F423758

General Info

Members Datasets Scaffolds Average Seq Length
365 163 355 217

Family's Representative Sequence

Representative Sequence 3300039110|Ga0400487_55658|Ga0400487_55658_3483_4253
Length 256
Sequence MNTPTSTTVNRGQTAVLSTNKVVRNTYWLLSMTLLFSALTAGVSMALNLPHPGLLITLVGYFGLLFATTKFRDSSLGLVFVFALTGFMGYTLGPILNAYLAMSNGGQLVMTAMSATGIIFLGLSGYALTSRKDFSFMGSFLMVGILVAFFAGLAAVFFEMPALSLAVSAMFVLLMSGLILYETSNIINGGETNYIMATVTLFVAIYNLFTSLLHLLGYLGGGRVTPGKGAEVSPSTRRVYNREWRHMTYRDVGKAL

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2738541337 Pelomonas sp. BT06 Isolate Unclassified
5 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
6 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
7 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
8 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
74 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
83 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
92 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
93 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
94 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
102 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
103 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
104 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
105 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
106 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
107 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
108 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
109 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
110 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
113 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
138 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
150 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
151 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 639633007 Azoarcus olearius BH72 Isolate Unclassified
163 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.44
Metatranscriptomes 20.82
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.41
Nodule 0
Rhizoplane 0.55
Rhizosphere 73.97
Stem 0
Stem Tuber 0
Unclassified 15.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10069382 3300003322 Bacteria 5916
2 rootL2_10375462 3300003322 Bacteria 1125
3 rootH1_10330385 3300003323 Bacteria 1213
4 Ga0055540_1023053 3300003792 Bacteria 1576
5 Ga0055531_10000069 3300003794 Bacteria 111334
6 Ga0065704_10101859 3300005289 Bacteria 2223
7 Ga0065707_10083605 3300005295 Bacteria 8635
8 Ga0070658_10573729 3300005327 Bacteria 977
9 Ga0070660_100003881 3300005339 Bacteria 10327
10 Ga0070661_100005329 3300005344 Bacteria 8873
11 Ga0070659_100411322 3300005366 Bacteria 1143
12 Ga0070714_100010128 3300005435 Bacteria 7442
13 Ga0070713_100000028 3300005436 Bacteria 93227
14 Ga0068855_100003860 3300005563 Bacteria 18319
15 Ga0068856_100013720 3300005614 Bacteria 7834
16 Ga0068859_101203997 3300005617 Bacteria 834
17 Ga0068861_100011917 3300005719 Bacteria 6055
18 Ga0068863_101037681 3300005841 Bacteria 823
19 Ga0075365_10003034 3300006038 Bacteria 8515
20 Ga0075365_10370387 3300006038 Bacteria 1010
21 Ga0075363_100088136 3300006048 Bacteria 1705
22 Ga0075364_10018964 3300006051 Bacteria 4315
23 Ga0075364_10051545 3300006051 Bacteria 2688
24 Ga0070716_100026093 3300006173 Bacteria 3125
25 Ga0070712_100628587 3300006175 Bacteria 911
26 Ga0075362_10179250 3300006177 Bacteria 1026
27 Ga0075367_10035987 3300006178 Bacteria 2868
28 Ga0075369_10004994 3300006186 Bacteria 4936
29 Ga0075427_10006203 3300006194 Bacteria 1725
30 Ga0075370_10001374 3300006353 Bacteria 10497
31 Ga0075434_100038671 3300006871 Bacteria 4726
32 Ga0075429_100007279 3300006880 Bacteria 9604
33 Ga0097620_101204166 3300006931 Bacteria 834
34 Ga0105250_10000006 3300009092 Bacteria 390071
35 Ga0105240_10220618 3300009093 Bacteria 2209
36 Ga0114129_10743675 3300009147 Bacteria 1256
37 Ga0105237_10184408 3300009545 Bacteria 2087
38 Ga0105238_10056301 3300009551 Bacteria 3946
39 Ga0105238_10089494 3300009551 Bacteria 3065
40 Ga0105239_10518768 3300010375 Bacteria 1356
41 Ga0105239_10603917 3300010375 Bacteria 1252
42 Ga0157371_10146180 3300013102 Bacteria 1685
43 Ga0157380_10077221 3300014326 Bacteria 2713
44 Ga0157380_10412366 3300014326 Bacteria 1285
45 Ga0157380_11297319 3300014326 Bacteria 775
46 Ga0157379_10000087 3300014968 Bacteria 61431
47 Ga0206352_10586731 3300020078 Unclassified 799
48 Ga0209050_1004974 3300025298 Bacteria 8652
49 Ga0209051_1004198 3300025303 Bacteria 8988
50 Ga0209257_1000016 3300025304 Bacteria 908015
51 Ga0207696_1000333 3300025711 Bacteria 49519
52 Ga0207695_10169788 3300025913 Bacteria 2107
53 Ga0207693_10546467 3300025915 Bacteria 903
54 Ga0207657_10007970 3300025919 Bacteria 10798
55 Ga0207649_10018719 3300025920 Bacteria 3945
56 Ga0207700_10001343 3300025928 Bacteria 13958
57 Ga0207690_10010910 3300025932 Bacteria 5416
58 Ga0207709_10150005 3300025935 Bacteria 1613
59 Ga0207665_10017070 3300025939 Bacteria 4767
60 Ga0207679_10010670 3300025945 Bacteria 5922
61 Ga0207667_10005788 3300025949 Bacteria 15080
62 Ga0207712_10166723 3300025961 Bacteria 1717
63 Ga0207702_10135923 3300026078 Bacteria 2218
64 Ga0207641_10962720 3300026088 Bacteria 849
65 Ga0207675_100021183 3300026118 Bacteria 6056
66 Ga0209813_10023791 3300027866 Bacteria 1744
67 Ga0310982_109681 3300029283 Unclassified 784
68 Ga0265327_10000885 3300031251 Bacteria 44235
69 Ga0265327_10003049 3300031251 Bacteria 16579
70 Ga0265327_10085345 3300031251 Bacteria 1550
71 Ga0265316_10000435 3300031344 Bacteria 47687
72 Ga0307509_10000145 3300031507 Bacteria 107492
73 Ga0307509_10000189 3300031507 Bacteria 96946
74 Ga0307408_100000012 3300031548 Bacteria 408153
75 Ga0307408_100194472 3300031548 Bacteria 1637
76 Ga0316575_10041013 3300031665 Bacteria 1830
77 Ga0316575_10048434 3300031665 Bacteria 1690
78 Ga0316575_10066684 3300031665 Bacteria 1442
79 Ga0316575_10173179 3300031665 Unclassified 895
80 Ga0316579_10000444 3300031691 Bacteria 13227
81 Ga0316579_10002193 3300031691 Bacteria 7353
82 Ga0316579_10002979 3300031691 Bacteria 6510
83 Ga0316579_10089841 3300031691 Bacteria 1466
84 Ga0316579_10162211 3300031691 Bacteria 1080
85 Ga0316576_10024648 3300031727 Bacteria 4201
86 Ga0316576_10070139 3300031727 Bacteria 2585
87 Ga0316576_10111834 3300031727 Bacteria 2047
88 Ga0316576_10128033 3300031727 Bacteria 1909
89 Ga0316576_10139460 3300031727 Bacteria 1825
90 Ga0316576_10267199 3300031727 Bacteria 1283
91 Ga0316576_10315316 3300031727 Bacteria 1167
92 Ga0316576_10341137 3300031727 Bacteria 1116
93 Ga0316576_10593880 3300031727 Unclassified 809
94 Ga0316578_10008506 3300031728 Bacteria 5227
95 Ga0316578_10043210 3300031728 Bacteria 2617
96 Ga0316578_10063805 3300031728 Bacteria 2173
97 Ga0316578_10080505 3300031728 Bacteria 1937
98 Ga0316578_10090852 3300031728 Bacteria 1823
99 Ga0316578_10097497 3300031728 Bacteria 1761
100 Ga0316578_10108953 3300031728 Bacteria 1663
101 Ga0316578_10217027 3300031728 Unclassified 1150
102 Ga0316578_10229883 3300031728 Bacteria 1114
103 Ga0307405_10752685 3300031731 Bacteria 812
104 Ga0316577_10007072 3300031733 Bacteria 5971
105 Ga0316577_10020747 3300031733 Bacteria 3640
106 Ga0316577_10068893 3300031733 Bacteria 1976
107 Ga0316577_10126384 3300031733 Bacteria 1438
108 Ga0316577_10196197 3300031733 Bacteria 1141
109 Ga0316577_10265792 3300031733 Bacteria 970
110 Ga0307410_10279614 3300031852 Unclassified 1309
111 Ga0307410_10591783 3300031852 Bacteria 924
112 Ga0307407_10228190 3300031903 Bacteria 1263
113 Ga0307409_100821221 3300031995 Bacteria 938
114 Ga0316583_10021603 3300032133 Bacteria 2307
115 Ga0316583_10027482 3300032133 Bacteria 2031
116 Ga0316585_10001831 3300032137 Bacteria 5684
117 Ga0316585_10016900 3300032137 Bacteria 2201
118 Ga0316585_10112353 3300032137 Unclassified 895
119 Ga0316585_10118300 3300032137 Bacteria 872
120 Ga0316580_10021207 3300032139 Bacteria 2002
121 Ga0316580_10026639 3300032139 Bacteria 1788
122 Ga0316580_10045802 3300032139 Bacteria 1348
123 Ga0316580_10057831 3300032139 Bacteria 1191
124 Ga0316580_10069576 3300032139 Bacteria 1078
125 Ga0316593_10005135 3300032168 Bacteria 3426
126 Ga0316593_10019611 3300032168 Bacteria 2091
127 Ga0316593_10023538 3300032168 Bacteria 1945
128 Ga0316593_10025178 3300032168 Bacteria 1892
129 Ga0316593_10035188 3300032168 Bacteria 1646
130 Ga0316593_10083234 3300032168 Bacteria 1119
131 Ga0316593_10083901 3300032168 Bacteria 1115
132 Ga0316593_10101536 3300032168 Bacteria 1021
133 Ga0316593_10141360 3300032168 Bacteria 872
134 Ga0316593_10178690 3300032168 Unclassified 780
135 Ga0316593_10178912 3300032168 Bacteria 779
136 Ga0316593_10182847 3300032168 Bacteria 771
137 Ga0316593_10202835 3300032168 Bacteria 733
138 Ga0316593_10214776 3300032168 Bacteria 713
139 Ga0316592_1000646 3300033524 Bacteria 5069
140 Ga0316592_1008196 3300033524 Bacteria 2058
141 Ga0316592_1020195 3300033524 Bacteria 1413
142 Ga0316592_1024469 3300033524 Bacteria 1299
143 Ga0316592_1049174 3300033524 Unclassified 940
144 Ga0316592_1069381 3300033524 Bacteria 796
145 Ga0316592_1073446 3300033524 Bacteria 775
146 Ga0316592_1082161 3300033524 Bacteria 733
147 Ga0316592_1084592 3300033524 Bacteria 723
148 Ga0316592_1085018 3300033524 Bacteria 721
149 Ga0316592_1085526 3300033524 Bacteria 719
150 Ga0316592_1089539 3300033524 Unclassified 703
151 Ga0316586_1012904 3300033527 Bacteria 1302
152 Ga0316586_1019338 3300033527 Bacteria 1112
153 Ga0316586_1021161 3300033527 Bacteria 1073
154 Ga0316586_1039745 3300033527 Bacteria 825
155 Ga0316586_1044330 3300033527 Bacteria 788
156 Ga0316588_1001054 3300033528 Bacteria 4348
157 Ga0316588_1001157 3300033528 Bacteria 4189
158 Ga0316588_1003067 3300033528 Bacteria 2996
159 Ga0316588_1079467 3300033528 Bacteria 811
160 Ga0316588_1087528 3300033528 Bacteria 775
161 Ga0316588_1099104 3300033528 Bacteria 729
162 Ga0316587_1012941 3300033529 Bacteria 1362
163 Ga0316587_1020870 3300033529 Bacteria 1114
164 Ga0316587_1024248 3300033529 Bacteria 1049
165 Ga0316587_1035895 3300033529 Bacteria 887
166 Ga0316587_1037294 3300033529 Bacteria 872
167 Ga0316587_1039513 3300033529 Bacteria 850
168 Ga0316587_1039977 3300033529 Unclassified 846
169 Ga0316587_1053157 3300033529 Bacteria 744
170 Ga0316587_1054592 3300033529 Bacteria 735
171 Ga0316587_1056398 3300033529 Bacteria 724
172 Ga0316587_1059188 3300033529 Bacteria 708
173 Ga0316596_1002632 3300033541 Bacteria 3849
174 Ga0316596_1004839 3300033541 Bacteria 3045
175 Ga0316596_1007585 3300033541 Bacteria 2569
176 Ga0316596_1016680 3300033541 Bacteria 1841
177 Ga0316596_1019515 3300033541 Bacteria 1720
178 Ga0316596_1030755 3300033541 Bacteria 1393
179 Ga0316596_1080767 3300033541 Unclassified 874
180 Ga0316596_1081929 3300033541 Unclassified 867
181 Ga0316596_1095455 3300033541 Bacteria 802
182 Ga0316596_1102142 3300033541 Bacteria 776
183 Ga0316596_1111084 3300033541 Bacteria 744
184 Ga0316596_1118513 3300033541 Bacteria 720
185 Ga0373958_0028200 3300034819 Bacteria 1085
186 Ga0373940_0006972 3300035088 Bacteria 2533
187 Ga0373939_0000015 3300035114 Bacteria 64012
188 Ga0373960_0005939 3300035121 Bacteria 2844
189 Ga0316574_0003865 3300035398 Bacteria 7779
190 Ga0316574_0005022 3300035398 Bacteria 7026
191 Ga0316574_0006742 3300035398 Bacteria 6236
192 Ga0316574_0013477 3300035398 Bacteria 4703
193 Ga0316574_0029442 3300035398 Bacteria 3318
194 Ga0316574_0035056 3300035398 Bacteria 3065
195 Ga0316574_0036618 3300035398 Bacteria 3004
196 Ga0316574_0046895 3300035398 Bacteria 2681
197 Ga0316574_0056466 3300035398 Bacteria 2456
198 Ga0316574_0069411 3300035398 Bacteria 2224
199 Ga0316574_0079146 3300035398 Bacteria 2084
200 Ga0316574_0089636 3300035398 Bacteria 1959
201 Ga0316574_0091744 3300035398 Bacteria 1937
202 Ga0316574_0105137 3300035398 Bacteria 1808
203 Ga0316574_0124956 3300035398 Bacteria 1653
204 Ga0316574_0148089 3300035398 Bacteria 1513
205 Ga0316574_0170826 3300035398 Bacteria 1400
206 Ga0316574_0219887 3300035398 Bacteria 1217
207 Ga0316574_0353824 3300035398 Bacteria 929
208 Ga0373931_0001009 3300035691 Bacteria 11912
209 Ga0316582_0002079 3300036647 Bacteria 9227
210 Ga0316582_0006880 3300036647 Bacteria 6014
211 Ga0316582_0020391 3300036647 Bacteria 3898
212 Ga0316582_0024929 3300036647 Bacteria 3585
213 Ga0316582_0035866 3300036647 Bacteria 3066
214 Ga0316582_0071399 3300036647 Bacteria 2248
215 Ga0316582_0100994 3300036647 Bacteria 1910
216 Ga0316582_0102740 3300036647 Bacteria 1895
217 Ga0316582_0112654 3300036647 Bacteria 1812
218 Ga0316582_0148672 3300036647 Unclassified 1583
219 Ga0316582_0163230 3300036647 Bacteria 1510
220 Ga0316582_0241837 3300036647 Bacteria 1236
221 Ga0316582_0247295 3300036647 Bacteria 1222
222 Ga0316582_0324538 3300036647 Bacteria 1058
223 Ga0316582_0597276 3300036647 Bacteria 760
224 Ga0316582_0663094 3300036647 Bacteria 717
225 Ga0316584_0001446 3300036712 Bacteria 14240
226 Ga0316584_0002068 3300036712 Bacteria 12561
227 Ga0316584_0003538 3300036712 Bacteria 10189
228 Ga0316584_0004654 3300036712 Bacteria 9094
229 Ga0316584_0006053 3300036712 Bacteria 8175
230 Ga0316584_0010356 3300036712 Bacteria 6512
231 Ga0316584_0020738 3300036712 Bacteria 4770
232 Ga0316584_0053353 3300036712 Bacteria 3026
233 Ga0316584_0066872 3300036712 Bacteria 2693
234 Ga0316584_0068777 3300036712 Bacteria 2654
235 Ga0316584_0146404 3300036712 Bacteria 1760
236 Ga0316584_0189374 3300036712 Bacteria 1521
237 Ga0316584_0234753 3300036712 Bacteria 1344
238 Ga0316584_0246564 3300036712 Bacteria 1306
239 Ga0316584_0284277 3300036712 Bacteria 1201
240 Ga0316584_0331927 3300036712 Bacteria 1095
241 Ga0316584_0385079 3300036712 Bacteria 1001
242 Ga0316584_0451831 3300036712 Bacteria 909
243 Ga0395900_0268907 3300037418 Bacteria 1700
244 Ga0395905_0000639 3300037471 Bacteria 46771
245 Ga0316581_0000895 3300037588 Bacteria 6312
246 Ga0400484_30031 3300038725 Bacteria 36880
247 Ga0400484_32759 3300038725 Bacteria 91677
248 Ga0400484_38498 3300038725 Bacteria 1296
249 Ga0400490_08397 3300038726 Bacteria 12216
250 Ga0400490_12391 3300038726 Bacteria 12576
251 Ga0400490_37810 3300038726 Bacteria 14344
252 Ga0400490_49136 3300038726 Bacteria 1329
253 Ga0400490_59739 3300038726 Bacteria 15700
254 Ga0400491_08133 3300038727 Bacteria 1468
255 Ga0400491_22007 3300038727 Bacteria 4085
256 Ga0400491_22185 3300038727 Bacteria 1281
257 Ga0400485_06401 3300038735 Bacteria 11304
258 Ga0400485_18327 3300038735 Bacteria 54081
259 Ga0400488_21820 3300038741 Bacteria 1576
260 Ga0400488_24387 3300038741 Bacteria 3577
261 Ga0400488_24989 3300038741 Bacteria 1462
262 Ga0400488_28799 3300038741 Bacteria 1784
263 Ga0400488_58092 3300038741 Bacteria 1291
264 Ga0400486_06140 3300038742 Bacteria 135791
265 Ga0400486_21617 3300038742 Bacteria 11389
266 Ga0400483_040782 3300039062 Bacteria 6785
267 Ga0400483_042147 3300039062 Bacteria 3132
268 Ga0400483_052033 3300039062 Bacteria 1792
269 Ga0400483_062693 3300039062 Bacteria 1592
270 Ga0400483_195012 3300039062 Bacteria 1407
271 Ga0400483_196027 3300039062 Bacteria 7126
272 Ga0400483_202408 3300039062 Unclassified 1014
273 Ga0400483_203222 3300039062 Bacteria 13818
274 Ga0400483_220286 3300039062 Bacteria 3914
275 Ga0400483_272603 3300039062 Bacteria 4329
276 Ga0400487_00965 3300039110 Bacteria 2799
277 Ga0400487_01118 3300039110 Bacteria 27006
278 Ga0400487_13434 3300039110 Bacteria 50360
279 Ga0400487_15810 3300039110 Bacteria 1159
280 Ga0400487_23947 3300039110 Bacteria 2578
281 Ga0400487_33965 3300039110 Bacteria 27121
282 Ga0400487_49424 3300039110 Bacteria 1592
283 Ga0400487_51022 3300039110 Bacteria 102767
284 Ga0400487_55658 3300039110 Bacteria 11268
285 Ga0451833_1075489 3300041491 Bacteria 1206
286 Ga0451853_1641008 3300041512 Bacteria 2553
287 Ga0450888_000683 3300042126 Bacteria 3227
288 Ga0450897_012049 3300042128 Bacteria 850
289 Ga0451577_0068229 3300042876 Bacteria 3171
290 Ga0451577_0081728 3300042876 Bacteria 2882
291 Ga0451577_0190243 3300042876 Bacteria 1851
292 Ga0466966_0010163 3300044684 Bacteria 6243
293 Ga0453684_0141584 3300044712 Bacteria 2871
294 Ga0453684_0730264 3300044712 Bacteria 1074
295 Ga0453684_1144946 3300044712 Bacteria 820
296 Ga0466971_0261466 3300044719 Bacteria 826
297 Ga0466970_0019030 3300044765 Bacteria 3558
298 Ga0466959_0052822 3300045049 Bacteria 2975
299 Ga0451576_0000237 3300045051 Bacteria 134538
300 Ga0451576_0002121 3300045051 Bacteria 30819
301 Ga0451576_0042939 3300045051 Bacteria 4773
302 Ga0451576_0284999 3300045051 Bacteria 1727
303 Ga0466967_0494328 3300045976 Bacteria 1200
304 Ga0495638_0027727 3300046460 Bacteria 3664
305 Ga0495594_0159543 3300046499 Unclassified 1282
306 Ga0495622_0244004 3300046557 Unclassified 791
307 Ga0495625_0005453 3300046660 Bacteria 11595
308 Ga0495625_0432730 3300046660 Bacteria 816
309 Ga0496100_0826676 3300048903 Bacteria 726
310 Ga0496101_0034895 3300048904 Bacteria 3555
311 Ga0501300_003810 3300049523 Bacteria 2245
312 Ga0501034_0322364 3300049571 Bacteria 1478
313 Ga0501042_0000228 3300049578 Bacteria 26974
314 Ga0501042_0038090 3300049578 Bacteria 3414
315 Ga0501223_018165 3300049663 Bacteria 1384
316 nmdc:mga03683_158001_c1 3300050489 Bacteria 1026
317 nmdc:mga03n38_1767_c1 3300050490 Bacteria 6407
318 nmdc:mga00v17_2055_c1 3300050491 Bacteria 10371
319 nmdc:mga00v17_31888_c1 3300050491 Bacteria 3111
320 nmdc:mga00v17_42619_c1 3300050491 Bacteria 2731
321 nmdc:mga0yw44_1391_c1 3300050492 Bacteria 9581
322 nmdc:mga0yw44_366076_c1 3300050492 Bacteria 972
323 nmdc:mga0k408_67315_c2 3300050493 Bacteria 1632
324 nmdc:mga0k408_77914_c1 3300050493 Bacteria 1938
325 nmdc:mga06z11_51559_c1 3300050494 Bacteria 2107
326 nmdc:mga06z11_5913_c1 3300050494 Bacteria 4943
327 nmdc:mga04h51_5429_c1 3300050495 Bacteria 3251
328 nmdc:mga07m45_1109_c1 3300050496 Bacteria 12041
329 nmdc:mga07m45_169_c1 3300050496 Bacteria 26198
330 nmdc:mga05p37_731371_c1 3300050507 Bacteria 1094
331 nmdc:mga09592_6334_c1 3300050508 Bacteria 9644
332 nmdc:mga0n895_78103_c1 3300050512 Bacteria 3294
333 nmdc:mga0sz30_21_c1 3300050516 Bacteria 30668
334 Ga0500583_0075038 3300053092 Bacteria 1624
335 Ga0500559_0048623 3300053136 Bacteria 1866
336 Ga0500568_0017961 3300053139 Bacteria 3109
337 Ga0500568_0079911 3300053139 Bacteria 1242
338 Ga0500622_0005832 3300053156 Bacteria 7294
339 Ga0500636_0000154 3300053177 Bacteria 35799
340 Ga0500637_0067082 3300053178 Bacteria 2060
341 Ga0500625_001453 3300053729 Bacteria 8134
342 Ga0587089_007862 3300059509 Bacteria 1274
343 Ga0587089_023753 3300059509 Unclassified 865
344 Ga0587106_014257 3300059605 Bacteria 1092
345 Ga0587127_002864 3300059629 Bacteria 1065
346 Ga0587127_008951 3300059629 Bacteria 755
347 Ga0587130_014261 3300059631 Bacteria 810
348 Ga0587072_009895 3300059643 Bacteria 1532
349 Ga0587076_023523 3300059645 Bacteria 1039
350 Ga0587079_042663 3300059647 Bacteria 922
351 Ga0587118_08261 3300059657 Bacteria 772
352 Ga0587124_002805 3300059660 Bacteria 1255
353 Ga0587071_013004 3300060344 Bacteria 1427
354 Ga0587111_0003507 3300060346 Bacteria 2237
355 Ga0587111_0024085 3300060346 Bacteria 1196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042128 Ga0450897_012049 Ga0450897_012049_80_670 161
2 3300042876 Ga0451577_0068229 Ga0451577_0068229_907_1599 177
3 3300044712 Ga0453684_0141584 Ga0453684_0141584_559_1251 177
4 3300006038 Ga0075365_10370387 Ga0075365_103703871 185
5 3300006051 Ga0075364_10051545 Ga0075364_100515452 185
6 3300050491 nmdc:mga00v17_42619_c1 nmdc:mga00v17_42619_c1_1430_2104 185
7 3300050492 nmdc:mga0yw44_366076_c1 nmdc:mga0yw44_366076_c1_110_784 185
8 3300006048 Ga0075363_100088136 Ga0075363_1000881363 186
9 3300006177 Ga0075362_10179250 Ga0075362_101792502 186
10 3300006178 Ga0075367_10035987 Ga0075367_100359873 186
11 3300006186 Ga0075369_10004994 Ga0075369_100049946 186
12 3300006194 Ga0075427_10006203 Ga0075427_100062032 186
13 3300006353 Ga0075370_10001374 Ga0075370_100013743 186
14 3300006871 Ga0075434_100038671 Ga0075434_1000386714 186
15 3300006880 Ga0075429_100007279 Ga0075429_1000072793 186
16 3300027866 Ga0209813_10023791 Ga0209813_100237912 186
17 3300038725 Ga0400484_32759 Ga0400484_32759_90360_91031 186
18 3300050489 nmdc:mga03683_158001_c1 nmdc:mga03683_158001_c1_201_875 186
19 3300050490 nmdc:mga03n38_1767_c1 nmdc:mga03n38_1767_c1_4447_5121 186
20 3300050491 nmdc:mga00v17_31888_c1 nmdc:mga00v17_31888_c1_1103_1777 186
21 3300050493 nmdc:mga0k408_67315_c2 nmdc:mga0k408_67315_c2_259_933 186
22 3300050494 nmdc:mga06z11_5913_c1 nmdc:mga06z11_5913_c1_3305_3979 186
23 3300050496 nmdc:mga07m45_169_c1 nmdc:mga07m45_169_c1_1227_1901 186
24 3300050508 nmdc:mga09592_6334_c1 nmdc:mga09592_6334_c1_8144_8818 186
25 3300050512 nmdc:mga0n895_78103_c1 nmdc:mga0n895_78103_c1_2112_2786 186
26 3300050516 nmdc:mga0sz30_21_c1 nmdc:mga0sz30_21_c1_29247_29921 186
27 3300029283 Ga0310982_109681 Ga0310982_1096811 187
28 3300038741 Ga0400488_24989 Ga0400488_24989_563_1234 187
29 3300035398 Ga0316574_0124956 Ga0316574_0124956_354_1022 188
30 3300038726 Ga0400490_37810 Ga0400490_37810_8694_9287 189
31 3300038727 Ga0400491_08133 Ga0400491_08133_602_1195 189
32 3300038741 Ga0400488_24387 Ga0400488_24387_315_908 189
33 3300039110 Ga0400487_51022 Ga0400487_51022_2464_3057 189
34 3300053729 Ga0500625_001453 Ga0500625_001453_1607_2293 189
35 3300059643 Ga0587072_009895 Ga0587072_009895_795_1484 190
36 3300059645 Ga0587076_023523 Ga0587076_023523_247_936 190
37 3300035398 Ga0316574_0089636 Ga0316574_0089636_75_743 191
38 3300036647 Ga0316582_0247295 Ga0316582_0247295_286_954 191
39 3300045051 Ga0451576_0002121 Ga0451576_0002121_14987_15685 191
40 3300045051 Ga0451576_0042939 Ga0451576_0042939_942_1646 191
41 3300031691 Ga0316579_10002193 Ga0316579_100021933 192
42 3300032133 Ga0316583_10021603 Ga0316583_100216032 192
43 3300036647 Ga0316582_0100994 Ga0316582_0100994_100_768 192
44 3300037418 Ga0395900_0268907 Ga0395900_0268907_554_1243 192
45 3300059629 Ga0587127_002864 Ga0587127_002864_115_804 192
46 3300059660 Ga0587124_002805 Ga0587124_002805_319_1008 192
47 3300060344 Ga0587071_013004 Ga0587071_013004_652_1341 192
48 3300060346 Ga0587111_0003507 Ga0587111_0003507_280_969 192
49 3300006038 Ga0075365_10003034 Ga0075365_100030343 193
50 3300006051 Ga0075364_10018964 Ga0075364_100189643 193
51 3300006173 Ga0070716_100026093 Ga0070716_1000260933 193
52 3300009147 Ga0114129_10743675 Ga0114129_107436752 193
53 3300038726 Ga0400490_49136 Ga0400490_49136_233_904 193
54 3300050491 nmdc:mga00v17_2055_c1 nmdc:mga00v17_2055_c1_883_1557 193
55 3300050492 nmdc:mga0yw44_1391_c1 nmdc:mga0yw44_1391_c1_2069_2743 193
56 3300050494 nmdc:mga06z11_51559_c1 nmdc:mga06z11_51559_c1_491_1165 193
57 3300050495 nmdc:mga04h51_5429_c1 nmdc:mga04h51_5429_c1_1955_2629 193
58 3300050507 nmdc:mga05p37_731371_c1 nmdc:mga05p37_731371_c1_130_804 193
59 3300005563 Ga0068855_100003860 Ga0068855_1000038608 194
60 3300005614 Ga0068856_100013720 Ga0068856_1000137204 194
61 3300009545 Ga0105237_10184408 Ga0105237_101844082 194
62 3300009551 Ga0105238_10089494 Ga0105238_100894943 194
63 3300010375 Ga0105239_10518768 Ga0105239_105187682 194
64 3300025949 Ga0207667_10005788 Ga0207667_1000578812 194
65 3300026078 Ga0207702_10135923 Ga0207702_101359233 194
66 3300046557 Ga0495622_0244004 Ga0495622_0244004_53_661 194
67 3300035398 Ga0316574_0035056 Ga0316574_0035056_1955_2623 195
68 3300032139 Ga0316580_10069576 Ga0316580_100695761 196
69 3300005339 Ga0070660_100003881 Ga0070660_1000038817 197
70 3300005344 Ga0070661_100005329 Ga0070661_1000053293 197
71 3300020078 Ga0206352_10586731 Ga0206352_105867311 197
72 3300025919 Ga0207657_10007970 Ga0207657_100079705 197
73 3300025920 Ga0207649_10018719 Ga0207649_100187194 197
74 3300025932 Ga0207690_10010910 Ga0207690_100109105 197
75 3300025945 Ga0207679_10010670 Ga0207679_100106704 197
76 3300031507 Ga0307509_10000189 Ga0307509_1000018968 197
77 3300032168 Ga0316593_10023538 Ga0316593_100235382 197
78 3300033524 Ga0316592_1085526 Ga0316592_10855261 197
79 3300036712 Ga0316584_0010356 Ga0316584_0010356_5017_5688 197
80 3300038725 Ga0400484_38498 Ga0400484_38498_58_729 197
81 3300039062 Ga0400483_062693 Ga0400483_062693_372_1043 197
82 3300039062 Ga0400483_272603 Ga0400483_272603_459_1130 197
83 3300059509 Ga0587089_007862 Ga0587089_007862_100_789 197
84 3300059647 Ga0587079_042663 Ga0587079_042663_72_758 197
85 3300049571 Ga0501034_0322364 Ga0501034_0322364_606_1295 198
86 3300059509 Ga0587089_023753 Ga0587089_023753_13_702 198
87 3300059605 Ga0587106_014257 Ga0587106_014257_191_880 198
88 3300059629 Ga0587127_008951 Ga0587127_008951_11_700 198
89 3300059631 Ga0587130_014261 Ga0587130_014261_56_745 198
90 3300059657 Ga0587118_08261 Ga0587118_08261_56_745 198
91 3300060346 Ga0587111_0024085 Ga0587111_0024085_260_949 198
92 3300044684 Ga0466966_0010163 Ga0466966_0010163_5096_5830 199
93 3300044719 Ga0466971_0261466 Ga0466971_0261466_37_771 199
94 3300035398 Ga0316574_0003865 Ga0316574_0003865_495_1163 201
95 3300035398 Ga0316574_0170826 Ga0316574_0170826_246_914 201
96 3300036712 Ga0316584_0189374 Ga0316584_0189374_294_962 201
97 3300039110 Ga0400487_01118 Ga0400487_01118_11132_11758 201
98 3300031691 Ga0316579_10000444 Ga0316579_100004441 202
99 3300031728 Ga0316578_10008506 Ga0316578_100085064 202
100 3300032137 Ga0316585_10112353 Ga0316585_101123531 202
101 3300036712 Ga0316584_0001446 Ga0316584_0001446_43_711 202
102 3300036712 Ga0316584_0246564 Ga0316584_0246564_18_677 202
103 3300042876 Ga0451577_0081728 Ga0451577_0081728_571_1239 202
104 3300031691 Ga0316579_10089841 Ga0316579_100898411 203
105 3300031727 Ga0316576_10111834 Ga0316576_101118342 203
106 3300031728 Ga0316578_10043210 Ga0316578_100432103 203
107 3300031852 Ga0307410_10279614 Ga0307410_102796141 203
108 3300031903 Ga0307407_10228190 Ga0307407_102281902 203
109 3300031995 Ga0307409_100821221 Ga0307409_1008212211 203
110 3300032137 Ga0316585_10001831 Ga0316585_100018314 203
111 3300032139 Ga0316580_10057831 Ga0316580_100578311 203
112 3300033524 Ga0316592_1073446 Ga0316592_10734461 203
113 3300033528 Ga0316588_1087528 Ga0316588_10875281 203
114 3300036647 Ga0316582_0597276 Ga0316582_0597276_44_679 203
115 3300037588 Ga0316581_0000895 Ga0316581_0000895_2957_3628 203
116 3300053136 Ga0500559_0048623 Ga0500559_0048623_53_739 203
117 3300053177 Ga0500636_0000154 Ga0500636_0000154_33326_34012 203
118 3300036712 Ga0316584_0068777 Ga0316584_0068777_184_855 204
119 3300053178 Ga0500637_0067082 Ga0500637_0067082_171_857 204
120 3300031665 Ga0316575_10041013 Ga0316575_100410131 205
121 3300031727 Ga0316576_10341137 Ga0316576_103411371 205
122 3300031728 Ga0316578_10097497 Ga0316578_100974972 205
123 3300033541 Ga0316596_1111084 Ga0316596_11110841 205
124 3300039062 Ga0400483_195012 Ga0400483_195012_319_990 205
125 3300032137 Ga0316585_10118300 Ga0316585_101183001 206
126 3300032168 Ga0316593_10025178 Ga0316593_100251783 206
127 3300033524 Ga0316592_1024469 Ga0316592_10244692 206
128 3300033541 Ga0316596_1016680 Ga0316596_10166801 206
129 3300036712 Ga0316584_0053353 Ga0316584_0053353_142_810 206
130 3300014326 Ga0157380_10077221 Ga0157380_100772212 207
131 3300033529 Ga0316587_1039513 Ga0316587_10395131 207
132 3300039062 Ga0400483_202408 Ga0400483_202408_26_694 208
133 3300031548 Ga0307408_100194472 Ga0307408_1001944721 209
134 3300031727 Ga0316576_10070139 Ga0316576_100701393 209
135 3300036712 Ga0316584_0284277 Ga0316584_0284277_464_1141 209
136 3300042126 Ga0450888_000683 Ga0450888_000683_1632_2315 209
137 iso_pu_bacteria 2887630918 2887631261 209
138 iso_pu_bacteria 2989392574 2989392858 209
139 3300014326 Ga0157380_11297319 Ga0157380_112973191 210
140 3300031727 Ga0316576_10139460 Ga0316576_101394603 210
141 3300031852 Ga0307410_10591783 Ga0307410_105917832 210
142 3300035398 Ga0316574_0046895 Ga0316574_0046895_1225_1887 210
143 3300036647 Ga0316582_0324538 Ga0316582_0324538_299_961 210
144 3300036712 Ga0316584_0234753 Ga0316584_0234753_358_1020 210
145 3300049663 Ga0501223_018165 Ga0501223_018165_360_1001 210
146 iso_pu_bacteria 2574179768 2574429361 210
147 iso_pu_bacteria 2891633521 2891636740 210
148 iso_pu_bacteria 2894510363 2894511622 210
149 iso_pu_bacteria 639633007 639786030 210
150 3300035398 Ga0316574_0006742 Ga0316574_0006742_2817_3473 211
151 3300035398 Ga0316574_0013477 Ga0316574_0013477_444_1103 211
152 3300036647 Ga0316582_0663094 Ga0316582_0663094_48_704 211
153 3300036712 Ga0316584_0006053 Ga0316584_0006053_5386_6042 211
154 iso_pu_bacteria 8001522603 8001524092 211
155 3300031665 Ga0316575_10048434 Ga0316575_100484343 212
156 3300031727 Ga0316576_10024648 Ga0316576_100246485 212
157 3300031728 Ga0316578_10063805 Ga0316578_100638053 212
158 3300031733 Ga0316577_10007072 Ga0316577_100070725 212
159 3300031733 Ga0316577_10068893 Ga0316577_100688933 212
160 3300032139 Ga0316580_10045802 Ga0316580_100458022 212
161 3300032168 Ga0316593_10005135 Ga0316593_100051351 212
162 3300032168 Ga0316593_10178690 Ga0316593_101786901 212
163 3300033524 Ga0316592_1020195 Ga0316592_10201951 212
164 3300033527 Ga0316586_1019338 Ga0316586_10193382 212
165 3300033528 Ga0316588_1001054 Ga0316588_10010544 212
166 3300033528 Ga0316588_1001157 Ga0316588_10011571 212
167 3300033529 Ga0316587_1024248 Ga0316587_10242482 212
168 3300033541 Ga0316596_1004839 Ga0316596_10048395 212
169 3300033541 Ga0316596_1007585 Ga0316596_10075853 212
170 3300033541 Ga0316596_1081929 Ga0316596_10819291 212
171 3300035398 Ga0316574_0029442 Ga0316574_0029442_2280_2945 212
172 3300035398 Ga0316574_0036618 Ga0316574_0036618_1635_2300 212
173 3300035398 Ga0316574_0069411 Ga0316574_0069411_157_816 212
174 3300036647 Ga0316582_0006880 Ga0316582_0006880_1235_1900 212
175 3300036647 Ga0316582_0071399 Ga0316582_0071399_98_763 212
176 3300036712 Ga0316584_0003538 Ga0316584_0003538_3322_3987 212
177 3300036712 Ga0316584_0004654 Ga0316584_0004654_4053_4718 212
178 3300005289 Ga0065704_10101859 Ga0065704_101018592 213
179 3300005436 Ga0070713_100000028 Ga0070713_10000002880 213
180 3300006175 Ga0070712_100628587 Ga0070712_1006285871 213
181 3300013102 Ga0157371_10146180 Ga0157371_101461802 213
182 3300025915 Ga0207693_10546467 Ga0207693_105464671 213
183 3300025928 Ga0207700_10001343 Ga0207700_100013434 213
184 3300031691 Ga0316579_10002979 Ga0316579_100029792 213
185 3300032133 Ga0316583_10027482 Ga0316583_100274821 213
186 3300032168 Ga0316593_10101536 Ga0316593_101015361 213
187 3300033524 Ga0316592_1069381 Ga0316592_10693811 213
188 3300033524 Ga0316592_1085018 Ga0316592_10850181 213
189 3300033527 Ga0316586_1012904 Ga0316586_10129042 213
190 3300033527 Ga0316586_1039745 Ga0316586_10397451 213
191 3300033528 Ga0316588_1079467 Ga0316588_10794671 213
192 3300033529 Ga0316587_1012941 Ga0316587_10129412 213
193 3300033529 Ga0316587_1020870 Ga0316587_10208701 213
194 3300033529 Ga0316587_1035895 Ga0316587_10358951 213
195 3300033529 Ga0316587_1054592 Ga0316587_10545921 213
196 3300033541 Ga0316596_1030755 Ga0316596_10307552 213
197 3300033541 Ga0316596_1102142 Ga0316596_11021421 213
198 3300035398 Ga0316574_0148089 Ga0316574_0148089_578_1240 213
199 3300036647 Ga0316582_0024929 Ga0316582_0024929_1090_1755 213
200 3300036712 Ga0316584_0066872 Ga0316584_0066872_528_1190 213
201 3300038735 Ga0400485_18327 Ga0400485_18327_49283_49978 213
202 3300038742 Ga0400486_06140 Ga0400486_06140_44148_44843 213
203 3300039110 Ga0400487_13434 Ga0400487_13434_49296_49991 213
204 3300044712 Ga0453684_1144946 Ga0453684_1144946_58_723 213
205 iso_pu_bacteria 2526164512 2526213718 213
206 3300005327 Ga0070658_10573729 Ga0070658_105737291 214
207 3300005366 Ga0070659_100411322 Ga0070659_1004113222 214
208 3300031251 Ga0265327_10000885 Ga0265327_100008852 214
209 3300031251 Ga0265327_10003049 Ga0265327_1000304911 214
210 3300031251 Ga0265327_10085345 Ga0265327_100853452 214
211 3300031344 Ga0265316_10000435 Ga0265316_1000043535 214
212 3300031665 Ga0316575_10066684 Ga0316575_100666841 214
213 3300031665 Ga0316575_10173179 Ga0316575_101731791 214
214 3300031691 Ga0316579_10162211 Ga0316579_101622111 214
215 3300031727 Ga0316576_10267199 Ga0316576_102671991 214
216 3300031728 Ga0316578_10090852 Ga0316578_100908522 214
217 3300031728 Ga0316578_10108953 Ga0316578_101089534 214
218 3300031728 Ga0316578_10217027 Ga0316578_102170271 214
219 3300031733 Ga0316577_10265792 Ga0316577_102657921 214
220 3300032139 Ga0316580_10026639 Ga0316580_100266392 214
221 3300032168 Ga0316593_10035188 Ga0316593_100351882 214
222 3300032168 Ga0316593_10141360 Ga0316593_101413601 214
223 3300032168 Ga0316593_10178912 Ga0316593_101789121 214
224 3300032168 Ga0316593_10182847 Ga0316593_101828471 214
225 3300032168 Ga0316593_10202835 Ga0316593_102028351 214
226 3300032168 Ga0316593_10214776 Ga0316593_102147761 214
227 3300033524 Ga0316592_1082161 Ga0316592_10821611 214
228 3300033524 Ga0316592_1084592 Ga0316592_10845921 214
229 3300033524 Ga0316592_1089539 Ga0316592_10895391 214
230 3300033527 Ga0316586_1044330 Ga0316586_10443301 214
231 3300033528 Ga0316588_1099104 Ga0316588_10991041 214
232 3300033529 Ga0316587_1037294 Ga0316587_10372941 214
233 3300033529 Ga0316587_1039977 Ga0316587_10399771 214
234 3300033529 Ga0316587_1053157 Ga0316587_10531571 214
235 3300033529 Ga0316587_1056398 Ga0316587_10563981 214
236 3300033529 Ga0316587_1059188 Ga0316587_10591881 214
237 3300033541 Ga0316596_1080767 Ga0316596_10807671 214
238 3300033541 Ga0316596_1095455 Ga0316596_10954551 214
239 3300033541 Ga0316596_1118513 Ga0316596_11185131 214
240 3300035398 Ga0316574_0005022 Ga0316574_0005022_1536_2204 214
241 3300035398 Ga0316574_0056466 Ga0316574_0056466_500_1168 214
242 3300036647 Ga0316582_0035866 Ga0316582_0035866_528_1196 214
243 3300036647 Ga0316582_0102740 Ga0316582_0102740_247_915 214
244 3300036647 Ga0316582_0112654 Ga0316582_0112654_118_786 214
245 3300038725 Ga0400484_30031 Ga0400484_30031_2005_2676 214
246 3300038741 Ga0400488_21820 Ga0400488_21820_731_1402 214
247 3300039062 Ga0400483_042147 Ga0400483_042147_1026_1775 214
248 3300039062 Ga0400483_220286 Ga0400483_220286_2673_3380 214
249 3300039110 Ga0400487_23947 Ga0400487_23947_590_1261 214
250 3300039110 Ga0400487_33965 Ga0400487_33965_11349_12020 214
251 3300039110 Ga0400487_49424 Ga0400487_49424_678_1349 214
252 3300042876 Ga0451577_0190243 Ga0451577_0190243_941_1627 214
253 3300044712 Ga0453684_0730264 Ga0453684_0730264_228_899 214
254 3300045051 Ga0451576_0000237 Ga0451576_0000237_42892_43572 214
255 3300049578 Ga0501042_0000228 Ga0501042_0000228_8325_9008 214
256 3300049578 Ga0501042_0038090 Ga0501042_0038090_1198_1881 214
257 iso_pu_bacteria 2643221646 2644260947 214
258 iso_pu_bacteria 2738541337 2739054865 214
259 3300009093 Ga0105240_10220618 Ga0105240_102206182 215
260 3300010375 Ga0105239_10603917 Ga0105239_106039172 215
261 3300014326 Ga0157380_10412366 Ga0157380_104123662 215
262 3300025913 Ga0207695_10169788 Ga0207695_101697882 215
263 3300031727 Ga0316576_10315316 Ga0316576_103153161 215
264 3300031728 Ga0316578_10080505 Ga0316578_100805052 215
265 3300031728 Ga0316578_10229883 Ga0316578_102298831 215
266 3300031731 Ga0307405_10752685 Ga0307405_107526851 215
267 3300031733 Ga0316577_10020747 Ga0316577_100207475 215
268 3300031733 Ga0316577_10126384 Ga0316577_101263841 215
269 3300031733 Ga0316577_10196197 Ga0316577_101961971 215
270 3300032137 Ga0316585_10016900 Ga0316585_100169002 215
271 3300032139 Ga0316580_10021207 Ga0316580_100212072 215
272 3300032168 Ga0316593_10019611 Ga0316593_100196112 215
273 3300032168 Ga0316593_10083234 Ga0316593_100832342 215
274 3300033524 Ga0316592_1008196 Ga0316592_10081962 215
275 3300033541 Ga0316596_1019515 Ga0316596_10195152 215
276 3300034819 Ga0373958_0028200 Ga0373958_0028200_385_1062 215
277 3300035088 Ga0373940_0006972 Ga0373940_0006972_870_1547 215
278 3300035114 Ga0373939_0000015 Ga0373939_0000015_13620_14411 215
279 3300035121 Ga0373960_0005939 Ga0373960_0005939_2144_2821 215
280 3300035398 Ga0316574_0079146 Ga0316574_0079146_1374_2051 215
281 3300035398 Ga0316574_0091744 Ga0316574_0091744_429_1100 215
282 3300035398 Ga0316574_0105137 Ga0316574_0105137_230_913 215
283 3300035398 Ga0316574_0219887 Ga0316574_0219887_514_1191 215
284 3300035398 Ga0316574_0353824 Ga0316574_0353824_27_704 215
285 3300035691 Ga0373931_0001009 Ga0373931_0001009_340_1131 215
286 3300036647 Ga0316582_0002079 Ga0316582_0002079_8201_8878 215
287 3300036647 Ga0316582_0020391 Ga0316582_0020391_2295_2966 215
288 3300036647 Ga0316582_0163230 Ga0316582_0163230_395_1066 215
289 3300036647 Ga0316582_0241837 Ga0316582_0241837_515_1192 215
290 3300036712 Ga0316584_0002068 Ga0316584_0002068_4585_5262 215
291 3300036712 Ga0316584_0331927 Ga0316584_0331927_44_715 215
292 3300036712 Ga0316584_0385079 Ga0316584_0385079_272_949 215
293 3300038726 Ga0400490_08397 Ga0400490_08397_8368_9039 215
294 3300038726 Ga0400490_12391 Ga0400490_12391_5889_6560 215
295 3300038726 Ga0400490_59739 Ga0400490_59739_2379_3050 215
296 3300038727 Ga0400491_22007 Ga0400491_22007_207_878 215
297 3300038727 Ga0400491_22185 Ga0400491_22185_422_1093 215
298 3300038735 Ga0400485_06401 Ga0400485_06401_7053_7724 215
299 3300038741 Ga0400488_28799 Ga0400488_28799_689_1363 215
300 3300038741 Ga0400488_58092 Ga0400488_58092_360_1031 215
301 3300038742 Ga0400486_21617 Ga0400486_21617_7143_7814 215
302 3300039062 Ga0400483_040782 Ga0400483_040782_5094_5765 215
303 3300039062 Ga0400483_052033 Ga0400483_052033_462_1133 215
304 3300039062 Ga0400483_196027 Ga0400483_196027_4785_5645 215
305 3300039062 Ga0400483_203222 Ga0400483_203222_9783_10454 215
306 3300039110 Ga0400487_00965 Ga0400487_00965_123_794 215
307 3300039110 Ga0400487_15810 Ga0400487_15810_396_1070 215
308 3300039110 Ga0400487_55658 Ga0400487_55658_3483_4253 215
309 3300041512 Ga0451853_1641008 Ga0451853_1641008_1350_2027 215
310 3300044765 Ga0466970_0019030 Ga0466970_0019030_589_1263 215
311 3300045049 Ga0466959_0052822 Ga0466959_0052822_1141_1815 215
312 3300053092 Ga0500583_0075038 Ga0500583_0075038_858_1565 215
313 3300003322 rootL2_10375462 rootL2_103754622 216
314 3300003323 rootH1_10330385 rootH1_103303852 216
315 3300003792 Ga0055540_1023053 Ga0055540_10230532 216
316 3300003794 Ga0055531_10000069 Ga0055531_1000006911 216
317 3300005295 Ga0065707_10083605 Ga0065707_100836056 216
318 3300005719 Ga0068861_100011917 Ga0068861_1000119172 216
319 3300009092 Ga0105250_10000006 Ga0105250_10000006238 216
320 3300014968 Ga0157379_10000087 Ga0157379_1000008710 216
321 3300025298 Ga0209050_1004974 Ga0209050_10049744 216
322 3300025303 Ga0209051_1004198 Ga0209051_10041986 216
323 3300025304 Ga0209257_1000016 Ga0209257_1000016101 216
324 3300025711 Ga0207696_1000333 Ga0207696_10003332 216
325 3300026118 Ga0207675_100021183 Ga0207675_1000211832 216
326 3300031507 Ga0307509_10000145 Ga0307509_1000014539 216
327 3300031727 Ga0316576_10593880 Ga0316576_105938801 216
328 3300032168 Ga0316593_10083901 Ga0316593_100839011 216
329 3300033524 Ga0316592_1000646 Ga0316592_10006465 216
330 3300033527 Ga0316586_1021161 Ga0316586_10211611 216
331 3300033528 Ga0316588_1003067 Ga0316588_10030671 216
332 3300033541 Ga0316596_1002632 Ga0316596_10026321 216
333 3300036712 Ga0316584_0020738 Ga0316584_0020738_3306_3983 216
334 3300041491 Ga0451833_1075489 Ga0451833_1075489_289_963 216
335 3300046460 Ga0495638_0027727 Ga0495638_0027727_432_1106 216
336 3300046499 Ga0495594_0159543 Ga0495594_0159543_154_837 216
337 3300046660 Ga0495625_0005453 Ga0495625_0005453_10730_11404 216
338 3300046660 Ga0495625_0432730 Ga0495625_0432730_74_748 216
339 3300053139 Ga0500568_0017961 Ga0500568_0017961_197_871 216
340 3300053139 Ga0500568_0079911 Ga0500568_0079911_91_765 216
341 3300053156 Ga0500622_0005832 Ga0500622_0005832_427_1101 216
342 3300005617 Ga0068859_101203997 Ga0068859_1012039971 217
343 3300005841 Ga0068863_101037681 Ga0068863_1010376812 217
344 3300006931 Ga0097620_101204166 Ga0097620_1012041661 217
345 3300025961 Ga0207712_10166723 Ga0207712_101667233 217
346 3300026088 Ga0207641_10962720 Ga0207641_109627202 217
347 3300031727 Ga0316576_10128033 Ga0316576_101280332 217
348 3300033524 Ga0316592_1049174 Ga0316592_10491741 217
349 3300036647 Ga0316582_0148672 Ga0316582_0148672_261_956 217
350 3300036712 Ga0316584_0451831 Ga0316584_0451831_202_897 217
351 3300037471 Ga0395905_0000639 Ga0395905_0000639_40461_41138 217
352 3300045976 Ga0466967_0494328 Ga0466967_0494328_86_778 217
353 3300048903 Ga0496100_0826676 Ga0496100_0826676_17_706 217
354 3300048904 Ga0496101_0034895 Ga0496101_0034895_338_1027 217
355 3300005435 Ga0070714_100010128 Ga0070714_1000101289 218
356 3300009551 Ga0105238_10056301 Ga0105238_100563013 218
357 3300025935 Ga0207709_10150005 Ga0207709_101500052 218
358 3300025939 Ga0207665_10017070 Ga0207665_100170704 218
359 3300031548 Ga0307408_100000012 Ga0307408_100000012306 218
360 3300049523 Ga0501300_003810 Ga0501300_003810_50_727 218
361 3300050493 nmdc:mga0k408_77914_c1 nmdc:mga0k408_77914_c1_1202_1888 218
362 3300050496 nmdc:mga07m45_1109_c1 nmdc:mga07m45_1109_c1_350_1027 218
363 3300036712 Ga0316584_0146404 Ga0316584_0146404_931_1626 220
364 3300003322 rootL2_10069382 rootL2_100693824 221
365 3300045051 Ga0451576_0284999 Ga0451576_0284999_153_839 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

20

216

0.92

Feature Viewer

pLDDT pTM Quality
55.84 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map