F424160

General Info

Members Datasets Scaffolds Average Seq Length
366 234 732 429

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_1784_c1|nmdc:mga07m45_1784_c1_7756_9168
Length 470
Sequence LADGRPHREVGDPGASTVDLKNCAEILVDDHRRSRTVNIDPAATAWLLASTALVLLMTPGLAIFYGGMVRSTGVLNMIMMSLISIPLVTVAWLLVGYSLAFSDGSAGGFLGGLAHVGMRGIGPETAHGSVPELLYATFQLGFAIITIALVSGAIADRAKFAAWMVFVPIWAVAVYSVVAHWVWGPDGWLFKMGVLDYAGGLVVEIVSGSSALALALVLGPRIGFKVEAMRPHNLPLVVLGVGLLWFGWFGFNAGSALAANGLAAAIFLNTLVAGCLGMLGWLSVEQVRDGRPTTFGAASGVVAGLVAITPSCGTVNTLGSAVVGLVAGIVCSFAVGVKFKLNYDDSLDVVGVHFVGGVVGVLLIGLLATAVMTHGANGLFFGGGLGQLGKQCLAMVVVGLYAFAVSYVLAMLIERLMGFRVSGEDEVRGVDLTQHAETAYTEGVYGHQQLRRPPLSDRDESRPRLDDEDD

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 2547132424 Nocardia nova SH22a Isolate Unclassified
203 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
204 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
205 2643221692 Nocardia sp. Root136 Isolate Unclassified
206 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
207 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
208 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
209 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
210 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
211 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
212 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
213 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
214 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
215 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
216 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
217 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
218 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
219 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
220 2862574272 Streptomyces sp. AcE210 Isolate Nodule
221 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
222 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
223 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
224 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
225 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
226 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
227 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
228 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
229 2922554459 Rhodococcus sp. 66b Isolate Unclassified
230 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
231 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
232 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
233 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
234 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.71
Metatranscriptomes 0.27
Isolates 9.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.93
Nodule 0.27
Rhizoplane 10.66
Rhizosphere 61.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_1784_c1 3300050496 Bacteria 9294
2 JGI24737J22298_10007333 3300001990 Bacteria 3728
3 Ga0055540_1000271 3300003792 Bacteria 46708
4 Ga0070658_10008537 3300005327 Bacteria 8236
5 Ga0070658_10021470 3300005327 Bacteria 5174
6 Ga0070658_10083200 3300005327 Bacteria 2630
7 Ga0070683_100198431 3300005329 Bacteria 1905
8 Ga0070666_10061422 3300005335 Bacteria 2544
9 Ga0070660_100042596 3300005339 Bacteria 3466
10 Ga0070661_100058936 3300005344 Bacteria 2814
11 Ga0070668_100002308 3300005347 Bacteria 14055
12 Ga0070668_100042515 3300005347 Bacteria 3483
13 Ga0070668_100149367 3300005347 Bacteria 1888
14 Ga0070671_100002280 3300005355 Bacteria 14806
15 Ga0070671_100164975 3300005355 Bacteria 1873
16 Ga0070659_100121165 3300005366 Bacteria 2119
17 Ga0070667_100003096 3300005367 Bacteria 14309
18 Ga0070667_100016414 3300005367 Bacteria 6127
19 Ga0070667_100057779 3300005367 Bacteria 3279
20 Ga0070714_100018330 3300005435 Bacteria 5685
21 Ga0070713_100050197 3300005436 Bacteria 3445
22 Ga0070713_100142730 3300005436 Bacteria 2123
23 Ga0070663_100184018 3300005455 Bacteria 1622
24 Ga0070678_100065636 3300005456 Bacteria 2695
25 Ga0070662_100032859 3300005457 Bacteria 3649
26 Ga0070681_10153472 3300005458 Bacteria 2228
27 Ga0070679_100024920 3300005530 Bacteria 5865
28 Ga0070679_100152440 3300005530 Bacteria 2288
29 Ga0070684_100135471 3300005535 Bacteria 2224
30 Ga0070672_100017031 3300005543 Bacteria 5220
31 Ga0070665_100016080 3300005548 Bacteria 7508
32 Ga0070665_100212549 3300005548 Bacteria 1935
33 Ga0068855_100330805 3300005563 Bacteria 1682
34 Ga0070664_100016500 3300005564 Bacteria 6055
35 Ga0068857_100250139 3300005577 Bacteria 1625
36 Ga0068856_100066332 3300005614 Bacteria 3567
37 Ga0068852_100049413 3300005616 Bacteria 3599
38 Ga0068859_100022423 3300005617 Bacteria 6331
39 Ga0068863_100024520 3300005841 Bacteria 5753
40 Ga0068858_100088347 3300005842 Bacteria 2884
41 Ga0068860_100146785 3300005843 Bacteria 2270
42 Ga0081455_10051361 3300005937 Bacteria 3537
43 Ga0081455_10098200 3300005937 Bacteria 2358
44 Ga0081538_10044960 3300005981 Bacteria 2745
45 Ga0081538_10086534 3300005981 Bacteria 1640
46 Ga0081539_10053762 3300005985 Bacteria 2253
47 Ga0075365_10005770 3300006038 Bacteria 6720
48 Ga0075365_10020664 3300006038 Bacteria 4088
49 Ga0075365_10046808 3300006038 Bacteria 2842
50 Ga0075365_10074035 3300006038 Bacteria 2297
51 Ga0075363_100000475 3300006048 Bacteria 12649
52 Ga0075363_100005281 3300006048 Bacteria 5732
53 Ga0075363_100011109 3300006048 Bacteria 4302
54 Ga0075363_100013254 3300006048 Bacteria 3990
55 Ga0075363_100014391 3300006048 Bacteria 3864
56 Ga0075363_100037050 3300006048 Bacteria 2560
57 Ga0075363_100055678 3300006048 Bacteria 2119
58 Ga0075364_10001811 3300006051 Bacteria 11837
59 Ga0075364_10101223 3300006051 Bacteria 1918
60 Ga0075364_10106239 3300006051 Bacteria 1871
61 Ga0075362_10013917 3300006177 Bacteria 3234
62 Ga0075367_10046603 3300006178 Bacteria 2547
63 Ga0075369_10002080 3300006186 Bacteria 7068
64 Ga0075370_10001152 3300006353 Bacteria 11103
65 Ga0075370_10020367 3300006353 Bacteria 3624
66 Ga0075370_10035145 3300006353 Bacteria 2812
67 Ga0075428_100000535 3300006844 Bacteria 38719
68 Ga0075428_100179936 3300006844 Bacteria 2289
69 Ga0075430_100000880 3300006846 Bacteria 23584
70 Ga0075430_100075021 3300006846 Bacteria 2836
71 Ga0075431_100002883 3300006847 Bacteria 16640
72 Ga0075429_100001129 3300006880 Bacteria 21525
73 Ga0075429_100208986 3300006880 Bacteria 1710
74 Ga0097620_100022423 3300006931 Bacteria 6331
75 Ga0105250_10000003 3300009092 Bacteria 547770
76 Ga0105250_10042649 3300009092 Bacteria 1818
77 Ga0105245_10071371 3300009098 Bacteria 3154
78 Ga0105247_10001870 3300009101 Bacteria 14740
79 Ga0114129_10001321 3300009147 Bacteria 33161
80 Ga0114129_10041859 3300009147 Bacteria 6449
81 Ga0105243_10021398 3300009148 Bacteria 4909
82 Ga0105248_10092369 3300009177 Bacteria 3409
83 Ga0105237_10302269 3300009545 Bacteria 1603
84 Ga0105239_10125235 3300010375 Bacteria 2855
85 Ga0157369_10015186 3300013105 Bacteria 8692
86 Ga0157369_10121755 3300013105 Bacteria 2768
87 Ga0163162_10240826 3300013306 Bacteria 1940
88 Ga0157372_10375909 3300013307 Bacteria 1656
89 Ga0163163_10066656 3300014325 Bacteria 3576
90 Ga0182008_10000192 3300014497 Bacteria 48269
91 Ga0182007_10000165 3300015262 Bacteria 45550
92 Ga0213876_10000327 3300021384 Bacteria 41631
93 Ga0213876_10000356 3300021384 Bacteria 39321
94 Ga0209051_1000158 3300025303 Bacteria 127723
95 Ga0209051_1010406 3300025303 Bacteria 4700
96 Ga0207696_1000004 3300025711 Bacteria 671626
97 Ga0207710_10003425 3300025900 Bacteria 7081
98 Ga0207680_10055912 3300025903 Bacteria 2381
99 Ga0207647_10104435 3300025904 Bacteria 1679
100 Ga0207699_10054778 3300025906 Bacteria 2370
101 Ga0207705_10085386 3300025909 Bacteria 2306
102 Ga0207671_10133359 3300025914 Bacteria 1908
103 Ga0207657_10011589 3300025919 Bacteria 8745
104 Ga0207650_10119750 3300025925 Bacteria 2048
105 Ga0207690_10112963 3300025932 Bacteria 1960
106 Ga0207706_10037346 3300025933 Bacteria 4314
107 Ga0207709_10004390 3300025935 Bacteria 8166
108 Ga0207691_10028237 3300025940 Bacteria 5255
109 Ga0207661_10085428 3300025944 Bacteria 2615
110 Ga0207679_10034664 3300025945 Bacteria 3563
111 Ga0207679_10100774 3300025945 Bacteria 2258
112 Ga0207668_10008231 3300025972 Bacteria 6213
113 Ga0207668_10066951 3300025972 Bacteria 2548
114 Ga0207658_10037111 3300025986 Bacteria 3498
115 Ga0207678_10009810 3300026067 Bacteria 8420
116 Ga0207678_10206027 3300026067 Bacteria 1682
117 Ga0207674_10037821 3300026116 Bacteria 5014
118 Ga0207674_10275680 3300026116 Bacteria 1630
119 Ga0268266_10011781 3300028379 Bacteria 7582
120 Ga0268264_10054893 3300028381 Bacteria 3328
121 Ga0265327_10001089 3300031251 Bacteria 37752
122 Ga0307513_10062921 3300031456 Bacteria 3919
123 Ga0307405_10013499 3300031731 Bacteria 4360
124 Ga0307413_10007345 3300031824 Bacteria 5110
125 Ga0307413_10141154 3300031824 Bacteria 1665
126 Ga0307410_10031525 3300031852 Bacteria 3403
127 Ga0307406_10007459 3300031901 Bacteria 6064
128 Ga0307406_10036250 3300031901 Bacteria 3038
129 Ga0307409_100006266 3300031995 Bacteria 6968
130 Ga0307409_100011772 3300031995 Bacteria 5537
131 Ga0307409_100089959 3300031995 Bacteria 2511
132 Ga0307416_100003829 3300032002 Bacteria 8942
133 Ga0307416_100094498 3300032002 Bacteria 2578
134 Ga0307415_100000049 3300032126 Bacteria 51581
135 Ga0307415_100003260 3300032126 Bacteria 8244
136 Ga0307415_100025890 3300032126 Bacteria 3691
137 Ga0373962_0005182 3300035242 Bacteria 3151
138 Ga0395899_0005790 3300037312 Bacteria 9589
139 Ga0395898_0193909 3300037466 Bacteria 1941
140 Ga0395901_0076263 3300038443 Bacteria 3497
141 Ga0395901_0205552 3300038443 Bacteria 2063
142 Ga0436365_0173513 3300039437 Bacteria 54651
143 Ga0436365_0235622 3300039437 Bacteria 20171
144 Ga0436365_0320908 3300039437 Bacteria 22071
145 Ga0436363_1495385 3300039450 Bacteria 1599
146 Ga0439465_0010853 3300041413 Bacteria 2858
147 Ga0451833_1154318 3300041491 Bacteria 1801
148 Ga0439434_0009274 3300042435 Bacteria 2891
149 Ga0439459_0008530 3300042438 Bacteria 1754
150 Ga0466972_0062332 3300044658 Bacteria 1787
151 Ga0466965_0026584 3300044683 Bacteria 2806
152 Ga0466965_0067646 3300044683 Bacteria 1793
153 Ga0466966_0009377 3300044684 Bacteria 6479
154 Ga0466961_0042591 3300044693 Bacteria 2910
155 Ga0466961_0079833 3300044693 Bacteria 2071
156 Ga0466961_0113432 3300044693 Bacteria 1704
157 Ga0466963_0079590 3300044694 Bacteria 2217
158 Ga0466964_0014586 3300044706 Bacteria 2989
159 Ga0466968_0002525 3300044735 Bacteria 6725
160 Ga0466968_0016524 3300044735 Bacteria 2939
161 Ga0466970_0039031 3300044765 Bacteria 2519
162 Ga0466970_0090202 3300044765 Bacteria 1663
163 Ga0466957_0067128 3300044842 Bacteria 2212
164 Ga0466960_0060541 3300044901 Bacteria 1856
165 Ga0466960_0081247 3300044901 Bacteria 1634
166 Ga0466959_0031232 3300045049 Bacteria 3941
167 Ga0466958_0074914 3300045836 Bacteria 2075
168 Ga0466967_0014200 3300045976 Bacteria 6193
169 Ga0466967_0014979 3300045976 Bacteria 6063
170 Ga0466967_0019211 3300045976 Bacteria 5489
171 Ga0466967_0021779 3300045976 Bacteria 5215
172 Ga0466967_0085280 3300045976 Bacteria 2859
173 Ga0466967_0100163 3300045976 Bacteria 2647
174 Ga0495603_0001722 3300046455 Bacteria 12888
175 Ga0495603_0005436 3300046455 Bacteria 7604
176 Ga0495629_0000345 3300046459 Bacteria 39755
177 Ga0495629_0003047 3300046459 Bacteria 12740
178 Ga0495629_0012722 3300046459 Bacteria 6093
179 Ga0495629_0044978 3300046459 Bacteria 3098
180 Ga0495638_0012480 3300046460 Bacteria 5821
181 Ga0495585_0033137 3300046492 Bacteria 2926
182 Ga0495594_0000187 3300046499 Bacteria 30127
183 Ga0495594_0141425 3300046499 Bacteria 1365
184 Ga0495606_0117883 3300046507 Bacteria 1593
185 Ga0495642_0012399 3300046528 Bacteria 3287
186 Ga0495665_0037922 3300046531 Bacteria 2571
187 Ga0495640_0067582 3300046533 Bacteria 2407
188 Ga0495621_0000810 3300046539 Bacteria 7910
189 Ga0495622_0031770 3300046557 Bacteria 2466
190 Ga0495622_0032708 3300046557 Bacteria 2428
191 Ga0495656_0061446 3300046615 Bacteria 1641
192 Ga0495668_0000990 3300046616 Bacteria 30837
193 Ga0495668_0040970 3300046616 Bacteria 2582
194 Ga0495668_0081059 3300046616 Bacteria 1781
195 Ga0495611_0037961 3300046648 Bacteria 2141
196 Ga0495625_0080122 3300046660 Bacteria 2275
197 Ga0495659_0051865 3300046664 Bacteria 1495
198 Ga0495588_0005197 3300046674 Bacteria 5785
199 Ga0495613_0001688 3300046689 Bacteria 16817
200 Ga0495613_0076627 3300046689 Bacteria 2433
201 Ga0495581_0019369 3300047315 Bacteria 3951
202 Ga0495672_0044052 3300047320 Bacteria 2679
203 Ga0495676_0048455 3300047321 Bacteria 3425
204 Ga0495686_0114845 3300047472 Bacteria 1611
205 Ga0495614_0008464 3300048089 Bacteria 4574
206 Ga0496100_0000026 3300048903 Bacteria 115873
207 Ga0496101_0000015 3300048904 Bacteria 252368
208 Ga0496101_0053762 3300048904 Bacteria 2906
209 Ga0496101_0216695 3300048904 Bacteria 1485
210 Ga0496101_0234146 3300048904 Bacteria 1428
211 Ga0496101_0246530 3300048904 Bacteria 1391
212 Ga0496102_0000090 3300048905 Bacteria 127346
213 Ga0496102_0028594 3300048905 Bacteria 4981
214 Ga0496102_0114026 3300048905 Bacteria 2522
215 Ga0496102_0117812 3300048905 Bacteria 2478
216 Ga0496102_0120193 3300048905 Bacteria 2453
217 Ga0496103_0000034 3300048906 Bacteria 189284
218 Ga0496103_0000653 3300048906 Bacteria 26243
219 Ga0496103_0033393 3300048906 Bacteria 3143
220 Ga0496103_0063406 3300048906 Bacteria 2302
221 Ga0496104_0020554 3300048907 Bacteria 6052
222 Ga0496106_0001036 3300048909 Bacteria 20452
223 Ga0496106_0032630 3300048909 Bacteria 3883
224 Ga0496107_0005143 3300048910 Bacteria 8927
225 Ga0496107_0159719 3300048910 Bacteria 1670
226 Ga0496108_0003363 3300048911 Bacteria 12839
227 Ga0496108_0102733 3300048911 Bacteria 2439
228 Ga0496109_0000022 3300048912 Bacteria 188901
229 Ga0496109_0006537 3300048912 Bacteria 9815
230 Ga0496109_0464486 3300048912 Bacteria 1195
231 Ga0496110_0004695 3300048913 Bacteria 10626
232 Ga0496110_0008843 3300048913 Bacteria 8114
233 Ga0496110_0022272 3300048913 Bacteria 5378
234 Ga0496110_0169895 3300048913 Bacteria 1978
235 Ga0496111_0017138 3300048914 Bacteria 5003
236 Ga0496111_0215760 3300048914 Bacteria 1425
237 Ga0496112_0024363 3300048915 Bacteria 5792
238 Ga0496112_0028916 3300048915 Bacteria 5356
239 Ga0496112_0422472 3300048915 Bacteria 1272
240 Ga0496113_0099924 3300048916 Bacteria 2247
241 Ga0496114_0000107 3300048917 Bacteria 59739
242 Ga0496114_0000681 3300048917 Bacteria 25219
243 Ga0496114_0053846 3300048917 Bacteria 3354
244 Ga0496115_0006687 3300048918 Bacteria 8458
245 Ga0496116_0060498 3300048919 Bacteria 2456
246 Ga0496117_0066013 3300048920 Bacteria 2456
247 Ga0496118_0008887 3300048921 Bacteria 10267
248 Ga0496118_0024738 3300048921 Bacteria 5172
249 Ga0496119_0019666 3300048922 Bacteria 4960
250 Ga0496119_0061814 3300048922 Bacteria 2234
251 Ga0496120_0019628 3300048923 Bacteria 4318
252 Ga0496120_0090729 3300048923 Bacteria 1633
253 Ga0496121_0000004 3300048924 Bacteria 1139011
254 Ga0496121_0105322 3300048924 Bacteria 2165
255 Ga0496122_0000257 3300048925 Bacteria 120176
256 Ga0496123_0004950 3300048926 Bacteria 13652
257 Ga0496123_0029271 3300048926 Bacteria 4059
258 Ga0496124_0000012 3300048927 Bacteria 512581
259 Ga0496125_0000003 3300048928 Bacteria 1189767
260 Ga0496125_0066968 3300048928 Bacteria 2833
261 Ga0496125_0094280 3300048928 Bacteria 2231
262 Ga0496126_0000001 3300048929 Bacteria 1139011
263 Ga0496126_0004298 3300048929 Bacteria 17126
264 Ga0496126_0005657 3300048929 Bacteria 14203
265 Ga0501316_002380 3300049532 Bacteria 1739
266 Ga0501032_0013367 3300049569 Bacteria 5842
267 Ga0501032_0014519 3300049569 Bacteria 5576
268 Ga0501033_0002354 3300049570 Bacteria 16122
269 Ga0501034_0000515 3300049571 Bacteria 62133
270 Ga0501034_0049368 3300049571 Bacteria 4245
271 Ga0501034_0124797 3300049571 Bacteria 2560
272 Ga0501034_0128799 3300049571 Bacteria 2515
273 Ga0501034_0149392 3300049571 Bacteria 2313
274 Ga0501036_0044674 3300049572 Bacteria 3753
275 Ga0501037_0004174 3300049573 Bacteria 10477
276 Ga0501037_0109713 3300049573 Bacteria 1988
277 Ga0501038_0039014 3300049574 Bacteria 4156
278 Ga0501039_0003162 3300049575 Bacteria 12319
279 Ga0501039_0047956 3300049575 Bacteria 3302
280 Ga0501043_0002282 3300049579 Bacteria 16285
281 Ga0501043_0009401 3300049579 Bacteria 7674
282 Ga0501043_0016815 3300049579 Bacteria 5733
283 Ga0501046_0000148 3300049580 Bacteria 74147
284 Ga0501046_0008794 3300049580 Bacteria 8771
285 Ga0501046_0018395 3300049580 Bacteria 5815
286 Ga0501047_0000195 3300049581 Bacteria 73381
287 Ga0501047_0011816 3300049581 Bacteria 8258
288 Ga0501048_0001136 3300049582 Bacteria 19978
289 Ga0501048_0004381 3300049582 Bacteria 10750
290 Ga0501069_0062110 3300049585 Bacteria 2086
291 Ga0501070_0012686 3300049586 Bacteria 7107
292 Ga0501070_0049844 3300049586 Bacteria 3476
293 Ga0501070_0102922 3300049586 Bacteria 2361
294 Ga0501073_0121853 3300049589 Bacteria 1807
295 Ga0501080_0223496 3300049742 Bacteria 1722
296 Ga0501035_0003765 3300049822 Bacteria 14451
297 Ga0501035_0202471 3300049822 Bacteria 1701
298 Ga0501044_0003964 3300049823 Bacteria 16580
299 Ga0501044_0008009 3300049823 Bacteria 11613
300 Ga0501044_0212729 3300049823 Bacteria 1887
301 nmdc:mga03683_61146_c1 3300050489 Bacteria 1592
302 nmdc:mga03n38_22362_c1 3300050490 Bacteria 2558
303 nmdc:mga03n38_25631_c1 3300050490 Bacteria 2425
304 nmdc:mga03n38_75890_c1 3300050490 Bacteria 1567
305 nmdc:mga03n38_9428_c1 3300050490 Bacteria 3553
306 nmdc:mga03n38_9699_c1 3300050490 Bacteria 3512
307 nmdc:mga00v17_48638_c1 3300050491 Bacteria 2570
308 nmdc:mga00v17_70776_c1 3300050491 Bacteria 2161
309 nmdc:mga00v17_9744_c1 3300050491 Bacteria 5214
310 nmdc:mga0yw44_383_c1 3300050492 Bacteria 15385
311 nmdc:mga0yw44_4218_c1 3300050492 Bacteria 4534
312 nmdc:mga06z11_117796_c1 3300050494 Bacteria 1478
313 nmdc:mga07m45_28787_c1 3300050496 Bacteria 3067
314 nmdc:mga07m45_41320_c1 3300050496 Bacteria 2582
315 nmdc:mga07m45_728_c1 3300050496 Bacteria 14018
316 nmdc:mga05p37_238_c1 3300050507 Bacteria 56124
317 nmdc:mga09592_6831_c1 3300050508 Bacteria 9289
318 nmdc:mga0qj67_18868_c1 3300050509 Bacteria 5262
319 nmdc:mga0qj67_67998_c1 3300050509 Bacteria 2839
320 nmdc:mga06r32_27843_c1 3300050510 Bacteria 5284
321 nmdc:mga0sz30_10001_c1 3300050516 Bacteria 3627
322 nmdc:mga0sz30_3739_c1 3300050516 Bacteria 5485
323 nmdc:mga0sz30_38667_c1 3300050516 Bacteria 2000
324 Ga0500635_0044890 3300053080 Bacteria 1493
325 Ga0500641_0023749 3300053096 Bacteria 2360
326 Ga0500652_001006 3300053131 Bacteria 9209
327 Ga0500559_0040152 3300053136 Bacteria 2037
328 Ga0500577_0020191 3300053142 Bacteria 2175
329 Ga0500616_0004426 3300053153 Bacteria 10019
330 Ga0500616_0011011 3300053153 Bacteria 5383
331 Ga0500627_0011278 3300053158 Bacteria 3294
332 Ga0500645_000020 3300053730 Bacteria 134162
333 Ga0466962_0026264 3300061719 Bacteria 2796
334 2548692546 2547132424 Bacteria 8348532
335 2552105082 2551306166 Bacteria 9731570
336 2566994467 2565956761 Bacteria 6601618
337 2644517228 2643221692 Bacteria 7282860
338 2644635969 2643221715 Bacteria 6671032
339 2738667897 2738541264 Bacteria 5935393
340 2738706427 2738541274 Bacteria 6909446
341 2738890976 2738541308 Bacteria 7020677
342 2739146967 2738541356 Bacteria 5935017
343 2739206264 2738543005 Bacteria 5278128
344 2739239169 2738543011 Bacteria 5731169
345 2739328918 2738543028 Bacteria 6917070
346 2753035534 2751185725 Bacteria 5740550
347 2753326440 2751185792 Bacteria 5739090
348 2812373569 2811994882 Bacteria 4688362
349 2816428031 2816332119 Bacteria 8120218
350 2819698762 2818991463 Bacteria 7948711
351 2857713014 2857710386 Bacteria 3186771
352 2862580065 2862574272 Bacteria 10567477
353 2889304123 2889300758 Bacteria 5690814
354 2891403792 2891395885 Bacteria 9251614
355 2891559799 2891554331 Bacteria 8812224
356 2902794254 2902792274 Bacteria 7270173
357 2902804194 2902799365 Bacteria 5419524
358 2902811950 2902810491 Bacteria 6794147
359 2904535994 2904535858 Bacteria 6308016
360 2919714665 2919713450 Bacteria 7431245
361 2922555961 2922554459 Bacteria 6683962
362 2928147240 2928142448 Bacteria 5288925
363 2939586053 2939582691 Bacteria 7088898
364 2939745483 2939743619 Bacteria 5762299
365 2966599856 2966598605 Bacteria 7676064
366 3003008366 3002998708 Bacteria 11715108
367 nmdc:mga07m45_1784_c1
368 JGI24737J22298_10007333
369 Ga0055540_1000271
370 Ga0070658_10008537
371 Ga0070658_10021470
372 Ga0070658_10083200
373 Ga0070683_100198431
374 Ga0070666_10061422
375 Ga0070660_100042596
376 Ga0070661_100058936
377 Ga0070668_100002308
378 Ga0070668_100042515
379 Ga0070668_100149367
380 Ga0070671_100002280
381 Ga0070671_100164975
382 Ga0070659_100121165
383 Ga0070667_100003096
384 Ga0070667_100016414
385 Ga0070667_100057779
386 Ga0070714_100018330
387 Ga0070713_100050197
388 Ga0070713_100142730
389 Ga0070663_100184018
390 Ga0070678_100065636
391 Ga0070662_100032859
392 Ga0070681_10153472
393 Ga0070679_100024920
394 Ga0070679_100152440
395 Ga0070684_100135471
396 Ga0070672_100017031
397 Ga0070665_100016080
398 Ga0070665_100212549
399 Ga0068855_100330805
400 Ga0070664_100016500
401 Ga0068857_100250139
402 Ga0068856_100066332
403 Ga0068852_100049413
404 Ga0068859_100022423
405 Ga0068863_100024520
406 Ga0068858_100088347
407 Ga0068860_100146785
408 Ga0081455_10051361
409 Ga0081455_10098200
410 Ga0081538_10044960
411 Ga0081538_10086534
412 Ga0081539_10053762
413 Ga0075365_10005770
414 Ga0075365_10020664
415 Ga0075365_10046808
416 Ga0075365_10074035
417 Ga0075363_100000475
418 Ga0075363_100005281
419 Ga0075363_100011109
420 Ga0075363_100013254
421 Ga0075363_100014391
422 Ga0075363_100037050
423 Ga0075363_100055678
424 Ga0075364_10001811
425 Ga0075364_10101223
426 Ga0075364_10106239
427 Ga0075362_10013917
428 Ga0075367_10046603
429 Ga0075369_10002080
430 Ga0075370_10001152
431 Ga0075370_10020367
432 Ga0075370_10035145
433 Ga0075428_100000535
434 Ga0075428_100179936
435 Ga0075430_100000880
436 Ga0075430_100075021
437 Ga0075431_100002883
438 Ga0075429_100001129
439 Ga0075429_100208986
440 Ga0097620_100022423
441 Ga0105250_10000003
442 Ga0105250_10042649
443 Ga0105245_10071371
444 Ga0105247_10001870
445 Ga0114129_10001321
446 Ga0114129_10041859
447 Ga0105243_10021398
448 Ga0105248_10092369
449 Ga0105237_10302269
450 Ga0105239_10125235
451 Ga0157369_10015186
452 Ga0157369_10121755
453 Ga0163162_10240826
454 Ga0157372_10375909
455 Ga0163163_10066656
456 Ga0182008_10000192
457 Ga0182007_10000165
458 Ga0213876_10000327
459 Ga0213876_10000356
460 Ga0209051_1000158
461 Ga0209051_1010406
462 Ga0207696_1000004
463 Ga0207710_10003425
464 Ga0207680_10055912
465 Ga0207647_10104435
466 Ga0207699_10054778
467 Ga0207705_10085386
468 Ga0207671_10133359
469 Ga0207657_10011589
470 Ga0207650_10119750
471 Ga0207690_10112963
472 Ga0207706_10037346
473 Ga0207709_10004390
474 Ga0207691_10028237
475 Ga0207661_10085428
476 Ga0207679_10034664
477 Ga0207679_10100774
478 Ga0207668_10008231
479 Ga0207668_10066951
480 Ga0207658_10037111
481 Ga0207678_10009810
482 Ga0207678_10206027
483 Ga0207674_10037821
484 Ga0207674_10275680
485 Ga0268266_10011781
486 Ga0268264_10054893
487 Ga0265327_10001089
488 Ga0307513_10062921
489 Ga0307405_10013499
490 Ga0307413_10007345
491 Ga0307413_10141154
492 Ga0307410_10031525
493 Ga0307406_10007459
494 Ga0307406_10036250
495 Ga0307409_100006266
496 Ga0307409_100011772
497 Ga0307409_100089959
498 Ga0307416_100003829
499 Ga0307416_100094498
500 Ga0307415_100000049
501 Ga0307415_100003260
502 Ga0307415_100025890
503 Ga0373962_0005182
504 Ga0395899_0005790
505 Ga0395898_0193909
506 Ga0395901_0076263
507 Ga0395901_0205552
508 Ga0436365_0173513
509 Ga0436365_0235622
510 Ga0436365_0320908
511 Ga0436363_1495385
512 Ga0439465_0010853
513 Ga0451833_1154318
514 Ga0439434_0009274
515 Ga0439459_0008530
516 Ga0466972_0062332
517 Ga0466965_0026584
518 Ga0466965_0067646
519 Ga0466966_0009377
520 Ga0466961_0042591
521 Ga0466961_0079833
522 Ga0466961_0113432
523 Ga0466963_0079590
524 Ga0466964_0014586
525 Ga0466968_0002525
526 Ga0466968_0016524
527 Ga0466970_0039031
528 Ga0466970_0090202
529 Ga0466957_0067128
530 Ga0466960_0060541
531 Ga0466960_0081247
532 Ga0466959_0031232
533 Ga0466958_0074914
534 Ga0466967_0014200
535 Ga0466967_0014979
536 Ga0466967_0019211
537 Ga0466967_0021779
538 Ga0466967_0085280
539 Ga0466967_0100163
540 Ga0495603_0001722
541 Ga0495603_0005436
542 Ga0495629_0000345
543 Ga0495629_0003047
544 Ga0495629_0012722
545 Ga0495629_0044978
546 Ga0495638_0012480
547 Ga0495585_0033137
548 Ga0495594_0000187
549 Ga0495594_0141425
550 Ga0495606_0117883
551 Ga0495642_0012399
552 Ga0495665_0037922
553 Ga0495640_0067582
554 Ga0495621_0000810
555 Ga0495622_0031770
556 Ga0495622_0032708
557 Ga0495656_0061446
558 Ga0495668_0000990
559 Ga0495668_0040970
560 Ga0495668_0081059
561 Ga0495611_0037961
562 Ga0495625_0080122
563 Ga0495659_0051865
564 Ga0495588_0005197
565 Ga0495613_0001688
566 Ga0495613_0076627
567 Ga0495581_0019369
568 Ga0495672_0044052
569 Ga0495676_0048455
570 Ga0495686_0114845
571 Ga0495614_0008464
572 Ga0496100_0000026
573 Ga0496101_0000015
574 Ga0496101_0053762
575 Ga0496101_0216695
576 Ga0496101_0234146
577 Ga0496101_0246530
578 Ga0496102_0000090
579 Ga0496102_0028594
580 Ga0496102_0114026
581 Ga0496102_0117812
582 Ga0496102_0120193
583 Ga0496103_0000034
584 Ga0496103_0000653
585 Ga0496103_0033393
586 Ga0496103_0063406
587 Ga0496104_0020554
588 Ga0496106_0001036
589 Ga0496106_0032630
590 Ga0496107_0005143
591 Ga0496107_0159719
592 Ga0496108_0003363
593 Ga0496108_0102733
594 Ga0496109_0000022
595 Ga0496109_0006537
596 Ga0496109_0464486
597 Ga0496110_0004695
598 Ga0496110_0008843
599 Ga0496110_0022272
600 Ga0496110_0169895
601 Ga0496111_0017138
602 Ga0496111_0215760
603 Ga0496112_0024363
604 Ga0496112_0028916
605 Ga0496112_0422472
606 Ga0496113_0099924
607 Ga0496114_0000107
608 Ga0496114_0000681
609 Ga0496114_0053846
610 Ga0496115_0006687
611 Ga0496116_0060498
612 Ga0496117_0066013
613 Ga0496118_0008887
614 Ga0496118_0024738
615 Ga0496119_0019666
616 Ga0496119_0061814
617 Ga0496120_0019628
618 Ga0496120_0090729
619 Ga0496121_0000004
620 Ga0496121_0105322
621 Ga0496122_0000257
622 Ga0496123_0004950
623 Ga0496123_0029271
624 Ga0496124_0000012
625 Ga0496125_0000003
626 Ga0496125_0066968
627 Ga0496125_0094280
628 Ga0496126_0000001
629 Ga0496126_0004298
630 Ga0496126_0005657
631 Ga0501316_002380
632 Ga0501032_0013367
633 Ga0501032_0014519
634 Ga0501033_0002354
635 Ga0501034_0000515
636 Ga0501034_0049368
637 Ga0501034_0124797
638 Ga0501034_0128799
639 Ga0501034_0149392
640 Ga0501036_0044674
641 Ga0501037_0004174
642 Ga0501037_0109713
643 Ga0501038_0039014
644 Ga0501039_0003162
645 Ga0501039_0047956
646 Ga0501043_0002282
647 Ga0501043_0009401
648 Ga0501043_0016815
649 Ga0501046_0000148
650 Ga0501046_0008794
651 Ga0501046_0018395
652 Ga0501047_0000195
653 Ga0501047_0011816
654 Ga0501048_0001136
655 Ga0501048_0004381
656 Ga0501069_0062110
657 Ga0501070_0012686
658 Ga0501070_0049844
659 Ga0501070_0102922
660 Ga0501073_0121853
661 Ga0501080_0223496
662 Ga0501035_0003765
663 Ga0501035_0202471
664 Ga0501044_0003964
665 Ga0501044_0008009
666 Ga0501044_0212729
667 nmdc:mga03683_61146_c1
668 nmdc:mga03n38_22362_c1
669 nmdc:mga03n38_25631_c1
670 nmdc:mga03n38_75890_c1
671 nmdc:mga03n38_9428_c1
672 nmdc:mga03n38_9699_c1
673 nmdc:mga00v17_48638_c1
674 nmdc:mga00v17_70776_c1
675 nmdc:mga00v17_9744_c1
676 nmdc:mga0yw44_383_c1
677 nmdc:mga0yw44_4218_c1
678 nmdc:mga06z11_117796_c1
679 nmdc:mga07m45_28787_c1
680 nmdc:mga07m45_41320_c1
681 nmdc:mga07m45_728_c1
682 nmdc:mga05p37_238_c1
683 nmdc:mga09592_6831_c1
684 nmdc:mga0qj67_18868_c1
685 nmdc:mga0qj67_67998_c1
686 nmdc:mga06r32_27843_c1
687 nmdc:mga0sz30_10001_c1
688 nmdc:mga0sz30_3739_c1
689 nmdc:mga0sz30_38667_c1
690 Ga0500635_0044890
691 Ga0500641_0023749
692 Ga0500652_001006
693 Ga0500559_0040152
694 Ga0500577_0020191
695 Ga0500616_0004426
696 Ga0500616_0011011
697 Ga0500627_0011278
698 Ga0500645_000020
699 Ga0466962_0026264
700 2548692546
701 2552105082
702 2566994467
703 2644517228
704 2644635969
705 2738667897
706 2738706427
707 2738890976
708 2739146967
709 2739206264
710 2739239169
711 2739328918
712 2753035534
713 2753326440
714 2812373569
715 2816428031
716 2819698762
717 2857713014
718 2862580065
719 2889304123
720 2891403792
721 2891559799
722 2902794254
723 2902804194
724 2902811950
725 2904535994
726 2919714665
727 2922555961
728 2928147240
729 2939586053
730 2939745483
731 2966599856
732 3003008366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00909

Ammonium_transp

Ammonium Transporter Family

45

440

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nuu-assembly2.cif.gz_D regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex 0.8989 1 368
2b2f-assembly1.cif.gz_A ammonium transporter amt-1 from a.fulgidus (native) 0.8842 3 372
6eu6-assembly1.cif.gz_A sensor amt protein 0.8768 6 366
2npk-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.8733 1 354
1u77-assembly1.cif.gz_A crystal structure of ammonia channel amtb from e. coli 0.873 1 353
ID Description Score Start End Superfamily
af_P9WQ65_5_450_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.902 1 374 1.10.3430.10
af_Q4DC59_3_424_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.8913 3 368 1.10.3430.10
af_Q9US00_22_473_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.8887 3 381 1.10.3430.10
af_Q2FWL9_1_414_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.8816 3 368 1.10.3430.10
af_Q2RBN4_1_316_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.8783 3 281 1.10.3430.10
ID Description Score Start End GO Terms
AF-A0A534QMV5-F1-model_v4 Ammonium transporter 0.9555 176 304 GO:0005886
GO:0008519
AF-A0A540K698-F1-model_v4 Ammonium transporter AmtB-like domain-containing protein 0.9453 197 299 GO:0005886
GO:0008519
AF-A0A7Y3DLF8-F1-model_v4 Ammonium transporter 0.9365 2 144 GO:0005886
GO:0008519
AF-A0A3N5T098-F1-model_v4 Ammonium transporter 0.9179 2 293 GO:0005886
GO:0008519
AF-A0A7J4RVX5-F1-model_v4 Ammonium transporter 0.9179 1 299 GO:0005886
GO:0008519

Map