F423554

General Info

Members Datasets Scaffolds Average Seq Length
365 219 361 218

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100095773|Ga0070670_1000957732
Length 236
Sequence MRNDAQAEAKREKRDIVSGEICDEAGLIRFVPGPDGTVTPDLARKLPGRGLWVAADRVSVETAARRNLFARAAKAKLSAPAGLADQVESLLKARLLSGLGLARRAGELAAGFEKVGQAIGAGRAAWLIEASDGADDGRRKVLALARRQPRPPRLFGVFSAEELGLALGLENVIHTAFLAGRASERWTSDVQRLSGFRPLLPESWREDLPAADGTDLVPGAGIILTDDGAGRTPAAM

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
208 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
211 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
212 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
213 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
217 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.52
Nodule 0
Rhizoplane 3.29
Rhizosphere 75.89
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10022021 3300003215 Bacteria 2362
2 Ga0055530_10000586 3300003791 Bacteria 31506
3 Ga0055531_10000968 3300003794 Bacteria 22999
4 Ga0055543_1007041 3300004625 Bacteria 2645
5 Ga0065165_1013914 3300005262 Bacteria 3158
6 Ga0070658_10361343 3300005327 Bacteria 1243
7 Ga0070670_100000007 3300005331 Bacteria 318672
8 Ga0070670_100095773 3300005331 Bacteria 2553
9 Ga0070670_100137976 3300005331 Bacteria 2108
10 Ga0070670_100491540 3300005331 Bacteria 1090
11 Ga0068869_100078046 3300005334 Bacteria 2465
12 Ga0068869_100558238 3300005334 Bacteria 963
13 Ga0070666_10034211 3300005335 Bacteria 3368
14 Ga0070666_10407050 3300005335 Bacteria 979
15 Ga0070680_100029908 3300005336 Bacteria 4373
16 Ga0070680_100162410 3300005336 Bacteria 1877
17 Ga0070661_100193182 3300005344 Bacteria 1553
18 Ga0070668_100001382 3300005347 Bacteria 17415
19 Ga0070668_100001424 3300005347 Bacteria 17257
20 Ga0070668_100002079 3300005347 Bacteria 14642
21 Ga0070668_100032574 3300005347 Bacteria 3966
22 Ga0070668_100074078 3300005347 Bacteria 2655
23 Ga0070669_100008765 3300005353 Bacteria 7216
24 Ga0070669_100098633 3300005353 Bacteria 2201
25 Ga0070669_100263652 3300005353 Bacteria 1375
26 Ga0070671_100003609 3300005355 Bacteria 12108
27 Ga0070673_100112654 3300005364 Bacteria 2258
28 Ga0070659_100033688 3300005366 Bacteria 3981
29 Ga0070659_100608358 3300005366 Bacteria 940
30 Ga0070667_100000293 3300005367 Bacteria 56352
31 Ga0070667_100106002 3300005367 Bacteria 2433
32 Ga0070667_100220742 3300005367 Bacteria 1687
33 Ga0070713_100464488 3300005436 Bacteria 1190
34 Ga0070662_100201166 3300005457 Bacteria 1581
35 Ga0070681_10009817 3300005458 Bacteria 9427
36 Ga0070681_10077621 3300005458 Bacteria 3278
37 Ga0070679_100021958 3300005530 Bacteria 6234
38 Ga0070679_100137583 3300005530 Bacteria 2423
39 Ga0068853_100110854 3300005539 Bacteria 2437
40 Ga0068853_100137556 3300005539 Bacteria 2191
41 Ga0070665_100000187 3300005548 Bacteria 110095
42 Ga0070665_100001912 3300005548 Bacteria 23543
43 Ga0070665_100027620 3300005548 Bacteria 5715
44 Ga0070665_100435734 3300005548 Bacteria 1320
45 Ga0068855_100042621 3300005563 Bacteria 5377
46 Ga0068855_100228338 3300005563 Bacteria 2085
47 Ga0068855_100740801 3300005563 Bacteria 1049
48 Ga0070664_100009891 3300005564 Bacteria 7730
49 Ga0068856_100692086 3300005614 Bacteria 1040
50 Ga0068852_100030488 3300005616 Bacteria 4440
51 Ga0068859_100000811 3300005617 Bacteria 31785
52 Ga0068859_100003794 3300005617 Bacteria 15415
53 Ga0068864_100002694 3300005618 Bacteria 14634
54 Ga0068864_100045951 3300005618 Bacteria 3746
55 Ga0068864_100105737 3300005618 Bacteria 2502
56 Ga0068864_100151854 3300005618 Bacteria 2098
57 Ga0068864_100159402 3300005618 Bacteria 2050
58 Ga0068861_100031419 3300005719 Bacteria 3901
59 Ga0068863_100000663 3300005841 Bacteria 34691
60 Ga0068863_100001917 3300005841 Bacteria 20674
61 Ga0068863_100003609 3300005841 Bacteria 15280
62 Ga0068863_100076975 3300005841 Bacteria 3156
63 Ga0068858_100001006 3300005842 Bacteria 29047
64 Ga0068858_100008697 3300005842 Bacteria 9747
65 Ga0068858_100035263 3300005842 Bacteria 4641
66 Ga0068858_100183372 3300005842 Bacteria 1977
67 Ga0068860_100000047 3300005843 Bacteria 213287
68 Ga0068860_100001005 3300005843 Bacteria 31230
69 Ga0068860_100015258 3300005843 Bacteria 7502
70 Ga0068860_100018144 3300005843 Bacteria 6849
71 Ga0068862_100000396 3300005844 Bacteria 47054
72 Ga0068862_100031519 3300005844 Bacteria 4476
73 Ga0068862_100079277 3300005844 Bacteria 2846
74 Ga0068862_100080434 3300005844 Bacteria 2826
75 Ga0068862_100094355 3300005844 Bacteria 2610
76 Ga0070717_10041433 3300006028 Bacteria 3754
77 Ga0075368_10017223 3300006042 Bacteria 2702
78 Ga0075368_10099650 3300006042 Bacteria 1192
79 Ga0075363_100040292 3300006048 Bacteria 2462
80 Ga0075364_10014234 3300006051 Bacteria 4911
81 Ga0075362_10135164 3300006177 Bacteria 1175
82 Ga0075367_10002614 3300006178 Bacteria 8272
83 Ga0075366_10073552 3300006195 Bacteria 2037
84 Ga0097621_100376400 3300006237 Bacteria 1267
85 Ga0068871_100443259 3300006358 Bacteria 1163
86 Ga0068865_100000389 3300006881 Bacteria 24391
87 Ga0097620_100000811 3300006931 Bacteria 31785
88 Ga0097620_100003793 3300006931 Bacteria 15415
89 Ga0105250_10010049 3300009092 Bacteria 3959
90 Ga0105240_10024353 3300009093 Bacteria 7980
91 Ga0105240_10081921 3300009093 Bacteria 3964
92 Ga0105240_10305191 3300009093 Bacteria 1820
93 Ga0105240_10594325 3300009093 Bacteria 1219
94 Ga0105242_10355558 3300009176 Bacteria 1354
95 Ga0105248_10118644 3300009177 Bacteria 2984
96 Ga0105248_10123579 3300009177 Bacteria 2919
97 Ga0105248_10243702 3300009177 Bacteria 2023
98 Ga0105248_10545556 3300009177 Bacteria 1308
99 Ga0105248_10930175 3300009177 Bacteria 982
100 Ga0105237_10468399 3300009545 Bacteria 1266
101 Ga0105238_10071414 3300009551 Bacteria 3469
102 Ga0105238_10153327 3300009551 Bacteria 2279
103 Ga0105249_10001104 3300009553 Bacteria 23992
104 Ga0105249_10972357 3300009553 Bacteria 917
105 Ga0105239_10560221 3300010375 Bacteria 1302
106 Ga0105239_10605337 3300010375 Bacteria 1250
107 Ga0105239_10842150 3300010375 Bacteria 1052
108 Ga0157373_10056667 3300013100 Bacteria 2782
109 Ga0157373_10312540 3300013100 Bacteria 1117
110 Ga0157370_10240715 3300013104 Bacteria 1674
111 Ga0157370_10889894 3300013104 Bacteria 808
112 Ga0163162_10010062 3300013306 Bacteria 9196
113 Ga0163162_10102841 3300013306 Bacteria 2950
114 Ga0157372_10472259 3300013307 Bacteria 1462
115 Ga0157375_10147700 3300013308 Bacteria 2483
116 Ga0163163_10012776 3300014325 Bacteria 7662
117 Ga0163163_10117100 3300014325 Bacteria 2696
118 Ga0163163_10134760 3300014325 Bacteria 2510
119 Ga0163163_10233502 3300014325 Bacteria 1889
120 Ga0163163_10487952 3300014325 Bacteria 1293
121 Ga0157380_10192052 3300014326 Bacteria 1804
122 Ga0182008_10021629 3300014497 Bacteria 3303
123 Ga0157379_10028979 3300014968 Bacteria 4923
124 Ga0157379_10304206 3300014968 Bacteria 1454
125 Ga0182007_10053953 3300015262 Bacteria 1322
126 Ga0163161_10396926 3300017792 Bacteria 1105
127 Ga0213872_10064518 3300021361 Bacteria 1654
128 Ga0209758_1000852 3300025297 Bacteria 42442
129 Ga0209050_1000053 3300025298 Bacteria 349521
130 Ga0209257_1000289 3300025304 Bacteria 110882
131 Ga0209257_1010487 3300025304 Bacteria 4677
132 Ga0207680_10030302 3300025903 Bacteria 3050
133 Ga0207705_10016595 3300025909 Bacteria 5275
134 Ga0207654_10323552 3300025911 Bacteria 1055
135 Ga0207707_10049061 3300025912 Bacteria 3678
136 Ga0207695_10018076 3300025913 Bacteria 8160
137 Ga0207695_10053874 3300025913 Bacteria 4205
138 Ga0207695_10230168 3300025913 Bacteria 1758
139 Ga0207695_10248888 3300025913 Bacteria 1677
140 Ga0207660_10002946 3300025917 Bacteria 11127
141 Ga0207660_10206846 3300025917 Bacteria 1535
142 Ga0207657_10017541 3300025919 Bacteria 6859
143 Ga0207649_10101699 3300025920 Bacteria 1904
144 Ga0207649_10205746 3300025920 Bacteria 1393
145 Ga0207652_10007229 3300025921 Bacteria 8949
146 Ga0207652_10098829 3300025921 Bacteria 2574
147 Ga0207681_10063213 3300025923 Bacteria 2552
148 Ga0207694_10073302 3300025924 Bacteria 2678
149 Ga0207694_10080585 3300025924 Bacteria 2555
150 Ga0207694_10600664 3300025924 Bacteria 925
151 Ga0207650_10000033 3300025925 Bacteria 226809
152 Ga0207650_10075549 3300025925 Bacteria 2543
153 Ga0207687_10094433 3300025927 Bacteria 2189
154 Ga0207644_10009332 3300025931 Bacteria 6442
155 Ga0207644_10102286 3300025931 Bacteria 2154
156 Ga0207690_10039514 3300025932 Bacteria 3079
157 Ga0207706_10141602 3300025933 Bacteria 2116
158 Ga0207706_10220147 3300025933 Bacteria 1662
159 Ga0207704_10011550 3300025938 Bacteria 4351
160 Ga0207711_10000374 3300025941 Bacteria 47567
161 Ga0207711_10144017 3300025941 Bacteria 2146
162 Ga0207711_10582852 3300025941 Bacteria 1043
163 Ga0207689_10098331 3300025942 Bacteria 2404
164 Ga0207667_10048538 3300025949 Bacteria 4488
165 Ga0207667_10049989 3300025949 Bacteria 4412
166 Ga0207667_10146415 3300025949 Bacteria 2431
167 Ga0207667_10342295 3300025949 Bacteria 1526
168 Ga0207667_10551447 3300025949 Bacteria 1166
169 Ga0207651_10020183 3300025960 Bacteria 4016
170 Ga0207712_10001424 3300025961 Bacteria 16336
171 Ga0207712_10389492 3300025961 Bacteria 1168
172 Ga0207668_10000013 3300025972 Bacteria 167989
173 Ga0207668_10000197 3300025972 Bacteria 41484
174 Ga0207668_10002677 3300025972 Bacteria 10425
175 Ga0207668_10031993 3300025972 Bacteria 3471
176 Ga0207668_10051524 3300025972 Bacteria 2843
177 Ga0207640_10585275 3300025981 Bacteria 943
178 Ga0207658_10000318 3300025986 Bacteria 48562
179 Ga0207658_10005669 3300025986 Bacteria 8541
180 Ga0207658_10079082 3300025986 Bacteria 2514
181 Ga0207677_11039100 3300026023 Bacteria 744
182 Ga0207703_10000065 3300026035 Bacteria 126087
183 Ga0207703_10020593 3300026035 Bacteria 5160
184 Ga0207703_10545885 3300026035 Bacteria 1092
185 Ga0207639_10129562 3300026041 Bacteria 2086
186 Ga0207639_10186838 3300026041 Bacteria 1767
187 Ga0207639_10233089 3300026041 Bacteria 1597
188 Ga0207678_10204500 3300026067 Bacteria 1689
189 Ga0207702_10293240 3300026078 Bacteria 1542
190 Ga0207702_10661802 3300026078 Bacteria 1027
191 Ga0207641_10000011 3300026088 Bacteria 384362
192 Ga0207641_10000532 3300026088 Bacteria 42714
193 Ga0207641_10002973 3300026088 Bacteria 15339
194 Ga0207641_10079114 3300026088 Bacteria 2849
195 Ga0207641_10465533 3300026088 Bacteria 1223
196 Ga0207676_10000135 3300026095 Bacteria 64914
197 Ga0207676_10000450 3300026095 Bacteria 34793
198 Ga0207676_10030351 3300026095 Bacteria 4057
199 Ga0207676_10136218 3300026095 Bacteria 2095
200 Ga0207674_10065893 3300026116 Bacteria 3650
201 Ga0207675_100048271 3300026118 Bacteria 3974
202 Ga0207675_100223813 3300026118 Bacteria 1813
203 Ga0209967_1016970 3300027364 Bacteria 1048
204 Ga0209981_1001912 3300027378 Bacteria 2656
205 Ga0209999_1008443 3300027543 Bacteria 1857
206 Ga0209983_1002968 3300027665 Bacteria 3661
207 Ga0209813_10006533 3300027866 Bacteria 2885
208 Ga0268266_10000003 3300028379 Bacteria 1701703
209 Ga0268266_10317975 3300028379 Bacteria 1456
210 Ga0268266_10499204 3300028379 Bacteria 1162
211 Ga0268265_10003943 3300028380 Bacteria 10454
212 Ga0268265_10005283 3300028380 Bacteria 8843
213 Ga0268265_10045851 3300028380 Bacteria 3265
214 Ga0268265_11174095 3300028380 Bacteria 764
215 Ga0268264_10000014 3300028381 Bacteria 509962
216 Ga0268264_10000205 3300028381 Bacteria 120743
217 Ga0268264_10005830 3300028381 Bacteria 10434
218 Ga0265334_10112022 3300028573 Bacteria 980
219 Ga0307517_10003957 3300028786 Bacteria 22943
220 Ga0307517_10100909 3300028786 Bacteria 2276
221 Ga0307511_10047913 3300030521 Bacteria 3487
222 Ga0307513_10000100 3300031456 Bacteria 125183
223 Ga0307513_10003278 3300031456 Bacteria 22053
224 Ga0307513_10005039 3300031456 Bacteria 17496
225 Ga0307513_10005827 3300031456 Bacteria 16184
226 Ga0307408_100407758 3300031548 Bacteria 1169
227 Ga0307516_10000338 3300031730 Bacteria 61339
228 Ga0307405_10311928 3300031731 Bacteria 1198
229 Ga0307412_10262710 3300031911 Bacteria 1347
230 Ga0307510_10040324 3300033180 Bacteria 5127
231 Ga0373944_0048046 3300035089 Bacteria 1338
232 Ga0373923_0103892 3300035111 Bacteria 1256
233 Ga0373936_0027085 3300035113 Bacteria 2248
234 Ga0373943_0017235 3300035170 Bacteria 3304
235 Ga0373927_0001686 3300035695 Bacteria 16509
236 Ga0373947_0145449 3300035725 Bacteria 1524
237 Ga0373947_0167507 3300035725 Bacteria 1424
238 Ga0373937_0086579 3300036401 Bacteria 2899
239 Ga0373937_0545017 3300036401 Bacteria 1102
240 Ga0373925_0000199 3300037068 Bacteria 65400
241 Ga0395899_0000560 3300037312 Bacteria 39802
242 Ga0395899_0078095 3300037312 Bacteria 2413
243 Ga0395900_0000002 3300037418 Bacteria 671103
244 Ga0395898_0012555 3300037466 Bacteria 8760
245 Ga0395898_0048766 3300037466 Bacteria 4151
246 Ga0395898_0323593 3300037466 Bacteria 1471
247 Ga0395905_0037939 3300037471 Bacteria 4521
248 Ga0395905_0056115 3300037471 Bacteria 3686
249 Ga0395905_0879449 3300037471 Bacteria 799
250 Ga0395901_0000021 3300038443 Bacteria 307734
251 Ga0395901_0042696 3300038443 Bacteria 4702
252 Ga0395901_0260875 3300038443 Bacteria 1803
253 Ga0436365_0108317 3300039437 Bacteria 5195
254 Ga0436365_0608300 3300039437 Bacteria 1410
255 Ga0436360_0785619 3300039438 Bacteria 1360
256 Ga0436361_0767272 3300039447 Bacteria 33690
257 Ga0451853_3003002 3300041512 Bacteria 1027
258 Ga0439442_036253 3300042002 Bacteria 1032
259 Ga0439462_0070835 3300042015 Bacteria 947
260 Ga0453684_1496660 3300044712 Bacteria 696
261 Ga0466970_0079439 3300044765 Bacteria 1771
262 Ga0466960_0385972 3300044901 Bacteria 804
263 Ga0495629_0014004 3300046459 Bacteria 5780
264 Ga0495585_0088629 3300046492 Bacteria 1669
265 Ga0495583_0143718 3300046506 Bacteria 992
266 Ga0495610_0137831 3300046512 Bacteria 1053
267 Ga0495620_0029298 3300046515 Bacteria 2549
268 Ga0495628_0036533 3300046516 Bacteria 3941
269 Ga0495643_0014449 3300046522 Bacteria 4698
270 Ga0495642_0119430 3300046528 Bacteria 1130
271 Ga0495609_0021443 3300046538 Bacteria 2980
272 Ga0495645_0068249 3300046543 Bacteria 2567
273 Ga0495622_0002218 3300046557 Bacteria 9469
274 Ga0495668_0064073 3300046616 Bacteria 2024
275 Ga0495668_0118910 3300046616 Bacteria 1445
276 Ga0495668_0155730 3300046616 Bacteria 1251
277 Ga0495668_0288151 3300046616 Bacteria 900
278 Ga0495625_0127770 3300046660 Bacteria 1724
279 Ga0495588_0223276 3300046674 Bacteria 994
280 Ga0495669_0000007 3300046684 Bacteria 180797
281 Ga0495669_0002577 3300046684 Bacteria 7408
282 Ga0495674_0271694 3300047319 Bacteria 1391
283 Ga0495672_0034389 3300047320 Bacteria 3132
284 Ga0495677_0036697 3300047445 Bacteria 1790
285 Ga0495686_0044959 3300047472 Bacteria 2795
286 Ga0495602_0064555 3300048088 Bacteria 3165
287 Ga0495615_0059368 3300048090 Bacteria 1005
288 Ga0496101_0244917 3300048904 Bacteria 1396
289 Ga0496102_1089951 3300048905 Bacteria 718
290 Ga0496103_0109817 3300048906 Bacteria 1751
291 Ga0496107_0174189 3300048910 Bacteria 1597
292 Ga0496108_0106651 3300048911 Bacteria 2392
293 Ga0496112_0020562 3300048915 Bacteria 6258
294 Ga0496112_0076705 3300048915 Bacteria 3305
295 Ga0496113_0073049 3300048916 Bacteria 2612
296 Ga0496115_0006365 3300048918 Bacteria 8648
297 Ga0496115_0019718 3300048918 Bacteria 5192
298 Ga0496115_0139627 3300048918 Bacteria 1999
299 Ga0496115_0632816 3300048918 Bacteria 847
300 Ga0496116_0171454 3300048919 Bacteria 1175
301 Ga0496117_0023221 3300048920 Bacteria 4952
302 Ga0496118_0019812 3300048921 Bacteria 5999
303 Ga0496119_0004198 3300048922 Bacteria 14479
304 Ga0496120_0138547 3300048923 Bacteria 1238
305 Ga0496121_0000035 3300048924 Bacteria 374316
306 Ga0496125_0012238 3300048928 Bacteria 8533
307 Ga0495682_0036524 3300049460 Bacteria 1809
308 Ga0501032_0598304 3300049569 Bacteria 702
309 Ga0501033_0000913 3300049570 Bacteria 26962
310 Ga0501033_0049531 3300049570 Bacteria 3118
311 Ga0501034_0071398 3300049571 Bacteria 3481
312 Ga0501034_0319092 3300049571 Bacteria 1487
313 Ga0501034_0865717 3300049571 Bacteria 793
314 Ga0501037_0021815 3300049573 Bacteria 4739
315 Ga0501037_0057556 3300049573 Bacteria 2838
316 Ga0501038_0499799 3300049574 Bacteria 930
317 Ga0501047_0026978 3300049581 Bacteria 5532
318 Ga0501047_0027394 3300049581 Bacteria 5490
319 Ga0501047_0299866 3300049581 Bacteria 1450
320 Ga0501047_0843800 3300049581 Bacteria 730
321 Ga0501048_0086234 3300049582 Bacteria 2215
322 Ga0501035_0111988 3300049822 Bacteria 2391
323 Ga0501035_0714347 3300049822 Bacteria 807
324 Ga0501044_0004988 3300049823 Bacteria 14831
325 Ga0501044_0519324 3300049823 Bacteria 1091
326 nmdc:mga03n38_50158_c1 3300050490 Bacteria 1859
327 nmdc:mga0k408_380059_c1 3300050493 Bacteria 841
328 nmdc:mga07m45_21370_c1 3300050496 Bacteria 3524
329 nmdc:mga07m45_264556_c1 3300050496 Bacteria 1000
330 nmdc:mga07m45_79070_c1 3300050496 Bacteria 1877
331 nmdc:mga0sz30_131939_c1 3300050516 Bacteria 1101
332 Ga0500610_0152236 3300053079 Bacteria 1158
333 Ga0500635_0043898 3300053080 Bacteria 1505
334 Ga0500643_032654 3300053087 Bacteria 1579
335 Ga0500643_037581 3300053087 Bacteria 1441
336 Ga0500647_0020943 3300053091 Bacteria 3048
337 Ga0500647_0051955 3300053091 Bacteria 1972
338 Ga0500583_0283349 3300053092 Bacteria 813
339 Ga0500566_0039715 3300053094 Bacteria 2720
340 Ga0500566_0158706 3300053094 Bacteria 1181
341 Ga0500641_0239749 3300053096 Bacteria 763
342 Ga0500572_003690 3300053111 Bacteria 3477
343 Ga0500595_011065 3300053119 Bacteria 3551
344 Ga0500595_016592 3300053119 Bacteria 2739
345 Ga0500595_069430 3300053119 Bacteria 1048
346 Ga0500607_136652 3300053121 Bacteria 1160
347 Ga0500608_000264 3300053122 Bacteria 20418
348 Ga0500614_005874 3300053123 Bacteria 2576
349 Ga0500614_035027 3300053123 Bacteria 1249
350 Ga0500655_030858 3300053133 Bacteria 1032
351 Ga0500559_0024479 3300053136 Bacteria 2569
352 Ga0500590_071612 3300053148 Bacteria 1721
353 Ga0500603_117287 3300053150 Bacteria 804
354 Ga0500619_012714 3300053154 Bacteria 2210
355 Ga0500624_004577 3300053157 Bacteria 1825
356 Ga0500636_0155251 3300053177 Bacteria 1253
357 Ga0500637_0024170 3300053178 Bacteria 3328
358 Ga0500576_102583 3300053725 Bacteria 1164
359 Ga0500625_055600 3300053729 Bacteria 1814
360 Ga0500645_002789 3300053730 Bacteria 7538
361 Ga0500596_003603 3300053735 Bacteria 2917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042015 Ga0439462_0070835 Ga0439462_0070835_187_765 188
2 3300005334 Ga0068869_100558238 Ga0068869_1005582381 192
3 3300005334 Ga0068869_100078046 Ga0068869_1000780462 193
4 3300025942 Ga0207689_10098331 Ga0207689_100983312 193
5 3300031911 Ga0307412_10262710 Ga0307412_102627101 193
6 3300039438 Ga0436360_0785619 Ga0436360_0785619_531_1154 197
7 3300028573 Ga0265334_10112022 Ga0265334_101120222 198
8 3300005844 Ga0068862_100094355 Ga0068862_1000943552 202
9 3300028380 Ga0268265_11174095 Ga0268265_111740951 202
10 3300036401 Ga0373937_0545017 Ga0373937_0545017_178_786 202
11 3300014497 Ga0182008_10021629 Ga0182008_100216292 203
12 3300031548 Ga0307408_100407758 Ga0307408_1004077582 203
13 3300036401 Ga0373937_0086579 Ga0373937_0086579_2016_2684 203
14 3300009177 Ga0105248_10123579 Ga0105248_101235792 204
15 3300014325 Ga0163163_10012776 Ga0163163_1001277611 204
16 3300014968 Ga0157379_10028979 Ga0157379_100289792 204
17 3300039437 Ga0436365_0608300 Ga0436365_0608300_600_1247 206
18 3300005331 Ga0070670_100137976 Ga0070670_1001379762 207
19 3300005353 Ga0070669_100008765 Ga0070669_1000087654 207
20 3300005355 Ga0070671_100003609 Ga0070671_10000360910 207
21 3300005366 Ga0070659_100608358 Ga0070659_1006083581 207
22 3300005367 Ga0070667_100220742 Ga0070667_1002207422 207
23 3300005563 Ga0068855_100740801 Ga0068855_1007408012 207
24 3300005617 Ga0068859_100000811 Ga0068859_1000008112 207
25 3300005841 Ga0068863_100000663 Ga0068863_1000006632 207
26 3300005842 Ga0068858_100008697 Ga0068858_1000086978 207
27 3300005843 Ga0068860_100018144 Ga0068860_1000181442 207
28 3300005844 Ga0068862_100080434 Ga0068862_1000804342 207
29 3300006931 Ga0097620_100000811 Ga0097620_1000008112 207
30 3300009545 Ga0105237_10468399 Ga0105237_104683992 207
31 3300010375 Ga0105239_10605337 Ga0105239_106053372 207
32 3300013306 Ga0163162_10010062 Ga0163162_100100621 207
33 3300025913 Ga0207695_10248888 Ga0207695_102488881 207
34 3300025931 Ga0207644_10009332 Ga0207644_100093322 207
35 3300025933 Ga0207706_10220147 Ga0207706_102201472 207
36 3300025949 Ga0207667_10048538 Ga0207667_100485383 207
37 3300025949 Ga0207667_10342295 Ga0207667_103422952 207
38 3300025972 Ga0207668_10002677 Ga0207668_100026772 207
39 3300025986 Ga0207658_10079082 Ga0207658_100790822 207
40 3300026088 Ga0207641_10002973 Ga0207641_1000297310 207
41 3300026118 Ga0207675_100223813 Ga0207675_1002238132 207
42 3300028381 Ga0268264_10005830 Ga0268264_100058309 207
43 3300035111 Ga0373923_0103892 Ga0373923_0103892_260_907 207
44 3300035725 Ga0373947_0167507 Ga0373947_0167507_589_1215 207
45 3300039437 Ga0436365_0108317 Ga0436365_0108317_498_1124 207
46 3300049823 Ga0501044_0519324 Ga0501044_0519324_325_960 207
47 3300005331 Ga0070670_100000007 Ga0070670_10000000763 208
48 3300005335 Ga0070666_10034211 Ga0070666_100342112 208
49 3300005347 Ga0070668_100001382 Ga0070668_1000013822 208
50 3300005353 Ga0070669_100263652 Ga0070669_1002636522 208
51 3300005367 Ga0070667_100000293 Ga0070667_10000029351 208
52 3300005548 Ga0070665_100001912 Ga0070665_1000019122 208
53 3300005618 Ga0068864_100002694 Ga0068864_10000269415 208
54 3300005841 Ga0068863_100003609 Ga0068863_1000036095 208
55 3300005842 Ga0068858_100035263 Ga0068858_1000352632 208
56 3300005843 Ga0068860_100000047 Ga0068860_10000004764 208
57 3300005844 Ga0068862_100000396 Ga0068862_10000039656 208
58 3300009177 Ga0105248_10930175 Ga0105248_109301751 208
59 3300009553 Ga0105249_10001104 Ga0105249_100011042 208
60 3300014325 Ga0163163_10487952 Ga0163163_104879522 208
61 3300014326 Ga0157380_10192052 Ga0157380_101920522 208
62 3300025903 Ga0207680_10030302 Ga0207680_100303022 208
63 3300025925 Ga0207650_10000033 Ga0207650_1000003332 208
64 3300025941 Ga0207711_10582852 Ga0207711_105828522 208
65 3300025961 Ga0207712_10001424 Ga0207712_1000142418 208
66 3300025972 Ga0207668_10000197 Ga0207668_100001972 208
67 3300025986 Ga0207658_10000318 Ga0207658_1000031852 208
68 3300026035 Ga0207703_10020593 Ga0207703_100205934 208
69 3300026088 Ga0207641_10000532 Ga0207641_1000053244 208
70 3300026095 Ga0207676_10000135 Ga0207676_1000013563 208
71 3300028380 Ga0268265_10003943 Ga0268265_100039432 208
72 3300028381 Ga0268264_10000205 Ga0268264_1000020553 208
73 3300046616 Ga0495668_0064073 Ga0495668_0064073_67_738 208
74 3300048905 Ga0496102_1089951 Ga0496102_1089951_25_666 208
75 3300049570 Ga0501033_0000913 Ga0501033_0000913_12109_12738 208
76 3300049571 Ga0501034_0071398 Ga0501034_0071398_73_702 208
77 3300049573 Ga0501037_0021815 Ga0501037_0021815_3193_3822 208
78 3300049574 Ga0501038_0499799 Ga0501038_0499799_117_818 208
79 3300049581 Ga0501047_0299866 Ga0501047_0299866_656_1357 208
80 3300049823 Ga0501044_0004988 Ga0501044_0004988_2530_3159 208
81 3300053087 Ga0500643_037581 Ga0500643_037581_713_1354 208
82 3300005327 Ga0070658_10361343 Ga0070658_103613432 209
83 3300005366 Ga0070659_100033688 Ga0070659_1000336882 209
84 3300005436 Ga0070713_100464488 Ga0070713_1004644882 209
85 3300005548 Ga0070665_100000187 Ga0070665_1000001873 209
86 3300009093 Ga0105240_10594325 Ga0105240_105943252 209
87 3300009176 Ga0105242_10355558 Ga0105242_103555582 209
88 3300014325 Ga0163163_10117100 Ga0163163_101171002 209
89 3300025932 Ga0207690_10039514 Ga0207690_100395142 209
90 3300028379 Ga0268266_10000003 Ga0268266_100000031308 209
91 3300035113 Ga0373936_0027085 Ga0373936_0027085_1128_1760 209
92 3300041512 Ga0451853_3003002 Ga0451853_3003002_266_904 209
93 3300048918 Ga0496115_0019718 Ga0496115_0019718_673_1302 209
94 3300053087 Ga0500643_032654 Ga0500643_032654_918_1562 209
95 3300005347 Ga0070668_100001424 Ga0070668_1000014242 210
96 3300005367 Ga0070667_100106002 Ga0070667_1001060022 210
97 3300005458 Ga0070681_10077621 Ga0070681_100776212 210
98 3300005548 Ga0070665_100435734 Ga0070665_1004357342 210
99 3300005614 Ga0068856_100692086 Ga0068856_1006920862 210
100 3300005616 Ga0068852_100030488 Ga0068852_1000304882 210
101 3300005618 Ga0068864_100105737 Ga0068864_1001057372 210
102 3300005841 Ga0068863_100001917 Ga0068863_1000019177 210
103 3300005842 Ga0068858_100001006 Ga0068858_10000100618 210
104 3300005842 Ga0068858_100183372 Ga0068858_1001833721 210
105 3300009092 Ga0105250_10010049 Ga0105250_100100492 210
106 3300009093 Ga0105240_10024353 Ga0105240_100243536 210
107 3300009177 Ga0105248_10118644 Ga0105248_101186442 210
108 3300010375 Ga0105239_10560221 Ga0105239_105602212 210
109 3300014325 Ga0163163_10134760 Ga0163163_101347602 210
110 3300014968 Ga0157379_10304206 Ga0157379_103042062 210
111 3300021361 Ga0213872_10064518 Ga0213872_100645182 210
112 3300025912 Ga0207707_10049061 Ga0207707_100490612 210
113 3300025913 Ga0207695_10053874 Ga0207695_100538743 210
114 3300025917 Ga0207660_10206846 Ga0207660_102068462 210
115 3300025941 Ga0207711_10144017 Ga0207711_101440172 210
116 3300025972 Ga0207668_10000013 Ga0207668_1000001327 210
117 3300026035 Ga0207703_10000065 Ga0207703_10000065104 210
118 3300026078 Ga0207702_10293240 Ga0207702_102932401 210
119 3300026088 Ga0207641_10000011 Ga0207641_10000011394 210
120 3300026095 Ga0207676_10000450 Ga0207676_1000045019 210
121 3300026095 Ga0207676_10136218 Ga0207676_101362182 210
122 3300027364 Ga0209967_1016970 Ga0209967_10169701 210
123 3300027378 Ga0209981_1001912 Ga0209981_10019122 210
124 3300027543 Ga0209999_1008443 Ga0209999_10084432 210
125 3300027665 Ga0209983_1002968 Ga0209983_10029682 210
126 3300028379 Ga0268266_10317975 Ga0268266_103179752 210
127 3300028786 Ga0307517_10100909 Ga0307517_101009092 210
128 3300031456 Ga0307513_10005039 Ga0307513_1000503915 210
129 3300037466 Ga0395898_0323593 Ga0395898_0323593_768_1403 210
130 3300037471 Ga0395905_0056115 Ga0395905_0056115_846_1484 210
131 3300038443 Ga0395901_0042696 Ga0395901_0042696_197_877 210
132 3300039447 Ga0436361_0767272 Ga0436361_0767272_27560_28201 210
133 3300044765 Ga0466970_0079439 Ga0466970_0079439_624_1262 210
134 3300046492 Ga0495585_0088629 Ga0495585_0088629_544_1197 210
135 3300048088 Ga0495602_0064555 Ga0495602_0064555_1140_1817 210
136 3300048904 Ga0496101_0244917 Ga0496101_0244917_412_1092 210
137 3300048906 Ga0496103_0109817 Ga0496103_0109817_176_829 210
138 3300048919 Ga0496116_0171454 Ga0496116_0171454_250_903 210
139 3300048920 Ga0496117_0023221 Ga0496117_0023221_1115_1768 210
140 3300048921 Ga0496118_0019812 Ga0496118_0019812_795_1448 210
141 3300048922 Ga0496119_0004198 Ga0496119_0004198_3174_3827 210
142 3300048924 Ga0496121_0000035 Ga0496121_0000035_358688_359341 210
143 3300049581 Ga0501047_0026978 Ga0501047_0026978_3698_4336 210
144 3300049581 Ga0501047_0843800 Ga0501047_0843800_33_674 210
145 3300053091 Ga0500647_0020943 Ga0500647_0020943_67_714 210
146 3300053096 Ga0500641_0239749 Ga0500641_0239749_81_725 210
147 3300053111 Ga0500572_003690 Ga0500572_003690_440_1087 210
148 3300053123 Ga0500614_035027 Ga0500614_035027_142_789 210
149 3300053148 Ga0500590_071612 Ga0500590_071612_556_1203 210
150 3300005344 Ga0070661_100193182 Ga0070661_1001931822 211
151 3300005539 Ga0068853_100137556 Ga0068853_1001375562 211
152 3300005564 Ga0070664_100009891 Ga0070664_1000098919 211
153 3300006048 Ga0075363_100040292 Ga0075363_1000402922 211
154 3300006195 Ga0075366_10073552 Ga0075366_100735522 211
155 3300013100 Ga0157373_10056667 Ga0157373_100566673 211
156 3300025920 Ga0207649_10101699 Ga0207649_101016992 211
157 3300026041 Ga0207639_10233089 Ga0207639_102330892 211
158 3300031456 Ga0307513_10000100 Ga0307513_1000010060 211
159 3300048923 Ga0496120_0138547 Ga0496120_0138547_274_909 211
160 3300050490 nmdc:mga03n38_50158_c1 nmdc:mga03n38_50158_c1_566_1222 211
161 3300050496 nmdc:mga07m45_21370_c1 nmdc:mga07m45_21370_c1_1277_1933 211
162 3300046674 Ga0495588_0223276 Ga0495588_0223276_74_736 212
163 3300046684 Ga0495669_0000007 Ga0495669_0000007_95421_96059 212
164 3300046684 Ga0495669_0002577 Ga0495669_0002577_2477_3139 212
165 3300049571 Ga0501034_0319092 Ga0501034_0319092_263_922 212
166 3300049571 Ga0501034_0865717 Ga0501034_0865717_51_701 212
167 3300049822 Ga0501035_0714347 Ga0501035_0714347_145_795 212
168 3300005331 Ga0070670_100491540 Ga0070670_1004915401 213
169 3300005335 Ga0070666_10407050 Ga0070666_104070501 213
170 3300005336 Ga0070680_100162410 Ga0070680_1001624102 213
171 3300005347 Ga0070668_100002079 Ga0070668_1000020792 213
172 3300005347 Ga0070668_100074078 Ga0070668_1000740782 213
173 3300005364 Ga0070673_100112654 Ga0070673_1001126541 213
174 3300005457 Ga0070662_100201166 Ga0070662_1002011662 213
175 3300005548 Ga0070665_100027620 Ga0070665_1000276202 213
176 3300005618 Ga0068864_100151854 Ga0068864_1001518542 213
177 3300005618 Ga0068864_100159402 Ga0068864_1001594022 213
178 3300005843 Ga0068860_100001005 Ga0068860_10000100528 213
179 3300005844 Ga0068862_100031519 Ga0068862_1000315192 213
180 3300006028 Ga0070717_10041433 Ga0070717_100414332 213
181 3300006237 Ga0097621_100376400 Ga0097621_1003764002 213
182 3300006358 Ga0068871_100443259 Ga0068871_1004432592 213
183 3300006881 Ga0068865_100000389 Ga0068865_10000038925 213
184 3300009093 Ga0105240_10081921 Ga0105240_100819213 213
185 3300009177 Ga0105248_10243702 Ga0105248_102437022 213
186 3300009177 Ga0105248_10545556 Ga0105248_105455561 213
187 3300010375 Ga0105239_10842150 Ga0105239_108421501 213
188 3300013100 Ga0157373_10312540 Ga0157373_103125402 213
189 3300013104 Ga0157370_10889894 Ga0157370_108898941 213
190 3300013306 Ga0163162_10102841 Ga0163162_101028412 213
191 3300013308 Ga0157375_10147700 Ga0157375_101477002 213
192 3300014325 Ga0163163_10233502 Ga0163163_102335022 213
193 3300017792 Ga0163161_10396926 Ga0163161_103969261 213
194 3300025913 Ga0207695_10230168 Ga0207695_102301682 213
195 3300025925 Ga0207650_10075549 Ga0207650_100755492 213
196 3300025927 Ga0207687_10094433 Ga0207687_100944332 213
197 3300025931 Ga0207644_10102286 Ga0207644_101022862 213
198 3300025933 Ga0207706_10141602 Ga0207706_101416022 213
199 3300025938 Ga0207704_10011550 Ga0207704_100115505 213
200 3300025941 Ga0207711_10000374 Ga0207711_100003742 213
201 3300025960 Ga0207651_10020183 Ga0207651_100201834 213
202 3300025961 Ga0207712_10389492 Ga0207712_103894921 213
203 3300025972 Ga0207668_10051524 Ga0207668_100515242 213
204 3300026023 Ga0207677_11039100 Ga0207677_110391001 213
205 3300026035 Ga0207703_10545885 Ga0207703_105458851 213
206 3300026067 Ga0207678_10204500 Ga0207678_102045002 213
207 3300026088 Ga0207641_10465533 Ga0207641_104655331 213
208 3300026095 Ga0207676_10030351 Ga0207676_100303512 213
209 3300028380 Ga0268265_10005283 Ga0268265_100052837 213
210 3300028381 Ga0268264_10000014 Ga0268264_10000014304 213
211 3300028786 Ga0307517_10003957 Ga0307517_1000395712 213
212 3300031456 Ga0307513_10005827 Ga0307513_1000582712 213
213 3300046506 Ga0495583_0143718 Ga0495583_0143718_171_818 213
214 3300046516 Ga0495628_0036533 Ga0495628_0036533_3141_3788 213
215 3300046528 Ga0495642_0119430 Ga0495642_0119430_452_1099 213
216 3300046543 Ga0495645_0068249 Ga0495645_0068249_1565_2212 213
217 3300046616 Ga0495668_0155730 Ga0495668_0155730_254_901 213
218 3300046660 Ga0495625_0127770 Ga0495625_0127770_895_1542 213
219 3300047319 Ga0495674_0271694 Ga0495674_0271694_618_1265 213
220 3300047320 Ga0495672_0034389 Ga0495672_0034389_1475_2122 213
221 3300047445 Ga0495677_0036697 Ga0495677_0036697_29_676 213
222 3300048910 Ga0496107_0174189 Ga0496107_0174189_72_719 213
223 3300048911 Ga0496108_0106651 Ga0496108_0106651_1470_2117 213
224 3300048915 Ga0496112_0020562 Ga0496112_0020562_5184_5828 213
225 3300048915 Ga0496112_0076705 Ga0496112_0076705_253_900 213
226 3300048916 Ga0496113_0073049 Ga0496113_0073049_815_1462 213
227 3300048918 Ga0496115_0006365 Ga0496115_0006365_6458_7105 213
228 3300048918 Ga0496115_0139627 Ga0496115_0139627_667_1314 213
229 3300053079 Ga0500610_0152236 Ga0500610_0152236_51_698 213
230 3300053119 Ga0500595_069430 Ga0500595_069430_151_795 213
231 3300005331 Ga0070670_100095773 Ga0070670_1000957732 214
232 3300005336 Ga0070680_100029908 Ga0070680_1000299082 214
233 3300005347 Ga0070668_100032574 Ga0070668_1000325742 214
234 3300005353 Ga0070669_100098633 Ga0070669_1000986332 214
235 3300005458 Ga0070681_10009817 Ga0070681_100098176 214
236 3300005530 Ga0070679_100137583 Ga0070679_1001375832 214
237 3300005539 Ga0068853_100110854 Ga0068853_1001108542 214
238 3300005563 Ga0068855_100042621 Ga0068855_1000426212 214
239 3300005617 Ga0068859_100003794 Ga0068859_1000037949 214
240 3300005618 Ga0068864_100045951 Ga0068864_1000459513 214
241 3300005719 Ga0068861_100031419 Ga0068861_1000314192 214
242 3300005841 Ga0068863_100076975 Ga0068863_1000769752 214
243 3300005843 Ga0068860_100015258 Ga0068860_1000152581 214
244 3300005844 Ga0068862_100079277 Ga0068862_1000792772 214
245 3300006042 Ga0075368_10017223 Ga0075368_100172232 214
246 3300006051 Ga0075364_10014234 Ga0075364_100142345 214
247 3300006178 Ga0075367_10002614 Ga0075367_100026142 214
248 3300006931 Ga0097620_100003793 Ga0097620_1000037939 214
249 3300009553 Ga0105249_10972357 Ga0105249_109723571 214
250 3300025909 Ga0207705_10016595 Ga0207705_100165952 214
251 3300025911 Ga0207654_10323552 Ga0207654_103235522 214
252 3300025917 Ga0207660_10002946 Ga0207660_100029469 214
253 3300025919 Ga0207657_10017541 Ga0207657_100175411 214
254 3300025921 Ga0207652_10007229 Ga0207652_100072295 214
255 3300025923 Ga0207681_10063213 Ga0207681_100632132 214
256 3300025924 Ga0207694_10073302 Ga0207694_100733022 214
257 3300025949 Ga0207667_10049989 Ga0207667_100499892 214
258 3300025949 Ga0207667_10551447 Ga0207667_105514472 214
259 3300025972 Ga0207668_10031993 Ga0207668_100319932 214
260 3300025986 Ga0207658_10005669 Ga0207658_100056692 214
261 3300026041 Ga0207639_10129562 Ga0207639_101295622 214
262 3300026041 Ga0207639_10186838 Ga0207639_101868382 214
263 3300026078 Ga0207702_10661802 Ga0207702_106618022 214
264 3300026088 Ga0207641_10079114 Ga0207641_100791142 214
265 3300026116 Ga0207674_10065893 Ga0207674_100658932 214
266 3300026118 Ga0207675_100048271 Ga0207675_1000482712 214
267 3300027866 Ga0209813_10006533 Ga0209813_100065332 214
268 3300028379 Ga0268266_10499204 Ga0268266_104992042 214
269 3300028380 Ga0268265_10045851 Ga0268265_100458512 214
270 3300031456 Ga0307513_10003278 Ga0307513_1000327812 214
271 3300031730 Ga0307516_10000338 Ga0307516_1000033828 214
272 3300033180 Ga0307510_10040324 Ga0307510_100403242 214
273 3300035089 Ga0373944_0048046 Ga0373944_0048046_360_1046 214
274 3300035170 Ga0373943_0017235 Ga0373943_0017235_1075_1761 214
275 3300035695 Ga0373927_0001686 Ga0373927_0001686_2364_3050 214
276 3300035725 Ga0373947_0145449 Ga0373947_0145449_740_1426 214
277 3300037068 Ga0373925_0000199 Ga0373925_0000199_353_1039 214
278 3300048090 Ga0495615_0059368 Ga0495615_0059368_54_722 214
279 3300048918 Ga0496115_0632816 Ga0496115_0632816_119_772 214
280 3300048928 Ga0496125_0012238 Ga0496125_0012238_4832_5536 214
281 3300049582 Ga0501048_0086234 Ga0501048_0086234_341_1048 214
282 3300053094 Ga0500566_0158706 Ga0500566_0158706_479_1147 214
283 3300025304 Ga0209257_1010487 Ga0209257_10104872 215
284 3300046459 Ga0495629_0014004 Ga0495629_0014004_2418_3116 215
285 3300046512 Ga0495610_0137831 Ga0495610_0137831_241_915 215
286 3300046515 Ga0495620_0029298 Ga0495620_0029298_1609_2307 215
287 3300046522 Ga0495643_0014449 Ga0495643_0014449_3777_4451 215
288 3300046538 Ga0495609_0021443 Ga0495609_0021443_377_1051 215
289 3300046557 Ga0495622_0002218 Ga0495622_0002218_4111_4809 215
290 3300046616 Ga0495668_0118910 Ga0495668_0118910_188_862 215
291 3300049460 Ga0495682_0036524 Ga0495682_0036524_472_1146 215
292 3300053080 Ga0500635_0043898 Ga0500635_0043898_730_1404 215
293 3300053091 Ga0500647_0051955 Ga0500647_0051955_331_1005 215
294 3300053092 Ga0500583_0283349 Ga0500583_0283349_14_688 215
295 3300053094 Ga0500566_0039715 Ga0500566_0039715_522_1220 215
296 3300053119 Ga0500595_011065 Ga0500595_011065_2124_2822 215
297 3300053121 Ga0500607_136652 Ga0500607_136652_21_695 215
298 3300053122 Ga0500608_000264 Ga0500608_000264_733_1431 215
299 3300053123 Ga0500614_005874 Ga0500614_005874_1275_1973 215
300 3300053133 Ga0500655_030858 Ga0500655_030858_291_965 215
301 3300053136 Ga0500559_0024479 Ga0500559_0024479_534_1232 215
302 3300053150 Ga0500603_117287 Ga0500603_117287_29_703 215
303 3300053154 Ga0500619_012714 Ga0500619_012714_845_1543 215
304 3300053157 Ga0500624_004577 Ga0500624_004577_564_1238 215
305 3300053177 Ga0500636_0155251 Ga0500636_0155251_44_742 215
306 3300053178 Ga0500637_0024170 Ga0500637_0024170_722_1420 215
307 3300053725 Ga0500576_102583 Ga0500576_102583_325_1023 215
308 3300053729 Ga0500625_055600 Ga0500625_055600_55_753 215
309 3300053735 Ga0500596_003603 Ga0500596_003603_1129_1827 215
310 iso_pu_bacteria 2643221598 2643999696 216
311 iso_pu_bacteria 2643221614 2644087684 216
312 iso_pu_bacteria 2643221661 2644344273 216
313 iso_pu_bacteria 2643221666 2644367042 216
314 3300009551 Ga0105238_10153327 Ga0105238_101533272 217
315 3300025924 Ga0207694_10080585 Ga0207694_100805852 217
316 3300037312 Ga0395899_0000560 Ga0395899_0000560_18805_19467 217
317 3300037312 Ga0395899_0078095 Ga0395899_0078095_499_1179 217
318 3300037418 Ga0395900_0000002 Ga0395900_0000002_209310_209972 217
319 3300037466 Ga0395898_0012555 Ga0395898_0012555_6424_7086 217
320 3300037466 Ga0395898_0048766 Ga0395898_0048766_566_1246 217
321 3300037471 Ga0395905_0037939 Ga0395905_0037939_1111_1773 217
322 3300037471 Ga0395905_0879449 Ga0395905_0879449_78_731 217
323 3300038443 Ga0395901_0000021 Ga0395901_0000021_84922_85584 217
324 3300038443 Ga0395901_0260875 Ga0395901_0260875_492_1172 217
325 3300042002 Ga0439442_036253 Ga0439442_036253_18_677 217
326 3300044901 Ga0466960_0385972 Ga0466960_0385972_87_743 217
327 3300049569 Ga0501032_0598304 Ga0501032_0598304_15_677 217
328 3300049570 Ga0501033_0049531 Ga0501033_0049531_771_1433 217
329 3300049573 Ga0501037_0057556 Ga0501037_0057556_1638_2300 217
330 3300049581 Ga0501047_0027394 Ga0501047_0027394_1355_2017 217
331 3300049822 Ga0501035_0111988 Ga0501035_0111988_1310_1972 217
332 3300005530 Ga0070679_100021958 Ga0070679_1000219585 219
333 3300005563 Ga0068855_100228338 Ga0068855_1002283382 219
334 3300009093 Ga0105240_10305191 Ga0105240_103051911 219
335 3300013307 Ga0157372_10472259 Ga0157372_104722592 219
336 3300025913 Ga0207695_10018076 Ga0207695_100180769 219
337 3300025921 Ga0207652_10098829 Ga0207652_100988292 219
338 3300025949 Ga0207667_10146415 Ga0207667_101464152 219
339 3300025981 Ga0207640_10585275 Ga0207640_105852752 219
340 3300006042 Ga0075368_10099650 Ga0075368_100996501 220
341 3300006177 Ga0075362_10135164 Ga0075362_101351641 220
342 3300013104 Ga0157370_10240715 Ga0157370_102407152 220
343 3300015262 Ga0182007_10053953 Ga0182007_100539532 220
344 3300025920 Ga0207649_10205746 Ga0207649_102057461 220
345 3300030521 Ga0307511_10047913 Ga0307511_100479134 220
346 3300031731 Ga0307405_10311928 Ga0307405_103119282 220
347 3300046616 Ga0495668_0288151 Ga0495668_0288151_161_823 220
348 3300047472 Ga0495686_0044959 Ga0495686_0044959_1214_1879 220
349 3300050493 nmdc:mga0k408_380059_c1 nmdc:mga0k408_380059_c1_137_799 220
350 3300050496 nmdc:mga07m45_264556_c1 nmdc:mga07m45_264556_c1_20_682 220
351 3300050496 nmdc:mga07m45_79070_c1 nmdc:mga07m45_79070_c1_703_1365 220
352 3300050516 nmdc:mga0sz30_131939_c1 nmdc:mga0sz30_131939_c1_181_843 220
353 3300053119 Ga0500595_016592 Ga0500595_016592_27_689 220
354 3300053730 Ga0500645_002789 Ga0500645_002789_6364_7029 220
355 3300003215 JGI25153J46596_10022021 JGI25153J46596_100220212 221
356 3300003791 Ga0055530_10000586 Ga0055530_100005862 221
357 3300003794 Ga0055531_10000968 Ga0055531_1000096820 221
358 3300004625 Ga0055543_1007041 Ga0055543_10070412 221
359 3300005262 Ga0065165_1013914 Ga0065165_10139142 221
360 3300009551 Ga0105238_10071414 Ga0105238_100714142 221
361 3300025297 Ga0209758_1000852 Ga0209758_10008529 221
362 3300025298 Ga0209050_1000053 Ga0209050_1000053232 221
363 3300025304 Ga0209257_1000289 Ga0209257_100028943 221
364 3300025924 Ga0207694_10600664 Ga0207694_106006641 221
365 3300044712 Ga0453684_1496660 Ga0453684_1496660_12_677 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04296

YlxR

Protein of unknown function (DUF448)

13

89

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v7q-assembly3.cif.gz_C crystal structure of b. subtilis ylxq at 1.55 a resolution 0.9256 100 193
3on1-assembly1.cif.gz_A the structure of a protein with unknown function from bacillus halodurans c 0.9036 99 197
4lck-assembly1.cif.gz_A co-crystal structure of a t-box riboswitch stem i domain in complex with its cognate trna 0.8816 113 185
7qiz-assembly1.cif.gz_e specific features and methylation sites of a plant 80s ribosome 0.8794 101 184
3on1-assembly1.cif.gz_A the structure of a protein with unknown function from bacillus halodurans c 0.8785 99 197
ID Description Score Start End Superfamily
3v7qC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9256 100 193 3.30.1330.30
3on1A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8975 99 197 3.30.1330.30
af_P0A0G6_3_83_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8818 114 185 3.30.1330.30
af_A0A0G2JZT7_3_157_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8755 114 185 3.30.1330.30
3on1A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.8725 99 197 3.30.1330.30
ID Description Score Start End GO Terms
AF-A0A0Q7QFV6-F1-model_v4 DNA-binding protein 0.9644 17 199 GO:0003677
AF-A0A840A158-F1-model_v4 YlxR domain-containing protein 0.9628 28 217
AF-Q0AK70-F1-model_v4 YlxR domain-containing protein 0.9607 17 206
AF-A0A7G8ZM56-F1-model_v4 RNA-binding protein 0.9594 17 209
AF-A0A436G1U3-F1-model_v4 RNA-binding protein 0.9594 18 174

Feature Viewer

pLDDT pTM Quality
90.26 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map