670
184 Ga0495606_0007945 3300046507 Bacteria 9344
185 Ga0495606_0085742 3300046507 Bacteria 1948
186 Ga0495610_0000073 3300046512 Bacteria 120193
187 Ga0495610_0207120 3300046512 Bacteria 799
188 Ga0495616_0000653 3300046513 Bacteria 25740
189 Ga0495616_0034016 3300046513 Bacteria 2650
190 Ga0495620_0030710 3300046515 Bacteria 2470
191 Ga0495631_0015895 3300046518 Bacteria 3596
192 Ga0495632_0028778 3300046519 Bacteria 2898
193 Ga0495632_0179162 3300046519 Bacteria 971
194 Ga0495637_0018325 3300046520 Bacteria 3249
195 Ga0495637_0036917 3300046520 Bacteria 2124
196 Ga0495637_0092281 3300046520 Bacteria 1193
197 Ga0495637_0115948 3300046520 Bacteria 1034
198 Ga0495643_0014421 3300046522 Bacteria 4702
199 Ga0495643_0039923 3300046522 Bacteria 2565
200 Ga0495648_0000334 3300046524 Bacteria 51958
201 Ga0495648_0080472 3300046524 Bacteria 1856
202 Ga0495648_0157627 3300046524 Bacteria 1177
203 Ga0495652_0255099 3300046529 Bacteria 1298
204 Ga0495654_0000018 3300046530 Bacteria 293124
205 Ga0495654_0084997 3300046530 Bacteria 1477
206 Ga0495609_0040517 3300046538 Bacteria 2096
207 Ga0495597_0019291 3300046542 Bacteria 3191
208 Ga0495597_0145677 3300046542 Bacteria 974
209 Ga0495622_0000401 3300046557 Bacteria 29198
210 Ga0495668_0018611 3300046616 Bacteria 4013
211 Ga0495668_0080407 3300046616 Bacteria 1788
212 Ga0495668_0132690 3300046616 Bacteria 1363
213 Ga0495625_0000157 3300046660 Bacteria 104679
214 Ga0495625_0001463 3300046660 Bacteria 28633
215 Ga0495625_0003681 3300046660 Bacteria 14999
216 Ga0495625_0012116 3300046660 Bacteria 6996
217 Ga0495625_0022857 3300046660 Bacteria 4784
218 Ga0495625_0097750 3300046660 Bacteria 2020
219 Ga0495625_0142923 3300046660 Bacteria 1613
220 Ga0495625_0264395 3300046660 Bacteria 1112
221 Ga0495625_0277540 3300046660 Bacteria 1079
222 Ga0495613_0004726 3300046689 Bacteria 10221
223 Ga0495670_0167659 3300046691 Bacteria 1156
224 Ga0495670_0563021 3300046691 Bacteria 620
225 Ga0495671_0092835 3300046692 Bacteria 1477
226 Ga0495671_0307070 3300046692 Bacteria 763
227 Ga0495660_0027110 3300046810 Bacteria 3242
228 Ga0495683_0229852 3300047323 Bacteria 823
229 Ga0495687_020793 3300047443 Bacteria 3192
230 Ga0495679_011683 3300047446 Bacteria 3374
231 Ga0495673_0000147 3300047469 Bacteria 125742
232 Ga0495673_0002690 3300047469 Bacteria 12243
233 Ga0495681_0041166 3300047470 Bacteria 2244
234 Ga0495686_0002204 3300047472 Bacteria 18924
235 Ga0495686_0011595 3300047472 Bacteria 6205
236 Ga0495686_0027673 3300047472 Bacteria 3700
237 Ga0495686_0314191 3300047472 Bacteria 861
238 Ga0495686_0460654 3300047472 Bacteria 674
239 Ga0495593_0027350 3300047673 Bacteria 3141
240 Ga0496101_0496400 3300048904 Bacteria 964
241 Ga0496102_0103249 3300048905 Bacteria 2651
242 Ga0496102_1219229 3300048905 Bacteria 672
243 Ga0496103_0016604 3300048906 Bacteria 4394
244 Ga0496106_1144453 3300048909 Bacteria 608
245 Ga0496111_0288438 3300048914 Bacteria 1217
246 Ga0496116_0068343 3300048919 Bacteria 2264
247 Ga0496117_0034635 3300048920 Bacteria 3802
248 Ga0496118_0005429 3300048921 Bacteria 14488
249 Ga0496119_0016523 3300048922 Bacteria 5611
250 Ga0496121_0000059 3300048924 Bacteria 278177
251 Ga0496121_0004510 3300048924 Bacteria 18653
252 Ga0496121_0287246 3300048924 Bacteria 1122
253 Ga0496124_0013574 3300048927 Bacteria 7944
254 Ga0496126_0012275 3300048929 Bacteria 8791
255 Ga0495678_004008 3300049459 Bacteria 8788
256 Ga0495682_0074522 3300049460 Bacteria 1221
257 Ga0501033_0605289 3300049570 Bacteria 751
258 Ga0501034_0042759 3300049571 Bacteria 4587
259 Ga0501034_0256581 3300049571 Bacteria 1692
260 Ga0501038_0759575 3300049574 Bacteria 723
261 Ga0501043_0099312 3300049579 Bacteria 2288
262 Ga0501047_0001567 3300049581 Bacteria 22372
263 Ga0501047_0047813 3300049581 Bacteria 4133
264 Ga0501047_0366119 3300049581 Bacteria 1277
265 Ga0501249_085917 3300049679 Bacteria 743
266 Ga0501035_0357729 3300049822 Bacteria 1221
267 Ga0501035_0451576 3300049822 Bacteria 1063
268 Ga0501035_0596515 3300049822 Bacteria 900
269 Ga0501044_0001035 3300049823 Bacteria 33494
270 nmdc:mga00v17_1532_c1 3300050491 Bacteria 12056
271 nmdc:mga0k408_36337_c1 3300050493 Bacteria 2827
272 nmdc:mga0k408_41152_c1 3300050493 Bacteria 2660
273 nmdc:mga06z11_110762_c1 3300050494 Bacteria 1520
274 nmdc:mga07m45_474934_c1 3300050496 Bacteria 725
275 nmdc:mga0sz30_139876_c1 3300050516 Bacteria 1069
276 nmdc:mga0sz30_233700_c1 3300050516 Bacteria 818
277 nmdc:mga0sz30_56200_c1 3300050516 Bacteria 1676
278 Ga0500635_0001956 3300053080 Bacteria 5030
279 Ga0500578_0000082 3300053086 Bacteria 105580
280 Ga0500578_0285420 3300053086 Bacteria 983
281 Ga0500643_000122 3300053087 Bacteria 81376
282 Ga0500643_004887 3300053087 Bacteria 5907
283 Ga0500644_0000650 3300053088 Bacteria 12874
284 Ga0500583_0008051 3300053092 Bacteria 3754
285 Ga0500651_0057238 3300053093 Bacteria 2440
286 Ga0500566_0074860 3300053094 Bacteria 1895
287 Ga0500641_0000708 3300053096 Bacteria 12071
288 Ga0500650_0271352 3300053098 Bacteria 756
289 Ga0500554_001541 3300053102 Bacteria 4442
290 Ga0500555_012440 3300053103 Bacteria 2450
291 Ga0500555_038867 3300053103 Bacteria 1330
292 Ga0500555_073961 3300053103 Bacteria 895
293 Ga0500556_0001245 3300053104 Bacteria 11765
294 Ga0500556_0005755 3300053104 Bacteria 3507
295 Ga0500562_011161 3300053108 Bacteria 2281
296 Ga0500562_043207 3300053108 Bacteria 1199
297 Ga0500569_000421 3300053109 Bacteria 6901
298 Ga0500594_0000213 3300053118 Bacteria 14182
299 Ga0500595_006522 3300053119 Bacteria 4939
300 Ga0500595_028910 3300053119 Bacteria 1886
301 Ga0500595_038119 3300053119 Bacteria 1564
302 Ga0500607_164265 3300053121 Bacteria 1010
303 Ga0500608_000027 3300053122 Bacteria 66998
304 Ga0500608_000263 3300053122 Bacteria 20495
305 Ga0500608_073895 3300053122 Bacteria 1617
306 Ga0500608_203546 3300053122 Bacteria 816
307 Ga0500614_001139 3300053123 Bacteria 6529
308 Ga0500618_000556 3300053125 Bacteria 23170
309 Ga0500652_177541 3300053131 Bacteria 874
310 Ga0500655_052406 3300053133 Bacteria 814
311 Ga0500655_056168 3300053133 Bacteria 789
312 Ga0500658_0005774 3300053134 Bacteria 4611
313 Ga0500559_0000026 3300053136 Bacteria 120494
314 Ga0500559_0004190 3300053136 Bacteria 6912
315 Ga0500559_0010991 3300053136 Bacteria 3876
316 Ga0500559_0054508 3300053136 Bacteria 1771
317 Ga0500559_0115617 3300053136 Bacteria 1245
318 Ga0500564_002811 3300053138 Bacteria 6557
319 Ga0500564_157913 3300053138 Bacteria 962
320 Ga0500577_0000544 3300053142 Bacteria 9745
321 Ga0500577_0141859 3300053142 Bacteria 1014
322 Ga0500604_0183246 3300053151 Bacteria 718
323 Ga0500604_0276267 3300053151 Bacteria 582
324 Ga0500616_0011985 3300053153 Bacteria 5092
325 Ga0500616_0067374 3300053153 Bacteria 1836
326 Ga0500616_0110254 3300053153 Bacteria 1330
327 Ga0500622_0004461 3300053156 Bacteria 8777
328 Ga0500622_0007790 3300053156 Bacteria 6042
329 Ga0500622_0170983 3300053156 Bacteria 1011
330 Ga0500622_0312242 3300053156 Bacteria 665
331 Ga0500627_0193201 3300053158 Bacteria 913
332 Ga0500627_0359929 3300053158 Bacteria 626
333 Ga0500576_075883 3300053725 Bacteria 1433
334 Ga0500611_045472 3300053727 Bacteria 983
335 Ga0500625_049064 3300053729 Bacteria 1958
336 Ga0500645_000488 3300053730 Bacteria 26788
337 Ga0500645_002012 3300053730 Bacteria 9518
338 Ga0500645_002715 3300053730 Bacteria 7685
339 Ga0500645_041922 3300053730 Bacteria 1351
340 Ga0500609_000215 3300053731 Bacteria 8252
341 Ga0500596_000806 3300053735 Bacteria 6187
342 Ga0500661_077063 3300055283 Bacteria 614
343 Ga0466962_0013799 3300061719 Bacteria 3889
344 Ga0466962_0236017 3300061719 Bacteria 897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100053412 Ga0070660_1000534121 154
2 3300005366 Ga0070659_100009652 Ga0070659_1000096525 154
3 3300009551 Ga0105238_10088522 Ga0105238_100885222 154
4 3300013307 Ga0157372_11347248 Ga0157372_113472482 154
5 3300037418 Ga0395900_0000016 Ga0395900_0000016_247192_247746 154
6 3300037466 Ga0395898_0114378 Ga0395898_0114378_1028_1582 154
7 3300037471 Ga0395905_0048442 Ga0395905_0048442_1865_2419 154
8 3300038443 Ga0395901_0000022 Ga0395901_0000022_285267_285821 154
9 3300005336 Ga0070680_100018377 Ga0070680_1000183776 155
10 3300005339 Ga0070660_100196468 Ga0070660_1001964683 155
11 3300005347 Ga0070668_100004326 Ga0070668_1000043265 155
12 3300005366 Ga0070659_100090552 Ga0070659_1000905524 155
13 3300005366 Ga0070659_100903898 Ga0070659_1009038982 155
14 3300005457 Ga0070662_100333415 Ga0070662_1003334152 155
15 3300005458 Ga0070681_10019122 Ga0070681_100191222 155
16 3300005530 Ga0070679_100223963 Ga0070679_1002239632 155
17 3300005539 Ga0068853_100060359 Ga0068853_1000603591 155
18 3300005548 Ga0070665_100001251 Ga0070665_10000125115 155
19 3300005548 Ga0070665_100133841 Ga0070665_1001338412 155
20 3300005563 Ga0068855_100015436 Ga0068855_1000154369 155
21 3300005616 Ga0068852_100783858 Ga0068852_1007838581 155
22 3300005617 Ga0068859_100000078 Ga0068859_10000007867 155
23 3300005618 Ga0068864_100000038 Ga0068864_100000038161 155
24 3300005618 Ga0068864_101307182 Ga0068864_1013071821 155
25 3300005841 Ga0068863_100000026 Ga0068863_100000026160 155
26 3300005841 Ga0068863_100009509 Ga0068863_1000095093 155
27 3300005842 Ga0068858_100000117 Ga0068858_10000011746 155
28 3300005842 Ga0068858_100002020 Ga0068858_1000020208 155
29 3300005843 Ga0068860_100024685 Ga0068860_1000246852 155
30 3300005844 Ga0068862_100080950 Ga0068862_1000809505 155
31 3300006051 Ga0075364_10000185 Ga0075364_1000018516 155
32 3300006178 Ga0075367_10001931 Ga0075367_100019312 155
33 3300006186 Ga0075369_10067829 Ga0075369_100678292 155
34 3300006353 Ga0075370_10407953 Ga0075370_104079531 155
35 3300006931 Ga0097620_100000078 Ga0097620_10000007867 155
36 3300009093 Ga0105240_10944886 Ga0105240_109448862 155
37 3300009177 Ga0105248_10001538 Ga0105248_1000153823 155
38 3300009553 Ga0105249_10177199 Ga0105249_101771992 155
39 3300009553 Ga0105249_10220062 Ga0105249_102200622 155
40 3300010375 Ga0105239_10122124 Ga0105239_101221242 155
41 3300010375 Ga0105239_10617243 Ga0105239_106172431 155
42 3300013306 Ga0163162_10394891 Ga0163162_103948912 155
43 3300014325 Ga0163163_10060152 Ga0163163_100601523 155
44 3300025909 Ga0207705_10003865 Ga0207705_100038652 155
45 3300025911 Ga0207654_10279496 Ga0207654_102794962 155
46 3300025912 Ga0207707_10025833 Ga0207707_100258333 155
47 3300025917 Ga0207660_10002714 Ga0207660_1000271411 155
48 3300025919 Ga0207657_10001909 Ga0207657_1000190912 155
49 3300025921 Ga0207652_10011944 Ga0207652_100119446 155
50 3300025923 Ga0207681_10127849 Ga0207681_101278491 155
51 3300025924 Ga0207694_10015154 Ga0207694_100151544 155
52 3300025925 Ga0207650_10007481 Ga0207650_100074812 155
53 3300025925 Ga0207650_10108709 Ga0207650_101087092 155
54 3300025931 Ga0207644_10006035 Ga0207644_100060357 155
55 3300025932 Ga0207690_10720911 Ga0207690_107209112 155
56 3300025932 Ga0207690_10824685 Ga0207690_108246852 155
57 3300025941 Ga0207711_10011385 Ga0207711_100113856 155
58 3300025941 Ga0207711_10036056 Ga0207711_100360562 155
59 3300025949 Ga0207667_10005300 Ga0207667_100053008 155
60 3300025961 Ga0207712_10433392 Ga0207712_104333922 155
61 3300025961 Ga0207712_10565049 Ga0207712_105650491 155
62 3300025972 Ga0207668_10003269 Ga0207668_100032693 155
63 3300025986 Ga0207658_10008295 Ga0207658_100082954 155
64 3300026035 Ga0207703_10000087 Ga0207703_1000008733 155
65 3300026035 Ga0207703_10002821 Ga0207703_100028219 155
66 3300026041 Ga0207639_10265892 Ga0207639_102658922 155
67 3300026088 Ga0207641_10000005 Ga0207641_10000005365 155
68 3300026088 Ga0207641_10008875 Ga0207641_100088752 155
69 3300026095 Ga0207676_10000145 Ga0207676_1000014546 155
70 3300026095 Ga0207676_10177248 Ga0207676_101772483 155
71 3300026142 Ga0207698_11177130 Ga0207698_111771301 155
72 3300028379 Ga0268266_10000005 Ga0268266_10000005609 155
73 3300028379 Ga0268266_10151261 Ga0268266_101512611 155
74 3300028381 Ga0268264_10084868 Ga0268264_100848682 155
75 3300028786 Ga0307517_10002714 Ga0307517_1000271415 155
76 3300028786 Ga0307517_10064161 Ga0307517_100641612 155
77 3300030878 Ga0265770_1056034 Ga0265770_10560341 155
78 3300031251 Ga0265327_10000240 Ga0265327_1000024045 155
79 3300031456 Ga0307513_10001882 Ga0307513_1000188227 155
80 3300031456 Ga0307513_10012919 Ga0307513_1001291911 155
81 3300037471 Ga0395905_0181964 Ga0395905_0181964_703_1176 155
82 3300037471 Ga0395905_0552817 Ga0395905_0552817_412_885 155
83 3300037853 Ga0436364_0302255 Ga0436364_0302255_140_631 155
84 3300038443 Ga0395901_0041275 Ga0395901_0041275_1247_1720 155
85 3300039437 Ga0436365_0705032 Ga0436365_0705032_21_512 155
86 3300039438 Ga0436360_0049903 Ga0436360_0049903_203_676 155
87 3300046459 Ga0495629_0028529 Ga0495629_0028529_613_1086 155
88 3300046506 Ga0495583_0035101 Ga0495583_0035101_884_1357 155
89 3300046506 Ga0495583_0061777 Ga0495583_0061777_946_1419 155
90 3300046507 Ga0495606_0085742 Ga0495606_0085742_1204_1677 155
91 3300046515 Ga0495620_0030710 Ga0495620_0030710_851_1324 155
92 3300046520 Ga0495637_0092281 Ga0495637_0092281_681_1154 155
93 3300046522 Ga0495643_0014421 Ga0495643_0014421_2093_2566 155
94 3300046530 Ga0495654_0084997 Ga0495654_0084997_982_1455 155
95 3300046538 Ga0495609_0040517 Ga0495609_0040517_32_505 155
96 3300046542 Ga0495597_0019291 Ga0495597_0019291_1177_1650 155
97 3300046557 Ga0495622_0000401 Ga0495622_0000401_26410_26883 155
98 3300046616 Ga0495668_0132690 Ga0495668_0132690_455_928 155
99 3300046660 Ga0495625_0097750 Ga0495625_0097750_292_765 155
100 3300046660 Ga0495625_0142923 Ga0495625_0142923_601_1074 155
101 3300046660 Ga0495625_0264395 Ga0495625_0264395_625_1098 155
102 3300047443 Ga0495687_020793 Ga0495687_020793_2564_3037 155
103 3300047472 Ga0495686_0314191 Ga0495686_0314191_46_519 155
104 3300047673 Ga0495593_0027350 Ga0495593_0027350_1035_1508 155
105 3300048904 Ga0496101_0496400 Ga0496101_0496400_89_562 155
106 3300048905 Ga0496102_0103249 Ga0496102_0103249_946_1419 155
107 3300048905 Ga0496102_1219229 Ga0496102_1219229_83_556 155
108 3300048906 Ga0496103_0016604 Ga0496103_0016604_2650_3123 155
109 3300048909 Ga0496106_1144453 Ga0496106_1144453_46_519 155
110 3300048914 Ga0496111_0288438 Ga0496111_0288438_506_979 155
111 3300048919 Ga0496116_0068343 Ga0496116_0068343_716_1189 155
112 3300048920 Ga0496117_0034635 Ga0496117_0034635_1026_1499 155
113 3300048921 Ga0496118_0005429 Ga0496118_0005429_1595_2068 155
114 3300048922 Ga0496119_0016523 Ga0496119_0016523_2358_2831 155
115 3300048924 Ga0496121_0000059 Ga0496121_0000059_88817_89290 155
116 3300049460 Ga0495682_0074522 Ga0495682_0074522_671_1144 155
117 3300049581 Ga0501047_0001567 Ga0501047_0001567_7234_7707 155
118 3300049581 Ga0501047_0366119 Ga0501047_0366119_166_639 155
119 3300049679 Ga0501249_085917 Ga0501249_085917_202_678 155
120 3300050491 nmdc:mga00v17_1532_c1 nmdc:mga00v17_1532_c1_3763_4236 155
121 3300050494 nmdc:mga06z11_110762_c1 nmdc:mga06z11_110762_c1_26_499 155
122 3300050496 nmdc:mga07m45_474934_c1 nmdc:mga07m45_474934_c1_109_582 155
123 3300050516 nmdc:mga0sz30_139876_c1 nmdc:mga0sz30_139876_c1_25_498 155
124 3300053086 Ga0500578_0285420 Ga0500578_0285420_43_516 155
125 3300053087 Ga0500643_004887 Ga0500643_004887_1810_2283 155
126 3300053092 Ga0500583_0008051 Ga0500583_0008051_1460_1933 155
127 3300053093 Ga0500651_0057238 Ga0500651_0057238_768_1241 155
128 3300053094 Ga0500566_0074860 Ga0500566_0074860_1048_1521 155
129 3300053103 Ga0500555_012440 Ga0500555_012440_693_1166 155
130 3300053109 Ga0500569_000421 Ga0500569_000421_254_727 155
131 3300053119 Ga0500595_006522 Ga0500595_006522_3028_3501 155
132 3300053119 Ga0500595_028910 Ga0500595_028910_481_957 155
133 3300053119 Ga0500595_038119 Ga0500595_038119_70_558 155
134 3300053121 Ga0500607_164265 Ga0500607_164265_342_815 155
135 3300053122 Ga0500608_000263 Ga0500608_000263_16312_16785 155
136 3300053123 Ga0500614_001139 Ga0500614_001139_4618_5091 155
137 3300053131 Ga0500652_177541 Ga0500652_177541_175_648 155
138 3300053136 Ga0500559_0004190 Ga0500559_0004190_2791_3264 155
139 3300053142 Ga0500577_0141859 Ga0500577_0141859_272_745 155
140 3300053725 Ga0500576_075883 Ga0500576_075883_463_936 155
141 3300053729 Ga0500625_049064 Ga0500625_049064_885_1358 155
142 3300053730 Ga0500645_041922 Ga0500645_041922_507_980 155
143 3300053735 Ga0500596_000806 Ga0500596_000806_3028_3501 155
144 3300003320 rootH2_10232400 rootH2_102324002 156
145 3300005328 Ga0070676_10493879 Ga0070676_104938792 156
146 3300009177 Ga0105248_10792514 Ga0105248_107925141 156
147 3300013296 Ga0157374_10751392 Ga0157374_107513922 156
148 3300014969 Ga0157376_11091786 Ga0157376_110917861 156
149 3300025938 Ga0207704_10002124 Ga0207704_100021249 156
150 3300026023 Ga0207677_10495210 Ga0207677_104952102 156
151 3300026095 Ga0207676_10964805 Ga0207676_109648052 156
152 3300032004 Ga0307414_10019515 Ga0307414_100195152 156
153 3300049574 Ga0501038_0759575 Ga0501038_0759575_22_513 156
154 3300049581 Ga0501047_0047813 Ga0501047_0047813_266_808 156
155 3300049822 Ga0501035_0596515 Ga0501035_0596515_17_559 156
156 3300049823 Ga0501044_0001035 Ga0501044_0001035_17724_18266 156
157 iso_pu_bacteria 2643221663 2644352916 156
158 iso_pu_bacteria 2843744320 2843746254 156
159 iso_pu_bacteria 2849560528 2849562071 156
160 iso_pu_bacteria 2849573788 2849575875 156
161 iso_pu_bacteria 2851153111 2851156209 156
162 iso_pu_bacteria 2898329390 2898332007 156
163 3300003323 rootH1_10082687 rootH1_100826879 157
164 3300005539 Ga0068853_100040578 Ga0068853_1000405781 157
165 3300005614 Ga0068856_100104372 Ga0068856_1001043722 157
166 3300013100 Ga0157373_10006297 Ga0157373_100062972 157
167 3300013100 Ga0157373_10020344 Ga0157373_100203444 157
168 3300026041 Ga0207639_10022246 Ga0207639_100222462 157
169 3300028577 Ga0265318_10096391 Ga0265318_100963912 157
170 3300031240 Ga0265320_10198600 Ga0265320_101986002 157
171 3300031711 Ga0265314_10350066 Ga0265314_103500662 157
172 3300037466 Ga0395898_0171391 Ga0395898_0171391_391_891 157
173 3300037471 Ga0395905_0008767 Ga0395905_0008767_3099_3584 157
174 3300037471 Ga0395905_0198484 Ga0395905_0198484_948_1448 157
175 3300038443 Ga0395901_0026308 Ga0395901_0026308_3560_4060 157
176 3300044656 Ga0466969_0041142 Ga0466969_0041142_1072_1557 157
177 3300044684 Ga0466966_0004209 Ga0466966_0004209_355_840 157
178 3300044693 Ga0466961_0034299 Ga0466961_0034299_1711_2196 157
179 3300044694 Ga0466963_0294281 Ga0466963_0294281_286_771 157
180 3300044719 Ga0466971_0033724 Ga0466971_0033724_993_1478 157
181 3300044765 Ga0466970_0013076 Ga0466970_0013076_2954_3439 157
182 3300044842 Ga0466957_0232304 Ga0466957_0232304_277_762 157
183 3300045049 Ga0466959_0000443 Ga0466959_0000443_1125_1610 157
184 3300045836 Ga0466958_0014359 Ga0466958_0014359_3448_3933 157
185 3300046529 Ga0495652_0255099 Ga0495652_0255099_242_742 157
186 3300046689 Ga0495613_0004726 Ga0495613_0004726_405_905 157
187 3300047472 Ga0495686_0460654 Ga0495686_0460654_70_546 157
188 3300049570 Ga0501033_0605289 Ga0501033_0605289_189_683 157
189 3300053151 Ga0500604_0276267 Ga0500604_0276267_41_517 157
190 3300061719 Ga0466962_0013799 Ga0466962_0013799_452_937 157
191 iso_pu_bacteria 2510917020 2511123715 157
192 iso_pu_bacteria 2582581279 2585147575 157
193 iso_pu_bacteria 2582581280 2585154633 157
194 iso_pu_bacteria 2582581293 2585198348 157
195 iso_pu_bacteria 2585428106 2587915473 157
196 iso_pu_bacteria 2643221545 2643750009 157
197 iso_pu_bacteria 2643221552 2643779442 157
198 iso_pu_bacteria 2643221584 2643931012 157
199 iso_pu_bacteria 2643221640 2644224032 157
200 iso_pu_bacteria 2643221642 2644233018 157
201 iso_pu_bacteria 2643221691 2644510836 157
202 iso_pu_bacteria 2791355048 2792461548 157
203 iso_pu_bacteria 2818991435 2819535684 157
204 iso_pu_bacteria 2818991454 2819644959 157
205 iso_pu_bacteria 2857504554 2857507931 157
206 iso_pu_bacteria 2884960567 2884965776 157
207 iso_pu_bacteria 2928531327 2928534923 157
208 3300009551 Ga0105238_10195393 Ga0105238_101953932 158
209 3300025924 Ga0207694_10809332 Ga0207694_108093322 158
210 3300053087 Ga0500643_000122 Ga0500643_000122_38364_38858 158
211 3300053096 Ga0500641_0000708 Ga0500641_0000708_5420_5914 158
212 3300053098 Ga0500650_0271352 Ga0500650_0271352_109_603 158
213 3300053104 Ga0500556_0005755 Ga0500556_0005755_2834_3328 158
214 3300053108 Ga0500562_011161 Ga0500562_011161_155_649 158
215 3300053133 Ga0500655_052406 Ga0500655_052406_172_666 158
216 3300053136 Ga0500559_0115617 Ga0500559_0115617_188_664 158
217 3300053153 Ga0500616_0110254 Ga0500616_0110254_71_565 158
218 3300053730 Ga0500645_000488 Ga0500645_000488_1511_2005 158
219 3300053730 Ga0500645_002012 Ga0500645_002012_7138_7632 158
220 3300003323 rootH1_10015152 rootH1_100151522 159
221 3300006195 Ga0075366_10034462 Ga0075366_100344622 159
222 3300037471 Ga0395905_0000070 Ga0395905_0000070_54452_54943 159
223 3300044693 Ga0466961_0108904 Ga0466961_0108904_1188_1679 159
224 3300045049 Ga0466959_0150919 Ga0466959_0150919_175_666 159
225 3300046460 Ga0495638_0071994 Ga0495638_0071994_749_1228 159
226 3300046691 Ga0495670_0563021 Ga0495670_0563021_34_513 159
227 3300049579 Ga0501043_0099312 Ga0501043_0099312_1312_1800 159
228 3300049822 Ga0501035_0357729 Ga0501035_0357729_374_862 159
229 3300050493 nmdc:mga0k408_36337_c1 nmdc:mga0k408_36337_c1_95_574 159
230 3300053122 Ga0500608_203546 Ga0500608_203546_223_711 159
231 3300053727 Ga0500611_045472 Ga0500611_045472_361_840 159
232 3300061719 Ga0466962_0236017 Ga0466962_0236017_15_506 159
233 3300003322 rootL2_10202990 rootL2_102029903 160
234 3300013104 Ga0157370_10134829 Ga0157370_101348291 160
235 3300015684 Ga0183365_10001 Ga0183365_10001944 160
236 3300028794 Ga0307515_10051523 Ga0307515_100515233 160
237 3300028794 Ga0307515_10136418 Ga0307515_101364183 160
238 3300046453 Ga0495627_001241 Ga0495627_001241_14441_14923 160
239 3300046506 Ga0495583_0000005 Ga0495583_0000005_436345_436827 160
240 3300046524 Ga0495648_0080472 Ga0495648_0080472_1331_1816 160
241 3300046660 Ga0495625_0001463 Ga0495625_0001463_21089_21574 160
242 3300046692 Ga0495671_0307070 Ga0495671_0307070_167_649 160
243 3300047446 Ga0495679_011683 Ga0495679_011683_2068_2550 160
244 3300047469 Ga0495673_0000147 Ga0495673_0000147_69233_69715 160
245 3300048924 Ga0496121_0004510 Ga0496121_0004510_9663_10160 160
246 3300049571 Ga0501034_0042759 Ga0501034_0042759_2265_2759 160
247 3300049571 Ga0501034_0256581 Ga0501034_0256581_1162_1656 160
248 3300053102 Ga0500554_001541 Ga0500554_001541_56_541 160
249 3300053125 Ga0500618_000556 Ga0500618_000556_14505_14987 160
250 3300053133 Ga0500655_056168 Ga0500655_056168_110_595 160
251 3300053136 Ga0500559_0000026 Ga0500559_0000026_25755_26237 160
252 3300053142 Ga0500577_0000544 Ga0500577_0000544_6180_6662 160
253 3300003316 rootH1_10069759 rootH1_100697592 161
254 3300003320 rootH2_10015133 rootH2_100151335 161
255 3300003320 rootH2_10106815 rootH2_101068152 161
256 3300003322 rootL2_10141283 rootL2_101412832 161
257 3300003771 Ga0055526_1023515 Ga0055526_10235152 161
258 3300003773 Ga0055537_1000813 Ga0055537_10008135 161
259 3300003775 Ga0055524_1005450 Ga0055524_10054503 161
260 3300003775 Ga0055524_1066544 Ga0055524_10665441 161
261 3300003781 Ga0055536_1005094 Ga0055536_10050941 161
262 3300003781 Ga0055536_1008341 Ga0055536_10083411 161
263 3300003790 Ga0055528_1013764 Ga0055528_10137642 161
264 3300003791 Ga0055530_10015556 Ga0055530_100155563 161
265 3300003792 Ga0055540_1052616 Ga0055540_10526161 161
266 3300003794 Ga0055531_10001076 Ga0055531_100010761 161
267 3300003794 Ga0055531_10006484 Ga0055531_100064844 161
268 3300003794 Ga0055531_10055671 Ga0055531_100556713 161
269 3300003794 Ga0055531_10058243 Ga0055531_100582431 161
270 3300005262 Ga0065165_1001226 Ga0065165_100122620 161
271 3300005289 Ga0065704_10114707 Ga0065704_101147072 161
272 3300006195 Ga0075366_10022642 Ga0075366_100226425 161
273 3300025263 Ga0209565_1000065 Ga0209565_100006560 161
274 3300025273 Ga0209673_1001555 Ga0209673_100155514 161
275 3300025291 Ga0209675_1032481 Ga0209675_10324811 161
276 3300025292 Ga0209676_1000163 Ga0209676_100016384 161
277 3300025292 Ga0209676_1000188 Ga0209676_100018873 161
278 3300025295 Ga0209564_1035890 Ga0209564_10358903 161
279 3300025297 Ga0209758_1001051 Ga0209758_10010514 161
280 3300025297 Ga0209758_1004825 Ga0209758_10048256 161
281 3300025298 Ga0209050_1001123 Ga0209050_10011234 161
282 3300025298 Ga0209050_1001523 Ga0209050_100152321 161
283 3300025298 Ga0209050_1054560 Ga0209050_10545602 161
284 3300025299 Ga0209256_1002408 Ga0209256_100240810 161
285 3300025299 Ga0209256_1010683 Ga0209256_10106833 161
286 3300025303 Ga0209051_1003588 Ga0209051_10035884 161
287 3300025304 Ga0209257_1000074 Ga0209257_1000074176 161
288 3300025304 Ga0209257_1000370 Ga0209257_100037017 161
289 3300025304 Ga0209257_1007513 Ga0209257_10075136 161
290 3300041410 Ga0439461_0045009 Ga0439461_0045009_336_821 161
291 3300042156 Ga0439446_0052559 Ga0439446_0052559_676_1161 161
292 3300042438 Ga0439459_0003468 Ga0439459_0003468_1945_2430 161
293 3300044706 Ga0466964_0141775 Ga0466964_0141775_153_641 161
294 3300046457 Ga0495590_0002974 Ga0495590_0002974_501_989 161
295 3300046460 Ga0495638_0000320 Ga0495638_0000320_55290_55778 161
296 3300046460 Ga0495638_0001983 Ga0495638_0001983_10391_10876 161
297 3300046460 Ga0495638_0006690 Ga0495638_0006690_6282_6767 161
298 3300046460 Ga0495638_0007487 Ga0495638_0007487_862_1347 161
299 3300046460 Ga0495638_0098427 Ga0495638_0098427_26_511 161
300 3300046471 Ga0495650_0000045 Ga0495650_0000045_40010_40495 161
301 3300046507 Ga0495606_0007945 Ga0495606_0007945_4520_5005 161
302 3300046512 Ga0495610_0000073 Ga0495610_0000073_111217_111702 161
303 3300046512 Ga0495610_0207120 Ga0495610_0207120_83_568 161
304 3300046513 Ga0495616_0000653 Ga0495616_0000653_17625_18110 161
305 3300046513 Ga0495616_0034016 Ga0495616_0034016_40_525 161
306 3300046518 Ga0495631_0015895 Ga0495631_0015895_2766_3254 161
307 3300046519 Ga0495632_0028778 Ga0495632_0028778_49_534 161
308 3300046519 Ga0495632_0179162 Ga0495632_0179162_301_786 161
309 3300046520 Ga0495637_0018325 Ga0495637_0018325_1649_2137 161
310 3300046520 Ga0495637_0036917 Ga0495637_0036917_1148_1633 161
311 3300046520 Ga0495637_0115948 Ga0495637_0115948_274_759 161
312 3300046522 Ga0495643_0039923 Ga0495643_0039923_1165_1650 161
313 3300046524 Ga0495648_0000334 Ga0495648_0000334_7525_8013 161
314 3300046524 Ga0495648_0157627 Ga0495648_0157627_537_1022 161
315 3300046530 Ga0495654_0000018 Ga0495654_0000018_185337_185822 161
316 3300046542 Ga0495597_0145677 Ga0495597_0145677_48_542 161
317 3300046616 Ga0495668_0018611 Ga0495668_0018611_89_574 161
318 3300046616 Ga0495668_0080407 Ga0495668_0080407_1215_1700 161
319 3300046660 Ga0495625_0000157 Ga0495625_0000157_7526_8014 161
320 3300046660 Ga0495625_0003681 Ga0495625_0003681_9687_10172 161
321 3300046660 Ga0495625_0012116 Ga0495625_0012116_445_930 161
322 3300046660 Ga0495625_0022857 Ga0495625_0022857_1214_1702 161
323 3300046660 Ga0495625_0277540 Ga0495625_0277540_258_746 161
324 3300046691 Ga0495670_0167659 Ga0495670_0167659_221_709 161
325 3300046692 Ga0495671_0092835 Ga0495671_0092835_625_1110 161
326 3300046810 Ga0495660_0027110 Ga0495660_0027110_2038_2523 161
327 3300047323 Ga0495683_0229852 Ga0495683_0229852_157_642 161
328 3300047469 Ga0495673_0002690 Ga0495673_0002690_4715_5203 161
329 3300047470 Ga0495681_0041166 Ga0495681_0041166_208_693 161
330 3300047472 Ga0495686_0002204 Ga0495686_0002204_4754_5242 161
331 3300047472 Ga0495686_0011595 Ga0495686_0011595_1331_1816 161
332 3300047472 Ga0495686_0027673 Ga0495686_0027673_1294_1782 161
333 3300048924 Ga0496121_0287246 Ga0496121_0287246_34_519 161
334 3300048927 Ga0496124_0013574 Ga0496124_0013574_674_1165 161
335 3300048929 Ga0496126_0012275 Ga0496126_0012275_5471_5962 161
336 3300049459 Ga0495678_004008 Ga0495678_004008_7809_8297 161
337 3300049822 Ga0501035_0451576 Ga0501035_0451576_318_821 161
338 3300050493 nmdc:mga0k408_41152_c1 nmdc:mga0k408_41152_c1_267_755 161
339 3300050516 nmdc:mga0sz30_233700_c1 nmdc:mga0sz30_233700_c1_238_729 161
340 3300050516 nmdc:mga0sz30_56200_c1 nmdc:mga0sz30_56200_c1_316_807 161
341 3300053080 Ga0500635_0001956 Ga0500635_0001956_3873_4379 161
342 3300053086 Ga0500578_0000082 Ga0500578_0000082_49124_49612 161
343 3300053088 Ga0500644_0000650 Ga0500644_0000650_8682_9170 161
344 3300053103 Ga0500555_038867 Ga0500555_038867_622_1107 161
345 3300053103 Ga0500555_073961 Ga0500555_073961_66_572 161
346 3300053104 Ga0500556_0001245 Ga0500556_0001245_18_503 161
347 3300053108 Ga0500562_043207 Ga0500562_043207_329_817 161
348 3300053118 Ga0500594_0000213 Ga0500594_0000213_10174_10662 161
349 3300053122 Ga0500608_000027 Ga0500608_000027_13661_14155 161
350 3300053122 Ga0500608_073895 Ga0500608_073895_598_1107 161
351 3300053134 Ga0500658_0005774 Ga0500658_0005774_1811_2296 161
352 3300053136 Ga0500559_0010991 Ga0500559_0010991_214_699 161
353 3300053136 Ga0500559_0054508 Ga0500559_0054508_897_1403 161
354 3300053138 Ga0500564_002811 Ga0500564_002811_41_529 161
355 3300053138 Ga0500564_157913 Ga0500564_157913_23_508 161
356 3300053151 Ga0500604_0183246 Ga0500604_0183246_20_526 161
357 3300053153 Ga0500616_0011985 Ga0500616_0011985_3223_3729 161
358 3300053153 Ga0500616_0067374 Ga0500616_0067374_95_580 161
359 3300053156 Ga0500622_0004461 Ga0500622_0004461_4829_5317 161
360 3300053156 Ga0500622_0007790 Ga0500622_0007790_2612_3118 161
361 3300053156 Ga0500622_0170983 Ga0500622_0170983_167_661 161
362 3300053156 Ga0500622_0312242 Ga0500622_0312242_83_571 161
363 3300053158 Ga0500627_0193201 Ga0500627_0193201_119_604 161
364 3300053158 Ga0500627_0359929 Ga0500627_0359929_82_588 161
365 3300053730 Ga0500645_002715 Ga0500645_002715_238_723 161
366 3300053731 Ga0500609_000215 Ga0500609_000215_2506_2991 161
367 3300055283 Ga0500661_077063 Ga0500661_077063_42_530 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03692

CxxCxxCC

Putative zinc- or iron-chelating domain

58

127

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lvt-assembly2.cif.gz_B structure of hu protein from lactococcus lactis 0.5511 32 46
3doh-assembly1.cif.gz_B crystal structure of a thermostable esterase 0.4954 29 46
7z6r-assembly1.cif.gz_A psychrobacter arcticus atpprt (hisgz) r56a mutant bound to atp and prpp 0.4682 22 46
6zhh-assembly2.cif.gz_B ca2+-atpase from listeria monocytogenes with g4 insertion. 0.4434 12 44
8bf5-assembly1.cif.gz_B early transcription elongation state of influenza a/h7n9 polymerase stalled with incoming gtp analogue 0.4351 22 49
ID Description Score Start End Superfamily
af_C6T936_31_286_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6906 33 47 1.10.510.10
af_Q04149_350_493_3.40.50.10130 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6574 33 51 3.40.50.10130
1pl3B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cellobiose dehydrogenase, cytochrome domain 0.6447 33 47 2.60.40.1210
af_Q5ANJ0_28_112_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6298 33 47 3.30.200.20
4qi3B00 Mainly Beta;Sandwich;Immunoglobulin-like;Cellobiose dehydrogenase, cytochrome domain 0.6182 32 47 2.60.40.1210
ID Description Score Start End GO Terms
AF-A0A2D2AVS4-F1-model_v4 UPF0260 protein CSW64_06685 0.9911 2 158
AF-A0A2G5QTP0-F1-model_v4 UPF0260 protein CSW62_21105 0.9845 1 161
AF-A0A841M072-F1-model_v4 deleted 0.9832 15 161
AF-A0A1G4RCE1-F1-model_v4 UPF0260 protein SAMN02927928_1732 0.9828 2 154
AF-A0A258CHI0-F1-model_v4 deleted 0.9797 1 153

Feature Viewer

pLDDT pTM Quality
91.43 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map