F423520

General Info

Members Datasets Scaffolds Average Seq Length
364 222 728 247

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8025530807|8025535344
Length 247
Sequence DGYFSERVAATYDNPAAREFQPETVAPVAELLADLAGDGPALELGIGTGRVALPLAARGVPVHGIDLSRAMVARMREKPGGDAIGVTIGDFATTKAGGTEGKGAFSVAYLVFNTIMNLTTQEAQVACFRNVADQLAPGGCFVIETMVPDLRKLPPGQNLVPFHASDTRWSFDSYDVATQEMSSHHVEVVDGRGTYWSVPFRYVWPAELDLMAQLAGMRLRDRWADWGREPFTNESTGHVSVWQKPAH

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
205 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
206 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
207 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
208 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
213 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
214 2687453737 Frankia sp. BMG5.36 Isolate Nodule
215 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
216 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
217 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
218 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
219 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
220 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
221 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
222 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 0.27
Isolates 3.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0.82
Rhizoplane 1.65
Rhizosphere 93.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10029225 3300003323 Bacteria 2638
2 JGI25407J50210_10008292 3300003373 Bacteria 2618
3 Ga0068869_100045135 3300005334 Bacteria 3172
4 Ga0068869_100226208 3300005334 Bacteria 1485
5 Ga0070682_100152802 3300005337 Bacteria 1586
6 Ga0068868_100358729 3300005338 Bacteria 1250
7 Ga0070691_10032555 3300005341 Bacteria 2450
8 Ga0070668_100048496 3300005347 Bacteria 3266
9 Ga0070669_100154369 3300005353 Bacteria 1779
10 Ga0070709_10000361 3300005434 Bacteria 28094
11 Ga0070709_10010738 3300005434 Bacteria 5082
12 Ga0070709_10041596 3300005434 Bacteria 2832
13 Ga0070709_10076218 3300005434 Bacteria 2177
14 Ga0070709_10343650 3300005434 Bacteria 1101
15 Ga0070714_100000615 3300005435 Bacteria 25442
16 Ga0070714_100000898 3300005435 Bacteria 21103
17 Ga0070714_100094474 3300005435 Bacteria 2624
18 Ga0070714_100417619 3300005435 Bacteria 1270
19 Ga0070713_100000934 3300005436 Bacteria 18669
20 Ga0070713_100037381 3300005436 Bacteria 3925
21 Ga0070713_100208921 3300005436 Bacteria 1766
22 Ga0070710_10000602 3300005437 Bacteria 17146
23 Ga0070710_10010839 3300005437 Bacteria 4486
24 Ga0070710_10041764 3300005437 Bacteria 2533
25 Ga0070711_100000275 3300005439 Bacteria 26678
26 Ga0070711_100016743 3300005439 Bacteria 4659
27 Ga0070711_100044119 3300005439 Bacteria 3024
28 Ga0070705_100196174 3300005440 Bacteria 1380
29 Ga0070700_100120078 3300005441 Bacteria 1760
30 Ga0070708_100032870 3300005445 Bacteria 4502
31 Ga0070708_100190692 3300005445 Bacteria 1917
32 Ga0070708_100595169 3300005445 Bacteria 1043
33 Ga0070662_100010428 3300005457 Bacteria 6095
34 Ga0070706_100002563 3300005467 Bacteria 18277
35 Ga0070706_100003830 3300005467 Bacteria 14705
36 Ga0070706_100068219 3300005467 Bacteria 3289
37 Ga0070707_100004301 3300005468 Bacteria 13345
38 Ga0070707_100046456 3300005468 Bacteria 4156
39 Ga0070698_100000898 3300005471 Bacteria 32677
40 Ga0070698_100001316 3300005471 Bacteria 27654
41 Ga0070698_100006950 3300005471 Bacteria 12252
42 Ga0070699_100200550 3300005518 Bacteria 1774
43 Ga0070697_100088053 3300005536 Bacteria 2564
44 Ga0070697_100188977 3300005536 Bacteria 1748
45 Ga0068855_100049732 3300005563 Bacteria 4943
46 Ga0068856_100194890 3300005614 Bacteria 2040
47 Ga0068852_100008654 3300005616 Bacteria 7522
48 Ga0068861_100024690 3300005719 Bacteria 4349
49 Ga0068861_100407077 3300005719 Bacteria 1209
50 Ga0068863_100201454 3300005841 Bacteria 1915
51 Ga0081455_10000258 3300005937 Bacteria 69890
52 Ga0081455_10003888 3300005937 Bacteria 17011
53 Ga0081455_10005128 3300005937 Bacteria 14434
54 Ga0081455_10022327 3300005937 Bacteria 5917
55 Ga0081455_10476285 3300005937 Bacteria 845
56 Ga0081538_10003107 3300005981 Bacteria 15798
57 Ga0081538_10011318 3300005981 Bacteria 7235
58 Ga0081540_1000176 3300005983 Bacteria 67057
59 Ga0081539_10043696 3300005985 Bacteria 2594
60 Ga0070717_10003221 3300006028 Bacteria 11654
61 Ga0070717_10076434 3300006028 Bacteria 2803
62 Ga0075363_100310436 3300006048 Bacteria 916
63 Ga0070715_10001414 3300006163 Bacteria 6946
64 Ga0070716_100000167 3300006173 Bacteria 25955
65 Ga0070716_100061303 3300006173 Bacteria 2176
66 Ga0070712_100012931 3300006175 Bacteria 5318
67 Ga0070712_100020390 3300006175 Bacteria 4338
68 Ga0070712_100069662 3300006175 Bacteria 2510
69 Ga0070712_100102569 3300006175 Bacteria 2119
70 Ga0070712_100145150 3300006175 Bacteria 1815
71 Ga0075367_10000665 3300006178 Bacteria 13165
72 Ga0075428_100118791 3300006844 Bacteria 2879
73 Ga0075433_10044053 3300006852 Bacteria 3876
74 Ga0075434_100369870 3300006871 Bacteria 1454
75 Ga0068865_100016018 3300006881 Bacteria 4789
76 Ga0075436_100152911 3300006914 Bacteria 1624
77 Ga0075435_100048832 3300007076 Bacteria 3401
78 Ga0099794_10043060 3300007265 Bacteria 2154
79 Ga0105240_10490073 3300009093 Bacteria 1369
80 Ga0111539_10164542 3300009094 Bacteria 2594
81 Ga0105245_10005573 3300009098 Bacteria 11065
82 Ga0114129_10001352 3300009147 Bacteria 32900
83 Ga0114129_10057317 3300009147 Bacteria 5452
84 Ga0114129_10228528 3300009147 Bacteria 2507
85 Ga0114129_10363976 3300009147 Bacteria 1913
86 Ga0114129_10958461 3300009147 Bacteria 1080
87 Ga0105243_10060798 3300009148 Bacteria 3019
88 Ga0105242_10031454 3300009176 Bacteria 4239
89 Ga0105249_10039313 3300009553 Bacteria 4295
90 Ga0157338_1014693 3300012515 Bacteria 846
91 Ga0157371_10048765 3300013102 Bacteria 3010
92 Ga0163162_10159715 3300013306 Bacteria 2375
93 Ga0163162_10720634 3300013306 Bacteria 1118
94 Ga0157372_10027029 3300013307 Bacteria 6246
95 Ga0157372_10453055 3300013307 Bacteria 1495
96 Ga0182008_10004158 3300014497 Bacteria 8522
97 Ga0157379_10024867 3300014968 Bacteria 5317
98 Ga0182007_10000170 3300015262 Bacteria 44373
99 Ga0183367_1001 3300015688 Bacteria 1225545
100 Ga0163161_10044812 3300017792 Bacteria 3187
101 Ga0163161_10263839 3300017792 Bacteria 1346
102 Ga0213875_10000160 3300021388 Bacteria 71044
103 Ga0207692_10089668 3300025898 Bacteria 1665
104 Ga0207688_10002956 3300025901 Bacteria 9249
105 Ga0207685_10038564 3300025905 Bacteria 1767
106 Ga0207685_10104322 3300025905 Bacteria 1218
107 Ga0207699_10000351 3300025906 Bacteria 24518
108 Ga0207699_10005306 3300025906 Bacteria 6173
109 Ga0207699_10023060 3300025906 Bacteria 3383
110 Ga0207684_10003269 3300025910 Bacteria 15906
111 Ga0207684_10004909 3300025910 Bacteria 12481
112 Ga0207684_10148259 3300025910 Bacteria 2018
113 Ga0207695_10495050 3300025913 Bacteria 1104
114 Ga0207693_10004523 3300025915 Bacteria 11757
115 Ga0207693_10091191 3300025915 Bacteria 2389
116 Ga0207693_10093730 3300025915 Bacteria 2354
117 Ga0207663_10005137 3300025916 Bacteria 6580
118 Ga0207663_10053094 3300025916 Bacteria 2530
119 Ga0207646_10004229 3300025922 Bacteria 15703
120 Ga0207646_10089970 3300025922 Bacteria 2748
121 Ga0207646_10145035 3300025922 Bacteria 2139
122 Ga0207700_10000831 3300025928 Bacteria 17851
123 Ga0207700_10012685 3300025928 Bacteria 5447
124 Ga0207700_10036099 3300025928 Bacteria 3566
125 Ga0207700_10144047 3300025928 Bacteria 1962
126 Ga0207664_10000392 3300025929 Bacteria 31387
127 Ga0207664_10063302 3300025929 Bacteria 2956
128 Ga0207664_10118740 3300025929 Bacteria 2210
129 Ga0207706_10017777 3300025933 Bacteria 6403
130 Ga0207686_10022062 3300025934 Bacteria 3662
131 Ga0207669_10246630 3300025937 Bacteria 1327
132 Ga0207704_10009767 3300025938 Bacteria 4646
133 Ga0207704_10084874 3300025938 Bacteria 2059
134 Ga0207665_10000202 3300025939 Bacteria 40056
135 Ga0207665_10000638 3300025939 Bacteria 23596
136 Ga0207689_10027490 3300025942 Bacteria 4761
137 Ga0207667_10163776 3300025949 Bacteria 2287
138 Ga0207712_10059042 3300025961 Bacteria 2713
139 Ga0207712_10111360 3300025961 Bacteria 2054
140 Ga0207668_10027361 3300025972 Bacteria 3713
141 Ga0207677_10143225 3300026023 Bacteria 1833
142 Ga0207677_10195987 3300026023 Bacteria 1601
143 Ga0207703_10095786 3300026035 Bacteria 2504
144 Ga0207702_10161461 3300026078 Bacteria 2047
145 Ga0207641_10301424 3300026088 Bacteria 1514
146 Ga0207698_10049469 3300026142 Bacteria 3200
147 Ga0268264_10486114 3300028381 Bacteria 1202
148 Ga0265336_10010224 3300028666 Bacteria 3217
149 Ga0265338_10028487 3300028800 Bacteria 5568
150 Ga0307409_100443388 3300031995 Bacteria 1251
151 Ga0307409_100560852 3300031995 Bacteria 1123
152 Ga0307416_100085573 3300032002 Bacteria 2684
153 Ga0373926_0003715 3300035083 Bacteria 4965
154 Ga0373934_0002290 3300035086 Bacteria 7048
155 Ga0373944_0001124 3300035089 Bacteria 6659
156 Ga0373923_0004191 3300035111 Bacteria 4758
157 Ga0373923_0176488 3300035111 Bacteria 980
158 Ga0373936_0009445 3300035113 Bacteria 3677
159 Ga0373945_0152400 3300035116 Bacteria 938
160 Ga0373953_0000335 3300035117 Bacteria 12687
161 Ga0373953_0043314 3300035117 Bacteria 1796
162 Ga0373954_0034631 3300035118 Bacteria 2340
163 Ga0373956_0001026 3300035119 Bacteria 11520
164 Ga0373956_0006707 3300035119 Bacteria 4618
165 Ga0373957_0000499 3300035120 Bacteria 9832
166 Ga0373957_0000719 3300035120 Bacteria 8583
167 Ga0373957_0046376 3300035120 Bacteria 1649
168 Ga0373943_0002150 3300035170 Bacteria 8962
169 Ga0373943_0003885 3300035170 Bacteria 6800
170 Ga0373946_0000135 3300035171 Bacteria 22104
171 Ga0373955_0000108 3300035172 Bacteria 33336
172 Ga0373955_0009852 3300035172 Bacteria 4494
173 Ga0373924_0003047 3300035410 Bacteria 5715
174 Ga0373935_0000419 3300035692 Bacteria 22093
175 Ga0373935_0001181 3300035692 Bacteria 14350
176 Ga0373935_0435584 3300035692 Bacteria 945
177 Ga0373927_0003759 3300035695 Bacteria 10780
178 Ga0373927_0081541 3300035695 Bacteria 2097
179 Ga0373933_0000237 3300035724 Bacteria 36352
180 Ga0373933_0024615 3300035724 Bacteria 3446
181 Ga0373933_0064225 3300035724 Bacteria 2220
182 Ga0373947_0014251 3300035725 Bacteria 4559
183 Ga0373947_0016804 3300035725 Bacteria 4204
184 Ga0373937_0000394 3300036401 Bacteria 40733
185 Ga0373937_0131808 3300036401 Bacteria 2334
186 Ga0373937_0157462 3300036401 Bacteria 2129
187 Ga0372808_002396 3300036459 Bacteria 2156
188 Ga0373925_0007836 3300037068 Bacteria 7777
189 Ga0373925_0018207 3300037068 Bacteria 5102
190 Ga0395900_0009877 3300037418 Bacteria 9775
191 Ga0395898_0035339 3300037466 Bacteria 4970
192 Ga0436364_0330965 3300037853 Bacteria 247749
193 Ga0395901_0006619 3300038443 Bacteria 11707
194 Ga0395901_0144380 3300038443 Bacteria 2502
195 Ga0439431_0020033 3300041997 Bacteria 1595
196 Ga0439448_0136388 3300042005 Bacteria 848
197 Ga0439449_0132264 3300042007 Bacteria 927
198 Ga0439463_018238 3300042016 Bacteria 1746
199 Ga0439464_0061383 3300042439 Bacteria 1100
200 Ga0439460_0021370 3300042461 Bacteria 1768
201 Ga0450893_0010985 3300042532 Bacteria 1493
202 Ga0466965_0061629 3300044683 Bacteria 1875
203 Ga0466963_0051333 3300044694 Bacteria 2733
204 Ga0466963_0221069 3300044694 Bacteria 1326
205 Ga0466957_0127402 3300044842 Bacteria 1628
206 Ga0466957_0154285 3300044842 Bacteria 1487
207 Ga0466958_0246871 3300045836 Bacteria 1141
208 Ga0466967_0069275 3300045976 Bacteria 3152
209 Ga0466967_0203791 3300045976 Bacteria 1874
210 Ga0495592_0000358 3300046454 Bacteria 36935
211 Ga0495592_0061575 3300046454 Bacteria 2757
212 Ga0495603_0029760 3300046455 Bacteria 3292
213 Ga0495603_0216608 3300046455 Bacteria 1105
214 Ga0495629_0001769 3300046459 Bacteria 16944
215 Ga0495638_0106405 3300046460 Bacteria 1671
216 Ga0495641_0005237 3300046461 Bacteria 8836
217 Ga0495641_0005465 3300046461 Bacteria 8580
218 Ga0495651_0000334 3300046462 Bacteria 36369
219 Ga0495651_0012043 3300046462 Bacteria 6656
220 Ga0495651_0072456 3300046462 Bacteria 2616
221 Ga0495651_0155231 3300046462 Bacteria 1646
222 Ga0495653_0004847 3300046463 Bacteria 10911
223 Ga0495653_0027151 3300046463 Bacteria 4582
224 Ga0495653_0030663 3300046463 Bacteria 4280
225 Ga0495580_0032433 3300046472 Bacteria 3770
226 Ga0495582_0002260 3300046473 Bacteria 10773
227 Ga0495582_0061248 3300046473 Bacteria 2078
228 Ga0495639_0235874 3300046475 Bacteria 902
229 Ga0495662_0001734 3300046476 Bacteria 10890
230 Ga0495664_0005189 3300046477 Bacteria 7148
231 Ga0495594_0000927 3300046499 Bacteria 15176
232 Ga0495594_0005557 3300046499 Bacteria 6477
233 Ga0495596_0069682 3300046500 Bacteria 1367
234 Ga0495608_0000273 3300046511 Bacteria 36936
235 Ga0495608_0002553 3300046511 Bacteria 13068
236 Ga0495608_0003360 3300046511 Bacteria 11438
237 Ga0495618_0010724 3300046514 Bacteria 5549
238 Ga0495618_0052157 3300046514 Bacteria 2585
239 Ga0495628_0000451 3300046516 Bacteria 37469
240 Ga0495628_0014641 3300046516 Bacteria 6569
241 Ga0495628_0041135 3300046516 Bacteria 3690
242 Ga0495630_0002935 3300046517 Bacteria 11851
243 Ga0495643_0200776 3300046522 Bacteria 957
244 Ga0495666_0002222 3300046526 Bacteria 9674
245 Ga0495666_0036145 3300046526 Bacteria 2406
246 Ga0495652_0000795 3300046529 Bacteria 36368
247 Ga0495652_0048254 3300046529 Bacteria 3649
248 Ga0495652_0106972 3300046529 Bacteria 2257
249 Ga0495652_0327399 3300046529 Bacteria 1105
250 Ga0495665_0000793 3300046531 Bacteria 16530
251 Ga0495640_0006421 3300046533 Bacteria 9296
252 Ga0495640_0042959 3300046533 Bacteria 3151
253 Ga0495586_0010554 3300046535 Bacteria 4914
254 Ga0495587_0000238 3300046536 Bacteria 40728
255 Ga0495587_0017876 3300046536 Bacteria 4398
256 Ga0495645_0125365 3300046543 Bacteria 1804
257 Ga0495645_0136143 3300046543 Bacteria 1718
258 Ga0495622_0012690 3300046557 Bacteria 3906
259 Ga0495667_0000111 3300046559 Bacteria 59734
260 Ga0495667_0000197 3300046559 Bacteria 40705
261 Ga0495667_0079769 3300046559 Bacteria 2128
262 Ga0495656_0039870 3300046615 Bacteria 1954
263 Ga0495634_0081351 3300046642 Bacteria 2118
264 Ga0495635_0006948 3300046663 Bacteria 7906
265 Ga0495635_0020327 3300046663 Bacteria 4625
266 Ga0495661_0175374 3300046665 Bacteria 1140
267 Ga0495588_0008587 3300046674 Bacteria 4693
268 Ga0495657_0000043 3300046675 Bacteria 114089
269 Ga0495657_0002590 3300046675 Bacteria 15134
270 Ga0495657_0051834 3300046675 Bacteria 2754
271 Ga0495599_0000078 3300046678 Bacteria 67349
272 Ga0495623_0005688 3300046679 Bacteria 8140
273 Ga0495623_0006472 3300046679 Bacteria 7624
274 Ga0495623_0040334 3300046679 Bacteria 2981
275 Ga0495658_0002640 3300046683 Bacteria 9011
276 Ga0495658_0014465 3300046683 Bacteria 4034
277 Ga0495613_0001028 3300046689 Bacteria 21269
278 Ga0495613_0024661 3300046689 Bacteria 4481
279 Ga0495624_0002551 3300046690 Bacteria 13792
280 Ga0495589_0005487 3300046794 Bacteria 6689
281 Ga0495589_0036464 3300046794 Bacteria 2465
282 Ga0495600_0002628 3300046809 Bacteria 10366
283 Ga0495600_0009229 3300046809 Bacteria 6085
284 Ga0495600_0166747 3300046809 Bacteria 1422
285 Ga0495581_0000259 3300047315 Bacteria 25347
286 Ga0495604_0000364 3300047317 Bacteria 40702
287 Ga0495604_0010784 3300047317 Bacteria 7256
288 Ga0495604_0064919 3300047317 Bacteria 2780
289 Ga0495636_0002968 3300047318 Bacteria 6563
290 Ga0495636_0030252 3300047318 Bacteria 2213
291 Ga0495636_0042077 3300047318 Bacteria 1897
292 Ga0495674_0007527 3300047319 Bacteria 10399
293 Ga0495674_0031019 3300047319 Bacteria 4858
294 Ga0495676_0011546 3300047321 Bacteria 7967
295 Ga0495680_0000590 3300047322 Bacteria 40722
296 Ga0495680_0002196 3300047322 Bacteria 20193
297 Ga0495680_0004382 3300047322 Bacteria 13516
298 Ga0495683_0168013 3300047323 Bacteria 1010
299 Ga0495687_002761 3300047443 Bacteria 13603
300 Ga0495687_028699 3300047443 Bacteria 2585
301 Ga0495675_0003761 3300047444 Bacteria 9180
302 Ga0495675_0080715 3300047444 Bacteria 2048
303 Ga0495685_011576 3300047447 Bacteria 2979
304 Ga0495685_020644 3300047447 Bacteria 2264
305 Ga0495685_025628 3300047447 Bacteria 2028
306 Ga0495685_036947 3300047447 Bacteria 1676
307 Ga0495684_0011605 3300047471 Bacteria 6802
308 Ga0495684_0034129 3300047471 Bacteria 3904
309 Ga0495684_0111542 3300047471 Bacteria 2063
310 Ga0495593_0000939 3300047673 Bacteria 16979
311 Ga0495602_0000394 3300048088 Bacteria 40733
312 Ga0495602_0015882 3300048088 Bacteria 7585
313 Ga0495602_0102285 3300048088 Bacteria 2348
314 Ga0496101_0240362 3300048904 Bacteria 1409
315 Ga0496104_0001665 3300048907 Bacteria 19193
316 Ga0496105_0001804 3300048908 Bacteria 15309
317 Ga0496112_0010456 3300048915 Bacteria 8417
318 Ga0496115_0032451 3300048918 Bacteria 4120
319 Ga0496115_0060165 3300048918 Bacteria 3060
320 Ga0501069_0114511 3300049585 Bacteria 1538
321 Ga0501070_0082338 3300049586 Bacteria 2664
322 Ga0501076_0413947 3300049592 Bacteria 1109
323 Ga0501044_0004033 3300049823 Bacteria 16468
324 Ga0501044_0132727 3300049823 Bacteria 2483
325 nmdc:mga06z11_315_c1 3300050494 Bacteria 18304
326 nmdc:mga05p37_15928_c1 3300050507 Bacteria 9043
327 nmdc:mga05p37_27116_c1 3300050507 Bacteria 6973
328 nmdc:mga05p37_280006_c1 3300050507 Bacteria 1989
329 nmdc:mga05p37_313859_c1 3300050507 Bacteria 1858
330 nmdc:mga05p37_368594_c1 3300050507 Bacteria 1686
331 nmdc:mga05p37_823497_c1 3300050507 Bacteria 1012
332 nmdc:mga09592_398_c1 3300050508 Bacteria 31870
333 nmdc:mga0qj67_82_c2 3300050509 Bacteria 31888
334 nmdc:mga06r32_128_c1 3300050510 Bacteria 30752
335 nmdc:mga08y16_299416_c1 3300050511 Bacteria 1658
336 nmdc:mga0n895_209527_c1 3300050512 Bacteria 1980
337 nmdc:mga0a205_108171_c1 3300050515 Bacteria 2679
338 nmdc:mga0a205_481532_c1 3300050515 Bacteria 1099
339 Ga0495601_0006367 3300053077 Bacteria 6902
340 Ga0495601_0024531 3300053077 Bacteria 3714
341 Ga0495612_0008756 3300053078 Bacteria 4104
342 Ga0495595_0000219 3300053084 Bacteria 23010
343 Ga0495595_0008697 3300053084 Bacteria 4178
344 Ga0495595_0189623 3300053084 Bacteria 1021
345 Ga0495619_0003062 3300053085 Bacteria 10854
346 Ga0500553_074562 3300053101 Bacteria 1548
347 Ga0500560_006779 3300053107 Bacteria 2653
348 Ga0500614_004522 3300053123 Bacteria 2934
349 Ga0500600_0098157 3300053149 Bacteria 1550
350 Ga0590071_018764 3300059421 Bacteria 1627
351 Ga0590074_032906 3300059423 Bacteria 919
352 Ga0590075_039308 3300059424 Bacteria 1207
353 Ga0466962_0122997 3300061719 Bacteria 1252
354 8025535344 8025530807 Bacteria 8495698
355 2676201464 2675902999 Bacteria 9438463
356 2689957403 2687453737 Bacteria 11203906
357 2774846040 2773857921 Bacteria 9435764
358 2808918105 2808606375 Bacteria 9466072
359 2867346650 2867346516 Bacteria 7608576
360 2996223877 2996221748 Bacteria 6799777
361 8001786332 8001781756 Bacteria 9586736
362 8008581086 8008574985 Bacteria 7815457
363 8047710719 8047710418 Bacteria 11023148
364 8048129772 8048127548 Bacteria 11053136
365 rootH1_10029225
366 JGI25407J50210_10008292
367 Ga0068869_100045135
368 Ga0068869_100226208
369 Ga0070682_100152802
370 Ga0068868_100358729
371 Ga0070691_10032555
372 Ga0070668_100048496
373 Ga0070669_100154369
374 Ga0070709_10000361
375 Ga0070709_10010738
376 Ga0070709_10041596
377 Ga0070709_10076218
378 Ga0070709_10343650
379 Ga0070714_100000615
380 Ga0070714_100000898
381 Ga0070714_100094474
382 Ga0070714_100417619
383 Ga0070713_100000934
384 Ga0070713_100037381
385 Ga0070713_100208921
386 Ga0070710_10000602
387 Ga0070710_10010839
388 Ga0070710_10041764
389 Ga0070711_100000275
390 Ga0070711_100016743
391 Ga0070711_100044119
392 Ga0070705_100196174
393 Ga0070700_100120078
394 Ga0070708_100032870
395 Ga0070708_100190692
396 Ga0070708_100595169
397 Ga0070662_100010428
398 Ga0070706_100002563
399 Ga0070706_100003830
400 Ga0070706_100068219
401 Ga0070707_100004301
402 Ga0070707_100046456
403 Ga0070698_100000898
404 Ga0070698_100001316
405 Ga0070698_100006950
406 Ga0070699_100200550
407 Ga0070697_100088053
408 Ga0070697_100188977
409 Ga0068855_100049732
410 Ga0068856_100194890
411 Ga0068852_100008654
412 Ga0068861_100024690
413 Ga0068861_100407077
414 Ga0068863_100201454
415 Ga0081455_10000258
416 Ga0081455_10003888
417 Ga0081455_10005128
418 Ga0081455_10022327
419 Ga0081455_10476285
420 Ga0081538_10003107
421 Ga0081538_10011318
422 Ga0081540_1000176
423 Ga0081539_10043696
424 Ga0070717_10003221
425 Ga0070717_10076434
426 Ga0075363_100310436
427 Ga0070715_10001414
428 Ga0070716_100000167
429 Ga0070716_100061303
430 Ga0070712_100012931
431 Ga0070712_100020390
432 Ga0070712_100069662
433 Ga0070712_100102569
434 Ga0070712_100145150
435 Ga0075367_10000665
436 Ga0075428_100118791
437 Ga0075433_10044053
438 Ga0075434_100369870
439 Ga0068865_100016018
440 Ga0075436_100152911
441 Ga0075435_100048832
442 Ga0099794_10043060
443 Ga0105240_10490073
444 Ga0111539_10164542
445 Ga0105245_10005573
446 Ga0114129_10001352
447 Ga0114129_10057317
448 Ga0114129_10228528
449 Ga0114129_10363976
450 Ga0114129_10958461
451 Ga0105243_10060798
452 Ga0105242_10031454
453 Ga0105249_10039313
454 Ga0157338_1014693
455 Ga0157371_10048765
456 Ga0163162_10159715
457 Ga0163162_10720634
458 Ga0157372_10027029
459 Ga0157372_10453055
460 Ga0182008_10004158
461 Ga0157379_10024867
462 Ga0182007_10000170
463 Ga0183367_1001
464 Ga0163161_10044812
465 Ga0163161_10263839
466 Ga0213875_10000160
467 Ga0207692_10089668
468 Ga0207688_10002956
469 Ga0207685_10038564
470 Ga0207685_10104322
471 Ga0207699_10000351
472 Ga0207699_10005306
473 Ga0207699_10023060
474 Ga0207684_10003269
475 Ga0207684_10004909
476 Ga0207684_10148259
477 Ga0207695_10495050
478 Ga0207693_10004523
479 Ga0207693_10091191
480 Ga0207693_10093730
481 Ga0207663_10005137
482 Ga0207663_10053094
483 Ga0207646_10004229
484 Ga0207646_10089970
485 Ga0207646_10145035
486 Ga0207700_10000831
487 Ga0207700_10012685
488 Ga0207700_10036099
489 Ga0207700_10144047
490 Ga0207664_10000392
491 Ga0207664_10063302
492 Ga0207664_10118740
493 Ga0207706_10017777
494 Ga0207686_10022062
495 Ga0207669_10246630
496 Ga0207704_10009767
497 Ga0207704_10084874
498 Ga0207665_10000202
499 Ga0207665_10000638
500 Ga0207689_10027490
501 Ga0207667_10163776
502 Ga0207712_10059042
503 Ga0207712_10111360
504 Ga0207668_10027361
505 Ga0207677_10143225
506 Ga0207677_10195987
507 Ga0207703_10095786
508 Ga0207702_10161461
509 Ga0207641_10301424
510 Ga0207698_10049469
511 Ga0268264_10486114
512 Ga0265336_10010224
513 Ga0265338_10028487
514 Ga0307409_100443388
515 Ga0307409_100560852
516 Ga0307416_100085573
517 Ga0373926_0003715
518 Ga0373934_0002290
519 Ga0373944_0001124
520 Ga0373923_0004191
521 Ga0373923_0176488
522 Ga0373936_0009445
523 Ga0373945_0152400
524 Ga0373953_0000335
525 Ga0373953_0043314
526 Ga0373954_0034631
527 Ga0373956_0001026
528 Ga0373956_0006707
529 Ga0373957_0000499
530 Ga0373957_0000719
531 Ga0373957_0046376
532 Ga0373943_0002150
533 Ga0373943_0003885
534 Ga0373946_0000135
535 Ga0373955_0000108
536 Ga0373955_0009852
537 Ga0373924_0003047
538 Ga0373935_0000419
539 Ga0373935_0001181
540 Ga0373935_0435584
541 Ga0373927_0003759
542 Ga0373927_0081541
543 Ga0373933_0000237
544 Ga0373933_0024615
545 Ga0373933_0064225
546 Ga0373947_0014251
547 Ga0373947_0016804
548 Ga0373937_0000394
549 Ga0373937_0131808
550 Ga0373937_0157462
551 Ga0372808_002396
552 Ga0373925_0007836
553 Ga0373925_0018207
554 Ga0395900_0009877
555 Ga0395898_0035339
556 Ga0436364_0330965
557 Ga0395901_0006619
558 Ga0395901_0144380
559 Ga0439431_0020033
560 Ga0439448_0136388
561 Ga0439449_0132264
562 Ga0439463_018238
563 Ga0439464_0061383
564 Ga0439460_0021370
565 Ga0450893_0010985
566 Ga0466965_0061629
567 Ga0466963_0051333
568 Ga0466963_0221069
569 Ga0466957_0127402
570 Ga0466957_0154285
571 Ga0466958_0246871
572 Ga0466967_0069275
573 Ga0466967_0203791
574 Ga0495592_0000358
575 Ga0495592_0061575
576 Ga0495603_0029760
577 Ga0495603_0216608
578 Ga0495629_0001769
579 Ga0495638_0106405
580 Ga0495641_0005237
581 Ga0495641_0005465
582 Ga0495651_0000334
583 Ga0495651_0012043
584 Ga0495651_0072456
585 Ga0495651_0155231
586 Ga0495653_0004847
587 Ga0495653_0027151
588 Ga0495653_0030663
589 Ga0495580_0032433
590 Ga0495582_0002260
591 Ga0495582_0061248
592 Ga0495639_0235874
593 Ga0495662_0001734
594 Ga0495664_0005189
595 Ga0495594_0000927
596 Ga0495594_0005557
597 Ga0495596_0069682
598 Ga0495608_0000273
599 Ga0495608_0002553
600 Ga0495608_0003360
601 Ga0495618_0010724
602 Ga0495618_0052157
603 Ga0495628_0000451
604 Ga0495628_0014641
605 Ga0495628_0041135
606 Ga0495630_0002935
607 Ga0495643_0200776
608 Ga0495666_0002222
609 Ga0495666_0036145
610 Ga0495652_0000795
611 Ga0495652_0048254
612 Ga0495652_0106972
613 Ga0495652_0327399
614 Ga0495665_0000793
615 Ga0495640_0006421
616 Ga0495640_0042959
617 Ga0495586_0010554
618 Ga0495587_0000238
619 Ga0495587_0017876
620 Ga0495645_0125365
621 Ga0495645_0136143
622 Ga0495622_0012690
623 Ga0495667_0000111
624 Ga0495667_0000197
625 Ga0495667_0079769
626 Ga0495656_0039870
627 Ga0495634_0081351
628 Ga0495635_0006948
629 Ga0495635_0020327
630 Ga0495661_0175374
631 Ga0495588_0008587
632 Ga0495657_0000043
633 Ga0495657_0002590
634 Ga0495657_0051834
635 Ga0495599_0000078
636 Ga0495623_0005688
637 Ga0495623_0006472
638 Ga0495623_0040334
639 Ga0495658_0002640
640 Ga0495658_0014465
641 Ga0495613_0001028
642 Ga0495613_0024661
643 Ga0495624_0002551
644 Ga0495589_0005487
645 Ga0495589_0036464
646 Ga0495600_0002628
647 Ga0495600_0009229
648 Ga0495600_0166747
649 Ga0495581_0000259
650 Ga0495604_0000364
651 Ga0495604_0010784
652 Ga0495604_0064919
653 Ga0495636_0002968
654 Ga0495636_0030252
655 Ga0495636_0042077
656 Ga0495674_0007527
657 Ga0495674_0031019
658 Ga0495676_0011546
659 Ga0495680_0000590
660 Ga0495680_0002196
661 Ga0495680_0004382
662 Ga0495683_0168013
663 Ga0495687_002761
664 Ga0495687_028699
665 Ga0495675_0003761
666 Ga0495675_0080715
667 Ga0495685_011576
668 Ga0495685_020644
669 Ga0495685_025628
670 Ga0495685_036947
671 Ga0495684_0011605
672 Ga0495684_0034129
673 Ga0495684_0111542
674 Ga0495593_0000939
675 Ga0495602_0000394
676 Ga0495602_0015882
677 Ga0495602_0102285
678 Ga0496101_0240362
679 Ga0496104_0001665
680 Ga0496105_0001804
681 Ga0496112_0010456
682 Ga0496115_0032451
683 Ga0496115_0060165
684 Ga0501069_0114511
685 Ga0501070_0082338
686 Ga0501076_0413947
687 Ga0501044_0004033
688 Ga0501044_0132727
689 nmdc:mga06z11_315_c1
690 nmdc:mga05p37_15928_c1
691 nmdc:mga05p37_27116_c1
692 nmdc:mga05p37_280006_c1
693 nmdc:mga05p37_313859_c1
694 nmdc:mga05p37_368594_c1
695 nmdc:mga05p37_823497_c1
696 nmdc:mga09592_398_c1
697 nmdc:mga0qj67_82_c2
698 nmdc:mga06r32_128_c1
699 nmdc:mga08y16_299416_c1
700 nmdc:mga0n895_209527_c1
701 nmdc:mga0a205_108171_c1
702 nmdc:mga0a205_481532_c1
703 Ga0495601_0006367
704 Ga0495601_0024531
705 Ga0495612_0008756
706 Ga0495595_0000219
707 Ga0495595_0008697
708 Ga0495595_0189623
709 Ga0495619_0003062
710 Ga0500553_074562
711 Ga0500560_006779
712 Ga0500614_004522
713 Ga0500600_0098157
714 Ga0590071_018764
715 Ga0590074_032906
716 Ga0590075_039308
717 Ga0466962_0122997
718 8025535344
719 2676201464
720 2689957403
721 2774846040
722 2808918105
723 2867346650
724 2996223877
725 8001786332
726 8008581086
727 8047710719
728 8048129772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

41

139

0.84

PF08242

Methyltransf_12

Methyltransferase domain

42

141

0.81

PF08241

Methyltransf_11

Methyltransferase domain

42

143

0.78

PF13489

Methyltransf_23

Methyltransferase domain

17

243

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.8955 25 243
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.8788 9 243
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.8703 2 245
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.87 9 243
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.8605 2 245
ID Description Score Start End Superfamily
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9156 31 246 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9023 12 243 3.40.50.150
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8895 31 246 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8873 12 243 3.40.50.150
3cggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8624 9 243 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V9PWJ8-F1-model_v4 Class I SAM-dependent methyltransferase 0.9877 46 244 GO:0008168
GO:0032259
AF-A0A6G3QA14-F1-model_v4 Class I SAM-dependent methyltransferase 0.9716 1 245 GO:0008168
GO:0009058
GO:0032259
AF-A0A7W0PYD9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9674 1 244 GO:0008168
GO:0032259
AF-A0A6B2DTB3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9673 9 244 GO:0008168
GO:0032259
AF-A0A444BLR6-F1-model_v4 deleted 0.9659 10 180

Map