F423578

General Info

Members Datasets Scaffolds Average Seq Length
365 203 730 323

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100274466|Ga0070674_1002744661
Length 362
Sequence VPAGKVVDRKGHPLPDQAQGQDGGLLPASWYPKGRMKRRNATFLLGNAALAWPLLIRAQQLAKIPRIGFLAAVPLATLAPRTQAFRQGLRELGYIEGENVVIEWRSADGREDRFPALAAELMRLRVDVIVTAGSSATRAAKEASVTTPIVMMQDGDPVASGFVTSLARPGGNITGLSTLFVELYGKQLELLKEAFPRLARIAVLGSSTEPSNARAFRSMEPVARALGVQLQYLDVRSPDDIETAFRAAKIGRADAILLMSSSVLAAHQTQLIDQGVRSGLPVIVYNRSLVEAGLLMSFSTNSTDLARRAATYVDKILKGMKPAELPVEQPTKFELVINLKTAKALGLTIPQSLLLRADEVIQ

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.92
Rhizosphere 97.81
Stem 0
Stem Tuber 0
Unclassified 14.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100274466 3300005356 Bacteria 1334
2 ARcpr5oldR_c004518 3300000041 Bacteria 1208
3 ARcpr5yngRDRAFT_c004897 3300000043 Bacteria 1248
4 rootL2_10146872 3300003322 Bacteria 1746
5 Ga0065712_10088626 3300005290 Unclassified 2495
6 Ga0065715_10089123 3300005293 Bacteria 13935
7 Ga0065715_10101921 3300005293 Bacteria 3159
8 Ga0065707_10003495 3300005295 Bacteria 6645
9 Ga0070683_100253807 3300005329 Bacteria 1673
10 Ga0070690_100219494 3300005330 Bacteria 1331
11 Ga0070670_100161411 3300005331 Bacteria 1942
12 Ga0070670_100235458 3300005331 Bacteria 1594
13 Ga0070670_100316826 3300005331 Unclassified 1366
14 Ga0070677_10004782 3300005333 Bacteria 4439
15 Ga0068869_100047668 3300005334 Unclassified 3095
16 Ga0070666_10008154 3300005335 Bacteria 6489
17 Ga0070666_10057670 3300005335 Bacteria 2624
18 Ga0070666_10145996 3300005335 Bacteria 1649
19 Ga0070680_100071649 3300005336 Bacteria 2848
20 Ga0068868_100166507 3300005338 Bacteria 1823
21 Ga0070689_100336959 3300005340 Bacteria 1263
22 Ga0070661_100300160 3300005344 Unclassified 1250
23 Ga0070668_100099604 3300005347 Bacteria 2301
24 Ga0070669_100052080 3300005353 Bacteria 2993
25 Ga0070669_100216332 3300005353 Bacteria 1513
26 Ga0070675_100040730 3300005354 Bacteria 3793
27 Ga0070675_100091469 3300005354 Bacteria 2549
28 Ga0070675_100193003 3300005354 Bacteria 1765
29 Ga0070675_100204324 3300005354 Bacteria 1715
30 Ga0070671_100009061 3300005355 Bacteria 7987
31 Ga0070671_100115485 3300005355 Bacteria 2257
32 Ga0070705_100085620 3300005440 Bacteria 1949
33 Ga0070708_100165434 3300005445 Unclassified 2063
34 Ga0070708_100170194 3300005445 Unclassified 2033
35 Ga0070708_100235008 3300005445 Bacteria 1720
36 Ga0070663_100197038 3300005455 Bacteria 1570
37 Ga0070678_100107583 3300005456 Bacteria 2175
38 Ga0070678_100402774 3300005456 Unclassified 1189
39 Ga0070662_100097103 3300005457 Bacteria 2223
40 Ga0070662_100120180 3300005457 Bacteria 2013
41 Ga0070662_100196359 3300005457 Unclassified 1599
42 Ga0070662_100314342 3300005457 Bacteria 1276
43 Ga0070681_10465022 3300005458 Unclassified 1177
44 Ga0068867_100295315 3300005459 Bacteria 1334
45 Ga0070685_10068218 3300005466 Bacteria 2100
46 Ga0070706_100008691 3300005467 Bacteria 9466
47 Ga0070706_100113747 3300005467 Unclassified 2520
48 Ga0070706_100145324 3300005467 Bacteria 2214
49 Ga0070706_100544571 3300005467 Unclassified 1079
50 Ga0070707_100340631 3300005468 Unclassified 1457
51 Ga0070707_100396319 3300005468 Bacteria 1340
52 Ga0070698_100001015 3300005471 Bacteria 30868
53 Ga0070698_100126622 3300005471 Bacteria 2511
54 Ga0070698_100183931 3300005471 Bacteria 2028
55 Ga0070698_100266886 3300005471 Bacteria 1643
56 Ga0070699_100050919 3300005518 Bacteria 3585
57 Ga0070699_100169453 3300005518 Bacteria 1934
58 Ga0070697_100006249 3300005536 Bacteria 9221
59 Ga0070697_100198160 3300005536 Bacteria 1706
60 Ga0068853_100033279 3300005539 Bacteria 4372
61 Ga0070672_100066112 3300005543 Bacteria 2862
62 Ga0070686_100204123 3300005544 Bacteria 1419
63 Ga0070695_100010675 3300005545 Bacteria 5487
64 Ga0070696_100058926 3300005546 Bacteria 2683
65 Ga0070696_100100095 3300005546 Bacteria 2075
66 Ga0070665_100240463 3300005548 Bacteria 1811
67 Ga0070704_100079116 3300005549 Bacteria 2414
68 Ga0070664_100037180 3300005564 Bacteria 4091
69 Ga0070664_100073530 3300005564 Bacteria 2933
70 Ga0068857_100010099 3300005577 Bacteria 8200
71 Ga0068857_100092294 3300005577 Bacteria 2711
72 Ga0068854_100250859 3300005578 Bacteria 1413
73 Ga0068856_100172372 3300005614 Unclassified 2176
74 Ga0068859_100187410 3300005617 Bacteria 2153
75 Ga0068864_100038864 3300005618 Bacteria 4065
76 Ga0068864_100040554 3300005618 Bacteria 3982
77 Ga0068861_100298078 3300005719 Unclassified 1395
78 Ga0068851_10103533 3300005834 Bacteria 1512
79 Ga0068870_10084905 3300005840 Bacteria 1758
80 Ga0068863_100132644 3300005841 Bacteria 2378
81 Ga0068858_100140934 3300005842 Bacteria 2263
82 Ga0068860_100198870 3300005843 Bacteria 1942
83 Ga0068862_100201758 3300005844 Unclassified 1794
84 Ga0081455_10000512 3300005937 Bacteria 50237
85 Ga0081455_10023483 3300005937 Bacteria 5736
86 Ga0081455_10038788 3300005937 Bacteria 4216
87 Ga0081538_10092140 3300005981 Bacteria 1561
88 Ga0097621_100201657 3300006237 Bacteria 1727
89 Ga0068871_100185314 3300006358 Bacteria 1790
90 Ga0075428_100053986 3300006844 Bacteria 4403
91 Ga0075428_100089849 3300006844 Bacteria 3350
92 Ga0075431_100166040 3300006847 Unclassified 2269
93 Ga0075431_100215713 3300006847 Bacteria 1959
94 Ga0075431_100217534 3300006847 Bacteria 1949
95 Ga0075433_10035227 3300006852 Bacteria 4303
96 Ga0075433_10097046 3300006852 Bacteria 2609
97 Ga0075433_10169367 3300006852 Bacteria 1944
98 Ga0075433_10317555 3300006852 Bacteria 1378
99 Ga0075434_100038356 3300006871 Bacteria 4745
100 Ga0075434_100038736 3300006871 Bacteria 4722
101 Ga0075434_100096548 3300006871 Bacteria 2960
102 Ga0075434_100136598 3300006871 Bacteria 2471
103 Ga0075434_100176659 3300006871 Bacteria 2155
104 Ga0075434_100376131 3300006871 Bacteria 1441
105 Ga0075434_100419398 3300006871 Bacteria 1359
106 Ga0075434_100560839 3300006871 Bacteria 1162
107 Ga0075429_100401471 3300006880 Unclassified 1200
108 Ga0068865_100234696 3300006881 Bacteria 1441
109 Ga0075436_100228523 3300006914 Bacteria 1321
110 Ga0097620_100187406 3300006931 Bacteria 2153
111 Ga0075435_100012742 3300007076 Bacteria 6231
112 Ga0075435_100020748 3300007076 Bacteria 5042
113 Ga0075435_100395956 3300007076 Unclassified 1187
114 Ga0111539_10134680 3300009094 Bacteria 2893
115 Ga0111539_10179958 3300009094 Bacteria 2470
116 Ga0111539_10225685 3300009094 Bacteria 2182
117 Ga0111539_10562184 3300009094 Bacteria 1328
118 Ga0105245_10269988 3300009098 Bacteria 1659
119 Ga0114129_10078568 3300009147 Bacteria 4590
120 Ga0114129_10112123 3300009147 Bacteria 3761
121 Ga0114129_10118378 3300009147 Bacteria 3649
122 Ga0114129_10190370 3300009147 Bacteria 2786
123 Ga0114129_10201400 3300009147 Bacteria 2696
124 Ga0114129_10402269 3300009147 Bacteria 1804
125 Ga0114129_10431052 3300009147 Bacteria 1732
126 Ga0114129_10458009 3300009147 Unclassified 1672
127 Ga0114129_10466339 3300009147 Bacteria 1654
128 Ga0114129_10556807 3300009147 Bacteria 1490
129 Ga0114129_10623443 3300009147 Bacteria 1395
130 Ga0114129_11064227 3300009147 Bacteria 1015
131 Ga0105243_10005129 3300009148 Bacteria 10272
132 Ga0105241_10267753 3300009174 Bacteria 1454
133 Ga0105242_10017304 3300009176 Bacteria 5614
134 Ga0105248_10025598 3300009177 Bacteria 6561
135 Ga0105248_10296070 3300009177 Bacteria 1822
136 Ga0105237_10164804 3300009545 Bacteria 2215
137 Ga0105249_10048073 3300009553 Bacteria 3890
138 Ga0105249_10224208 3300009553 Unclassified 1851
139 Ga0105249_10338026 3300009553 Bacteria 1522
140 Ga0105249_10372875 3300009553 Bacteria 1451
141 Ga0105239_10167423 3300010375 Bacteria 2458
142 Ga0157374_10242728 3300013296 Bacteria 1772
143 Ga0157378_10001136 3300013297 Bacteria 24233
144 Ga0157378_10047356 3300013297 Bacteria 3823
145 Ga0163162_10017303 3300013306 Bacteria 7053
146 Ga0163162_10026395 3300013306 Bacteria 5739
147 Ga0163162_10154785 3300013306 Bacteria 2412
148 Ga0163162_10260024 3300013306 Bacteria 1868
149 Ga0163162_10484216 3300013306 Bacteria 1368
150 Ga0157375_10520380 3300013308 Bacteria 1353
151 Ga0163163_10004431 3300014325 Bacteria 11977
152 Ga0157377_10048158 3300014745 Bacteria 2390
153 Ga0157379_10112359 3300014968 Bacteria 2448
154 Ga0157376_10014272 3300014969 Bacteria 5957
155 Ga0157376_10125735 3300014969 Unclassified 2280
156 Ga0163161_10070697 3300017792 Bacteria 2552
157 Ga0163161_10208698 3300017792 Bacteria 1508
158 Ga0207673_1002760 3300025290 Bacteria 2021
159 Ga0207697_10007689 3300025315 Bacteria 4780
160 Ga0207697_10046889 3300025315 Bacteria 1781
161 Ga0207656_10025460 3300025321 Bacteria 2402
162 Ga0207682_10021395 3300025893 Bacteria 2544
163 Ga0207642_10084525 3300025899 Bacteria 1550
164 Ga0207680_10010141 3300025903 Bacteria 4701
165 Ga0207680_10136895 3300025903 Bacteria 1620
166 Ga0207645_10000888 3300025907 Bacteria 24819
167 Ga0207643_10093199 3300025908 Bacteria 1758
168 Ga0207684_10042101 3300025910 Bacteria 3871
169 Ga0207684_10065649 3300025910 Unclassified 3081
170 Ga0207684_10300681 3300025910 Bacteria 1383
171 Ga0207654_10193369 3300025911 Bacteria 1335
172 Ga0207707_10224253 3300025912 Bacteria 1636
173 Ga0207649_10086909 3300025920 Bacteria 2039
174 Ga0207646_10320034 3300025922 Bacteria 1402
175 Ga0207681_10056305 3300025923 Bacteria 2681
176 Ga0207650_10084905 3300025925 Bacteria 2407
177 Ga0207650_10182706 3300025925 Bacteria 1672
178 Ga0207659_10048303 3300025926 Bacteria 3014
179 Ga0207644_10007021 3300025931 Bacteria 7333
180 Ga0207706_10000542 3300025933 Bacteria 40183
181 Ga0207706_10012853 3300025933 Bacteria 7619
182 Ga0207706_10129463 3300025933 Unclassified 2220
183 Ga0207706_10283901 3300025933 Unclassified 1443
184 Ga0207709_10036773 3300025935 Bacteria 2904
185 Ga0207669_10214824 3300025937 Bacteria 1407
186 Ga0207691_10076255 3300025940 Bacteria 3022
187 Ga0207691_10129519 3300025940 Bacteria 2230
188 Ga0207711_10016418 3300025941 Bacteria 6154
189 Ga0207711_10029308 3300025941 Bacteria 4641
190 Ga0207689_10022491 3300025942 Bacteria 5301
191 Ga0207689_10221376 3300025942 Bacteria 1564
192 Ga0207661_10202333 3300025944 Bacteria 1746
193 Ga0207679_10006358 3300025945 Bacteria 7466
194 Ga0207668_10349786 3300025972 Bacteria 1235
195 Ga0207703_10012140 3300026035 Bacteria 6713
196 Ga0207703_10177308 3300026035 Bacteria 1878
197 Ga0207678_10290706 3300026067 Bacteria 1404
198 Ga0207708_10056492 3300026075 Bacteria 2995
199 Ga0207641_10321487 3300026088 Bacteria 1467
200 Ga0207648_10282074 3300026089 Bacteria 1485
201 Ga0207676_10005710 3300026095 Bacteria 8806
202 Ga0207675_100422667 3300026118 Bacteria 1316
203 Ga0207683_10055086 3300026121 Bacteria 3488
204 Ga0207683_10077381 3300026121 Unclassified 2946
205 Ga0207683_10199956 3300026121 Bacteria 1816
206 Ga0207698_10420828 3300026142 Bacteria 1282
207 Ga0209982_1002280 3300027552 Unclassified 2688
208 Ga0209983_1012051 3300027665 Unclassified 1773
209 Ga0209998_10010637 3300027717 Bacteria 1905
210 Ga0209974_10005400 3300027876 Bacteria 4497
211 Ga0209974_10018444 3300027876 Bacteria 2315
212 Ga0268266_10031400 3300028379 Bacteria 4510
213 Ga0268265_10142441 3300028380 Bacteria 2009
214 Ga0307405_10222279 3300031731 Unclassified 1386
215 Ga0307406_10198953 3300031901 Unclassified 1473
216 Ga0307409_100001948 3300031995 Bacteria 10545
217 Ga0307416_100009406 3300032002 Bacteria 6395
218 Ga0307415_100016052 3300032126 Bacteria 4451
219 Ga0373926_0040280 3300035083 Bacteria 1667
220 Ga0373940_0016908 3300035088 Bacteria 1813
221 Ga0373942_0042593 3300035207 Bacteria 1245
222 Ga0373931_0044918 3300035691 Bacteria 2331
223 Ga0373931_0054620 3300035691 Bacteria 2135
224 Ga0373931_0106993 3300035691 Bacteria 1581
225 Ga0373947_0373109 3300035725 Bacteria 959
226 Ga0373925_0189573 3300037068 Bacteria 1631
227 Ga0395905_0002137 3300037471 Bacteria 22424
228 Ga0439441_012195 3300042001 Bacteria 1471
229 Ga0439435_0016372 3300042436 Bacteria 1859
230 Ga0451577_0173672 3300042876 Bacteria 1942
231 Ga0453683_0137224 3300044673 Unclassified 1543
232 Ga0495603_0267824 3300046455 Bacteria 983
233 Ga0495629_0217849 3300046459 Bacteria 1317
234 Ga0495580_0084596 3300046472 Bacteria 2209
235 Ga0495582_0066408 3300046473 Bacteria 1993
236 Ga0495642_0104410 3300046528 Unclassified 1208
237 Ga0495652_0250668 3300046529 Bacteria 1312
238 Ga0495645_0198964 3300046543 Bacteria 1361
239 Ga0495634_0053870 3300046642 Bacteria 2693
240 Ga0495604_0102158 3300047317 Bacteria 2105
241 Ga0495636_0014079 3300047318 Bacteria 3179
242 Ga0495680_0245855 3300047322 Bacteria 1269
243 Ga0495684_0107755 3300047471 Bacteria 2104
244 Ga0496100_0302152 3300048903 Bacteria 1198
245 Ga0496101_0183766 3300048904 Bacteria 1611
246 Ga0496106_0235104 3300048909 Bacteria 1464
247 Ga0496109_0018831 3300048912 Bacteria 6074
248 Ga0496109_0550299 3300048912 Bacteria 1089
249 Ga0496110_0309462 3300048913 Bacteria 1439
250 Ga0496112_0040446 3300048915 Bacteria 4558
251 Ga0501031_0034316 3300049568 Bacteria 3310
252 Ga0501033_0076388 3300049570 Bacteria 2459
253 Ga0501033_0108268 3300049570 Unclassified 2024
254 Ga0501033_0233784 3300049570 Unclassified 1305
255 Ga0501036_0130449 3300049572 Bacteria 2122
256 Ga0501037_0074807 3300049573 Unclassified 2460
257 Ga0501038_0013105 3300049574 Bacteria 7562
258 Ga0501038_0078850 3300049574 Bacteria 2778
259 Ga0501039_0007245 3300049575 Bacteria 8450
260 Ga0501040_0000687 3300049576 Bacteria 20864
261 Ga0501040_0001171 3300049576 Bacteria 16682
262 Ga0501041_0002241 3300049577 Bacteria 10927
263 Ga0501041_0039788 3300049577 Unclassified 2853
264 Ga0501042_0040298 3300049578 Bacteria 3321
265 Ga0501042_0078678 3300049578 Bacteria 2362
266 Ga0501046_0043741 3300049580 Bacteria 3565
267 Ga0501046_0129619 3300049580 Bacteria 1913
268 Ga0501048_0017741 3300049582 Bacteria 5238
269 Ga0501048_0021894 3300049582 Bacteria 4678
270 Ga0501048_0087462 3300049582 Bacteria 2198
271 Ga0501068_0094917 3300049584 Bacteria 1844
272 Ga0501069_0129254 3300049585 Unclassified 1446
273 Ga0501071_0126896 3300049587 Unclassified 1894
274 Ga0501072_0001231 3300049588 Bacteria 19111
275 Ga0501072_0026727 3300049588 Bacteria 4501
276 Ga0501073_0049720 3300049589 Bacteria 2939
277 Ga0501074_0055719 3300049590 Bacteria 2849
278 Ga0501074_0161627 3300049590 Unclassified 1599
279 Ga0501075_0002400 3300049591 Bacteria 12446
280 Ga0501075_0041425 3300049591 Bacteria 3451
281 Ga0501075_0116360 3300049591 Bacteria 2032
282 Ga0501076_0006004 3300049592 Bacteria 8774
283 Ga0501076_0007654 3300049592 Bacteria 7866
284 Ga0501076_0040445 3300049592 Bacteria 3664
285 Ga0501076_0104953 3300049592 Bacteria 2280
286 Ga0501077_0005044 3300049593 Bacteria 8005
287 Ga0501077_0009825 3300049593 Bacteria 5953
288 Ga0501077_0022461 3300049593 Bacteria 3996
289 Ga0501077_0083715 3300049593 Unclassified 2021
290 Ga0501079_0015237 3300049741 Bacteria 5865
291 Ga0501079_0027413 3300049741 Bacteria 4368
292 Ga0501079_0042509 3300049741 Bacteria 3508
293 Ga0501080_0014404 3300049742 Bacteria 7283
294 Ga0501080_0255793 3300049742 Unclassified 1596
295 Ga0501081_0002631 3300049743 Bacteria 11351
296 Ga0501081_0012431 3300049743 Bacteria 5595
297 Ga0501081_0052283 3300049743 Bacteria 2818
298 Ga0501081_0060575 3300049743 Unclassified 2623
299 Ga0501081_0176063 3300049743 Bacteria 1546
300 Ga0501083_0061804 3300049744 Bacteria 2500
301 Ga0501035_0410975 3300049822 Unclassified 1125
302 Ga0501044_0263635 3300049823 Unclassified 1661
303 Ga0501045_0002975 3300049824 Bacteria 11590
304 Ga0501045_0013912 3300049824 Bacteria 5691
305 Ga0501045_0074288 3300049824 Bacteria 2504
306 nmdc:mga05p37_106424_c1 3300050507 Bacteria 3451
307 nmdc:mga05p37_148129_c1 3300050507 Bacteria 2873
308 nmdc:mga05p37_159600_c1 3300050507 Bacteria 2754
309 nmdc:mga05p37_165925_c1 3300050507 Bacteria 2695
310 nmdc:mga05p37_180061_c1 3300050507 Bacteria 2572
311 nmdc:mga05p37_246205_c1 3300050507 Bacteria 2146
312 nmdc:mga05p37_332475_c1 3300050507 Bacteria 1794
313 nmdc:mga05p37_385983_c1 3300050507 Unclassified 1640
314 nmdc:mga05p37_416186_c1 3300050507 Bacteria 1565
315 nmdc:mga05p37_42406_c1 3300050507 Bacteria 5591
316 nmdc:mga05p37_436851_c1 3300050507 Bacteria 1519
317 nmdc:mga05p37_664236_c1 3300050507 Bacteria 1165
318 nmdc:mga05p37_75716_c1 3300050507 Bacteria 4143
319 nmdc:mga09592_241028_c1 3300050508 Unclassified 1567
320 nmdc:mga09592_281530_c1 3300050508 Bacteria 1442
321 nmdc:mga06r32_49286_c1 3300050510 Bacteria 4027
322 nmdc:mga06r32_499797_c1 3300050510 Bacteria 1193
323 nmdc:mga06r32_94417_c1 3300050510 Unclassified 2927
324 nmdc:mga08y16_134727_c1 3300050511 Bacteria 2567
325 nmdc:mga08y16_79387_c1 3300050511 Unclassified 3420
326 nmdc:mga08y16_95001_c1 3300050511 Bacteria 3105
327 nmdc:mga0n895_129634_c1 3300050512 Bacteria 2547
328 nmdc:mga0n895_173290_c1 3300050512 Bacteria 2189
329 nmdc:mga0n895_213422_c1 3300050512 Bacteria 1960
330 nmdc:mga0n895_35877_c1 3300050512 Bacteria 4785
331 nmdc:mga0n895_3700_c1 3300050512 Bacteria 12364
332 nmdc:mga0n895_632542_c1 3300050512 Bacteria 1070
333 nmdc:mga0n895_72432_c1 3300050512 Unclassified 3418
334 nmdc:mga0n895_7847_c1 3300050512 Bacteria 9201
335 nmdc:mga0rr50_116159_c1 3300050513 Bacteria 2124
336 nmdc:mga0rr50_330031_c1 3300050513 Bacteria 1280
337 nmdc:mga0rr50_73828_c1 3300050513 Unclassified 2609
338 nmdc:mga0rr50_82726_c1 3300050513 Unclassified 2480
339 nmdc:mga0rr50_87940_c1 3300050513 Bacteria 2413
340 nmdc:mga08x19_15298_c1 3300050514 Bacteria 4667
341 nmdc:mga08x19_243385_c1 3300050514 Bacteria 1240
342 nmdc:mga08x19_293571_c1 3300050514 Bacteria 1128
343 nmdc:mga0a205_112624_c1 3300050515 Bacteria 2620
344 nmdc:mga0a205_218139_c1 3300050515 Bacteria 1794
345 nmdc:mga0a205_35123_c2 3300050515 Unclassified 3936
346 nmdc:mga0a205_370243_c1 3300050515 Bacteria 1299
347 nmdc:mga0a205_83412_c1 3300050515 Bacteria 3087
348 Ga0495601_0111957 3300053077 Bacteria 1768
349 Ga0495601_0150278 3300053077 Bacteria 1520
350 Ga0495595_0027828 3300053084 Bacteria 2521
351 Ga0495619_0155951 3300053085 Bacteria 1575
352 Ga0501084_0006167 3300054114 Bacteria 9860
353 Ga0501084_0008164 3300054114 Bacteria 8633
354 Ga0501084_0038963 3300054114 Bacteria 3975
355 Ga0501084_0118609 3300054114 Bacteria 2224
356 Ga0501084_0329422 3300054114 Unclassified 1290
357 Ga0590077_007325 3300059426 Unclassified 2257
358 Ga0501082_0006083 3300060353 Bacteria 10475
359 Ga0501082_0017466 3300060353 Bacteria 6182
360 Ga0530510_0000293 3300061734 Bacteria 31807
361 Ga0530510_0002804 3300061734 Bacteria 11983
362 Ga0530510_0003648 3300061734 Bacteria 10601
363 Ga0530510_0004086 3300061734 Bacteria 10069
364 Ga0530510_0052869 3300061734 Unclassified 2934
365 Ga0530510_0064344 3300061734 Bacteria 2656
366 Ga0070674_100274466
367 ARcpr5oldR_c004518
368 ARcpr5yngRDRAFT_c004897
369 rootL2_10146872
370 Ga0065712_10088626
371 Ga0065715_10089123
372 Ga0065715_10101921
373 Ga0065707_10003495
374 Ga0070683_100253807
375 Ga0070690_100219494
376 Ga0070670_100161411
377 Ga0070670_100235458
378 Ga0070670_100316826
379 Ga0070677_10004782
380 Ga0068869_100047668
381 Ga0070666_10008154
382 Ga0070666_10057670
383 Ga0070666_10145996
384 Ga0070680_100071649
385 Ga0068868_100166507
386 Ga0070689_100336959
387 Ga0070661_100300160
388 Ga0070668_100099604
389 Ga0070669_100052080
390 Ga0070669_100216332
391 Ga0070675_100040730
392 Ga0070675_100091469
393 Ga0070675_100193003
394 Ga0070675_100204324
395 Ga0070671_100009061
396 Ga0070671_100115485
397 Ga0070705_100085620
398 Ga0070708_100165434
399 Ga0070708_100170194
400 Ga0070708_100235008
401 Ga0070663_100197038
402 Ga0070678_100107583
403 Ga0070678_100402774
404 Ga0070662_100097103
405 Ga0070662_100120180
406 Ga0070662_100196359
407 Ga0070662_100314342
408 Ga0070681_10465022
409 Ga0068867_100295315
410 Ga0070685_10068218
411 Ga0070706_100008691
412 Ga0070706_100113747
413 Ga0070706_100145324
414 Ga0070706_100544571
415 Ga0070707_100340631
416 Ga0070707_100396319
417 Ga0070698_100001015
418 Ga0070698_100126622
419 Ga0070698_100183931
420 Ga0070698_100266886
421 Ga0070699_100050919
422 Ga0070699_100169453
423 Ga0070697_100006249
424 Ga0070697_100198160
425 Ga0068853_100033279
426 Ga0070672_100066112
427 Ga0070686_100204123
428 Ga0070695_100010675
429 Ga0070696_100058926
430 Ga0070696_100100095
431 Ga0070665_100240463
432 Ga0070704_100079116
433 Ga0070664_100037180
434 Ga0070664_100073530
435 Ga0068857_100010099
436 Ga0068857_100092294
437 Ga0068854_100250859
438 Ga0068856_100172372
439 Ga0068859_100187410
440 Ga0068864_100038864
441 Ga0068864_100040554
442 Ga0068861_100298078
443 Ga0068851_10103533
444 Ga0068870_10084905
445 Ga0068863_100132644
446 Ga0068858_100140934
447 Ga0068860_100198870
448 Ga0068862_100201758
449 Ga0081455_10000512
450 Ga0081455_10023483
451 Ga0081455_10038788
452 Ga0081538_10092140
453 Ga0097621_100201657
454 Ga0068871_100185314
455 Ga0075428_100053986
456 Ga0075428_100089849
457 Ga0075431_100166040
458 Ga0075431_100215713
459 Ga0075431_100217534
460 Ga0075433_10035227
461 Ga0075433_10097046
462 Ga0075433_10169367
463 Ga0075433_10317555
464 Ga0075434_100038356
465 Ga0075434_100038736
466 Ga0075434_100096548
467 Ga0075434_100136598
468 Ga0075434_100176659
469 Ga0075434_100376131
470 Ga0075434_100419398
471 Ga0075434_100560839
472 Ga0075429_100401471
473 Ga0068865_100234696
474 Ga0075436_100228523
475 Ga0097620_100187406
476 Ga0075435_100012742
477 Ga0075435_100020748
478 Ga0075435_100395956
479 Ga0111539_10134680
480 Ga0111539_10179958
481 Ga0111539_10225685
482 Ga0111539_10562184
483 Ga0105245_10269988
484 Ga0114129_10078568
485 Ga0114129_10112123
486 Ga0114129_10118378
487 Ga0114129_10190370
488 Ga0114129_10201400
489 Ga0114129_10402269
490 Ga0114129_10431052
491 Ga0114129_10458009
492 Ga0114129_10466339
493 Ga0114129_10556807
494 Ga0114129_10623443
495 Ga0114129_11064227
496 Ga0105243_10005129
497 Ga0105241_10267753
498 Ga0105242_10017304
499 Ga0105248_10025598
500 Ga0105248_10296070
501 Ga0105237_10164804
502 Ga0105249_10048073
503 Ga0105249_10224208
504 Ga0105249_10338026
505 Ga0105249_10372875
506 Ga0105239_10167423
507 Ga0157374_10242728
508 Ga0157378_10001136
509 Ga0157378_10047356
510 Ga0163162_10017303
511 Ga0163162_10026395
512 Ga0163162_10154785
513 Ga0163162_10260024
514 Ga0163162_10484216
515 Ga0157375_10520380
516 Ga0163163_10004431
517 Ga0157377_10048158
518 Ga0157379_10112359
519 Ga0157376_10014272
520 Ga0157376_10125735
521 Ga0163161_10070697
522 Ga0163161_10208698
523 Ga0207673_1002760
524 Ga0207697_10007689
525 Ga0207697_10046889
526 Ga0207656_10025460
527 Ga0207682_10021395
528 Ga0207642_10084525
529 Ga0207680_10010141
530 Ga0207680_10136895
531 Ga0207645_10000888
532 Ga0207643_10093199
533 Ga0207684_10042101
534 Ga0207684_10065649
535 Ga0207684_10300681
536 Ga0207654_10193369
537 Ga0207707_10224253
538 Ga0207649_10086909
539 Ga0207646_10320034
540 Ga0207681_10056305
541 Ga0207650_10084905
542 Ga0207650_10182706
543 Ga0207659_10048303
544 Ga0207644_10007021
545 Ga0207706_10000542
546 Ga0207706_10012853
547 Ga0207706_10129463
548 Ga0207706_10283901
549 Ga0207709_10036773
550 Ga0207669_10214824
551 Ga0207691_10076255
552 Ga0207691_10129519
553 Ga0207711_10016418
554 Ga0207711_10029308
555 Ga0207689_10022491
556 Ga0207689_10221376
557 Ga0207661_10202333
558 Ga0207679_10006358
559 Ga0207668_10349786
560 Ga0207703_10012140
561 Ga0207703_10177308
562 Ga0207678_10290706
563 Ga0207708_10056492
564 Ga0207641_10321487
565 Ga0207648_10282074
566 Ga0207676_10005710
567 Ga0207675_100422667
568 Ga0207683_10055086
569 Ga0207683_10077381
570 Ga0207683_10199956
571 Ga0207698_10420828
572 Ga0209982_1002280
573 Ga0209983_1012051
574 Ga0209998_10010637
575 Ga0209974_10005400
576 Ga0209974_10018444
577 Ga0268266_10031400
578 Ga0268265_10142441
579 Ga0307405_10222279
580 Ga0307406_10198953
581 Ga0307409_100001948
582 Ga0307416_100009406
583 Ga0307415_100016052
584 Ga0373926_0040280
585 Ga0373940_0016908
586 Ga0373942_0042593
587 Ga0373931_0044918
588 Ga0373931_0054620
589 Ga0373931_0106993
590 Ga0373947_0373109
591 Ga0373925_0189573
592 Ga0395905_0002137
593 Ga0439441_012195
594 Ga0439435_0016372
595 Ga0451577_0173672
596 Ga0453683_0137224
597 Ga0495603_0267824
598 Ga0495629_0217849
599 Ga0495580_0084596
600 Ga0495582_0066408
601 Ga0495642_0104410
602 Ga0495652_0250668
603 Ga0495645_0198964
604 Ga0495634_0053870
605 Ga0495604_0102158
606 Ga0495636_0014079
607 Ga0495680_0245855
608 Ga0495684_0107755
609 Ga0496100_0302152
610 Ga0496101_0183766
611 Ga0496106_0235104
612 Ga0496109_0018831
613 Ga0496109_0550299
614 Ga0496110_0309462
615 Ga0496112_0040446
616 Ga0501031_0034316
617 Ga0501033_0076388
618 Ga0501033_0108268
619 Ga0501033_0233784
620 Ga0501036_0130449
621 Ga0501037_0074807
622 Ga0501038_0013105
623 Ga0501038_0078850
624 Ga0501039_0007245
625 Ga0501040_0000687
626 Ga0501040_0001171
627 Ga0501041_0002241
628 Ga0501041_0039788
629 Ga0501042_0040298
630 Ga0501042_0078678
631 Ga0501046_0043741
632 Ga0501046_0129619
633 Ga0501048_0017741
634 Ga0501048_0021894
635 Ga0501048_0087462
636 Ga0501068_0094917
637 Ga0501069_0129254
638 Ga0501071_0126896
639 Ga0501072_0001231
640 Ga0501072_0026727
641 Ga0501073_0049720
642 Ga0501074_0055719
643 Ga0501074_0161627
644 Ga0501075_0002400
645 Ga0501075_0041425
646 Ga0501075_0116360
647 Ga0501076_0006004
648 Ga0501076_0007654
649 Ga0501076_0040445
650 Ga0501076_0104953
651 Ga0501077_0005044
652 Ga0501077_0009825
653 Ga0501077_0022461
654 Ga0501077_0083715
655 Ga0501079_0015237
656 Ga0501079_0027413
657 Ga0501079_0042509
658 Ga0501080_0014404
659 Ga0501080_0255793
660 Ga0501081_0002631
661 Ga0501081_0012431
662 Ga0501081_0052283
663 Ga0501081_0060575
664 Ga0501081_0176063
665 Ga0501083_0061804
666 Ga0501035_0410975
667 Ga0501044_0263635
668 Ga0501045_0002975
669 Ga0501045_0013912
670 Ga0501045_0074288
671 nmdc:mga05p37_106424_c1
672 nmdc:mga05p37_148129_c1
673 nmdc:mga05p37_159600_c1
674 nmdc:mga05p37_165925_c1
675 nmdc:mga05p37_180061_c1
676 nmdc:mga05p37_246205_c1
677 nmdc:mga05p37_332475_c1
678 nmdc:mga05p37_385983_c1
679 nmdc:mga05p37_416186_c1
680 nmdc:mga05p37_42406_c1
681 nmdc:mga05p37_436851_c1
682 nmdc:mga05p37_664236_c1
683 nmdc:mga05p37_75716_c1
684 nmdc:mga09592_241028_c1
685 nmdc:mga09592_281530_c1
686 nmdc:mga06r32_49286_c1
687 nmdc:mga06r32_499797_c1
688 nmdc:mga06r32_94417_c1
689 nmdc:mga08y16_134727_c1
690 nmdc:mga08y16_79387_c1
691 nmdc:mga08y16_95001_c1
692 nmdc:mga0n895_129634_c1
693 nmdc:mga0n895_173290_c1
694 nmdc:mga0n895_213422_c1
695 nmdc:mga0n895_35877_c1
696 nmdc:mga0n895_3700_c1
697 nmdc:mga0n895_632542_c1
698 nmdc:mga0n895_72432_c1
699 nmdc:mga0n895_7847_c1
700 nmdc:mga0rr50_116159_c1
701 nmdc:mga0rr50_330031_c1
702 nmdc:mga0rr50_73828_c1
703 nmdc:mga0rr50_82726_c1
704 nmdc:mga0rr50_87940_c1
705 nmdc:mga08x19_15298_c1
706 nmdc:mga08x19_243385_c1
707 nmdc:mga08x19_293571_c1
708 nmdc:mga0a205_112624_c1
709 nmdc:mga0a205_218139_c1
710 nmdc:mga0a205_35123_c2
711 nmdc:mga0a205_370243_c1
712 nmdc:mga0a205_83412_c1
713 Ga0495601_0111957
714 Ga0495601_0150278
715 Ga0495595_0027828
716 Ga0495619_0155951
717 Ga0501084_0006167
718 Ga0501084_0008164
719 Ga0501084_0038963
720 Ga0501084_0118609
721 Ga0501084_0329422
722 Ga0590077_007325
723 Ga0501082_0006083
724 Ga0501082_0017466
725 Ga0530510_0000293
726 Ga0530510_0002804
727 Ga0530510_0003648
728 Ga0530510_0004086
729 Ga0530510_0052869
730 Ga0530510_0064344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

66

361

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9325 33 328
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9265 33 328
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9234 33 329
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9204 33 329
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9169 36 329
ID Description Score Start End Superfamily
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9034 149 328 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8917 149 329 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8916 149 328 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.886 149 329 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8728 34 300 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1Y2JG93-F1-model_v4 Uncharacterized protein 0.9857 236 328
AF-A0A2V7DBA7-F1-model_v4 ABC transporter substrate-binding protein 0.969 33 294
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9681 236 330
AF-A0A536TI46-F1-model_v4 ABC transporter substrate-binding protein 0.9676 60 330 GO:0016020
AF-A0A2V7D4C4-F1-model_v4 ABC transporter substrate-binding protein 0.9617 235 330

Map