F423341

General Info

Members Datasets Scaffolds Average Seq Length
364 280 310 235

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10102465|Ga0207705_101024652
Length 272
Sequence MGAPMLTIDGLSAAYGDIPVLHGISMSVAAGESLGILGHNGMGKTTLLRCLIGATPSKLAVTAGSVQLDGHDITRAAPHARAARGLAYVPQGREIFATLSVRDNLRMGLVKTGVRGDGPLDELLQHFPRLAPLLDRAGGSLSGGEQQLLALARALAGQPRVLLLDEPTEGIQPSIIEEIAETLATLRDRLGLTIVLVEQNLDFIATVSQRVLVIKRGQLGAEIPREHLEDLAVMSEYTGGIDPHPRSAFGAPPQGGDPGGPAKPDPRRPLVA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
5 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
6 2643221610 Ensifer sp. Root74 Isolate Unclassified
7 2643221675 Ensifer sp. Root1298 Isolate Unclassified
8 2643221680 Ensifer sp. Root1312 Isolate Unclassified
9 2643221726 Ensifer sp. Root954 Isolate Unclassified
10 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
11 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
12 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
13 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
14 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
15 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
16 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
17 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
18 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
19 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
20 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
21 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
22 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
23 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
24 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
25 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
26 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
27 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
28 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
29 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
30 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
31 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
32 2904456579 Variovorax sp. 2002 Isolate Unclassified
33 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
34 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
35 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
36 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
37 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
38 2929520902 Variovorax beijingensis 502 Isolate Unclassified
39 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
40 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
41 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
42 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
43 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
44 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
45 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
46 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
47 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
48 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
49 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
62 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
63 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
64 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
112 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
113 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
254 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
255 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
256 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
257 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
258 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
259 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
260 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
261 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
262 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
263 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
264 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
265 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
268 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
272 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
273 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
274 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
279 8005382845 Rhizobium sp. R634 Isolate Nodule
280 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.16
Metatranscriptomes 0
Isolates 14.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.15
Nodule 11.54
Rhizoplane 4.67
Rhizosphere 53.3
Stem 0
Stem Tuber 0
Unclassified 9.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000026 3300002987 Bacteria 114104
2 JGI25153J46596_10013265 3300003215 Bacteria 3495
3 rootH1_10000260 3300003316 Bacteria 2990
4 rootL2_10123108 3300003322 Bacteria 5199
5 rootH1_10265892 3300003323 Bacteria 1642
6 JGI25160J50197_1000013 3300003354 Bacteria 263367
7 JGI25160J50197_1000039 3300003354 Bacteria 159036
8 JGI25161J50226_1001386 3300003374 Bacteria 7384
9 Ga0055536_1004541 3300003781 Bacteria 7055
10 Ga0055528_1030281 3300003790 Bacteria 1440
11 Ga0055530_10009229 3300003791 Bacteria 3823
12 Ga0055540_1000851 3300003792 Bacteria 20392
13 Ga0055540_1001916 3300003792 Bacteria 11636
14 Ga0055531_10001692 3300003794 Bacteria 15850
15 Ga0055543_1000132 3300004625 Bacteria 61786
16 Ga0065165_1000021 3300005262 Bacteria 262983
17 Ga0065165_1000770 3300005262 Bacteria 43283
18 Ga0070690_100341175 3300005330 Bacteria 1085
19 Ga0070680_100359283 3300005336 Bacteria 1239
20 Ga0070674_100105434 3300005356 Bacteria 2061
21 Ga0070700_100287712 3300005441 Bacteria 1194
22 Ga0070694_100649611 3300005444 Bacteria 854
23 Ga0070678_100016771 3300005456 Bacteria 4695
24 Ga0070681_10513380 3300005458 Bacteria 1112
25 Ga0070706_100346197 3300005467 Bacteria 1386
26 Ga0070706_100408726 3300005467 Bacteria 1264
27 Ga0070707_100000111 3300005468 Bacteria 75249
28 Ga0070699_100247501 3300005518 Bacteria 1592
29 Ga0070697_100025101 3300005536 Bacteria 4751
30 Ga0070697_100287011 3300005536 Unclassified 1413
31 Ga0070697_100395440 3300005536 Bacteria 1199
32 Ga0070697_100623704 3300005536 Bacteria 949
33 Ga0068853_100073668 3300005539 Bacteria 2978
34 Ga0070695_100082382 3300005545 Bacteria 2130
35 Ga0070665_100336175 3300005548 Bacteria 1515
36 Ga0070665_100430265 3300005548 Bacteria 1329
37 Ga0070704_100358566 3300005549 Bacteria 1233
38 Ga0070704_100444041 3300005549 Bacteria 1116
39 Ga0068852_100224977 3300005616 Bacteria 1786
40 Ga0068863_100272418 3300005841 Bacteria 1639
41 Ga0081455_10031367 3300005937 Bacteria 4810
42 Ga0081539_10026295 3300005985 Bacteria 3718
43 Ga0075365_10210488 3300006038 Bacteria 1363
44 Ga0075363_100021550 3300006048 Bacteria 3248
45 Ga0075363_100111511 3300006048 Bacteria 1521
46 Ga0075362_10000630 3300006177 Bacteria 10317
47 Ga0075367_10018112 3300006178 Bacteria 3880
48 Ga0075369_10000545 3300006186 Bacteria 11886
49 Ga0075428_100000048 3300006844 Bacteria 96714
50 Ga0075428_100152963 3300006844 Bacteria 2506
51 Ga0075428_100209939 3300006844 Bacteria 2104
52 Ga0075428_100376950 3300006844 Bacteria 1521
53 Ga0075430_100001285 3300006846 Bacteria 20240
54 Ga0075430_100012097 3300006846 Bacteria 7348
55 Ga0075430_100222535 3300006846 Bacteria 1566
56 Ga0075430_100280084 3300006846 Bacteria 1380
57 Ga0075431_100000554 3300006847 Bacteria 31462
58 Ga0075431_100008254 3300006847 Bacteria 10411
59 Ga0075433_10139189 3300006852 Bacteria 2157
60 Ga0075434_100119517 3300006871 Bacteria 2649
61 Ga0075429_100000770 3300006880 Bacteria 25272
62 Ga0075429_100001225 3300006880 Bacteria 20840
63 Ga0075429_100240187 3300006880 Bacteria 1587
64 Ga0079104_1000183 3300006946 Bacteria 89496
65 Ga0099794_10090307 3300007265 Bacteria 1520
66 Ga0105244_10013804 3300009036 Bacteria 4701
67 Ga0105240_10005714 3300009093 Bacteria 18452
68 Ga0111539_10567455 3300009094 Bacteria 1322
69 Ga0114129_10000521 3300009147 Bacteria 46873
70 Ga0114129_10011798 3300009147 Bacteria 12432
71 Ga0114129_10070013 3300009147 Bacteria 4891
72 Ga0114129_10187159 3300009147 Bacteria 2813
73 Ga0105248_10001760 3300009177 Bacteria 24098
74 Ga0105248_10108791 3300009177 Bacteria 3126
75 Ga0105248_10302626 3300009177 Bacteria 1801
76 Ga0105237_10001166 3300009545 Bacteria 35086
77 Ga0105238_10001264 3300009551 Bacteria 25422
78 Ga0099796_10013029 3300010159 Bacteria 2365
79 Ga0105239_10002608 3300010375 Bacteria 22812
80 Ga0105246_10008555 3300011119 Bacteria 6294
81 Ga0157370_10211193 3300013104 Bacteria 1799
82 Ga0157369_10027560 3300013105 Bacteria 6296
83 Ga0157372_10467513 3300013307 Bacteria 1470
84 Ga0157380_10135568 3300014326 Bacteria 2106
85 Ga0182005_1096028 3300015265 Bacteria 827
86 Ga0163161_10033737 3300017792 Bacteria 3658
87 Ga0163161_10217869 3300017792 Bacteria 1477
88 Ga0214544_1000097 3300021320 Bacteria 116548
89 Ga0214542_1019485 3300021321 Bacteria 5322
90 Ga0214543_1014631 3300021327 Bacteria 9117
91 Ga0213871_10097052 3300021441 Bacteria 859
92 Ga0209436_100024 3300025208 Bacteria 95606
93 Ga0209673_1000905 3300025273 Bacteria 37932
94 Ga0209130_1000039 3300025284 Bacteria 263493
95 Ga0209130_1015299 3300025284 Bacteria 1895
96 Ga0209676_1000743 3300025292 Bacteria 44174
97 Ga0209676_1012944 3300025292 Bacteria 3239
98 Ga0209025_1004027 3300025294 Bacteria 13176
99 Ga0209025_1013152 3300025294 Bacteria 5226
100 Ga0209564_1010370 3300025295 Bacteria 4300
101 Ga0209758_1002277 3300025297 Bacteria 19883
102 Ga0209050_1011593 3300025298 Bacteria 4155
103 Ga0209256_1008917 3300025299 Bacteria 4519
104 Ga0207426_1000018 3300025302 Bacteria 566740
105 Ga0207426_1000099 3300025302 Bacteria 263493
106 Ga0209051_1000178 3300025303 Bacteria 115109
107 Ga0209051_1007619 3300025303 Bacteria 5891
108 Ga0209257_1001965 3300025304 Bacteria 22155
109 Ga0207655_1069613 3300025728 Bacteria 1314
110 Ga0207705_10102465 3300025909 Bacteria 2107
111 Ga0207684_10040917 3300025910 Bacteria 3930
112 Ga0207684_10551427 3300025910 Bacteria 986
113 Ga0207707_10216510 3300025912 Bacteria 1667
114 Ga0207707_10306532 3300025912 Bacteria 1372
115 Ga0207695_10003519 3300025913 Bacteria 21935
116 Ga0207695_10040855 3300025913 Bacteria 4968
117 Ga0207671_10007523 3300025914 Bacteria 9442
118 Ga0207660_10314600 3300025917 Bacteria 1249
119 Ga0207660_10332281 3300025917 Bacteria 1215
120 Ga0207652_10245182 3300025921 Bacteria 1615
121 Ga0207646_10000163 3300025922 Bacteria 90731
122 Ga0207706_10065019 3300025933 Bacteria 3212
123 Ga0207669_10070985 3300025937 Bacteria 2186
124 Ga0207704_10157889 3300025938 Bacteria 1610
125 Ga0207711_10019846 3300025941 Bacteria 5602
126 Ga0207711_10252676 3300025941 Bacteria 1619
127 Ga0207668_10503473 3300025972 Bacteria 1042
128 Ga0207708_10345512 3300026075 Bacteria 1219
129 Ga0207676_10611728 3300026095 Bacteria 1048
130 Ga0207675_100819956 3300026118 Bacteria 944
131 Ga0207683_10040956 3300026121 Bacteria 4044
132 Ga0209281_1000295 3300027111 Bacteria 90994
133 Ga0265330_10200861 3300031235 Bacteria 843
134 Ga0265340_10071144 3300031247 Bacteria 1649
135 Ga0307513_10212546 3300031456 Bacteria 1764
136 Ga0307408_100010012 3300031548 Bacteria 6247
137 Ga0307408_100158214 3300031548 Bacteria 1797
138 Ga0307514_10035390 3300031649 Bacteria 3975
139 Ga0307514_10279172 3300031649 Bacteria 958
140 Ga0265314_10002436 3300031711 Bacteria 19077
141 Ga0307413_10494850 3300031824 Bacteria 980
142 Ga0307410_10017580 3300031852 Bacteria 4300
143 Ga0307406_10000594 3300031901 Bacteria 20799
144 Ga0307407_10048325 3300031903 Bacteria 2421
145 Ga0307412_10863601 3300031911 Bacteria 790
146 Ga0307409_100002515 3300031995 Bacteria 9607
147 Ga0307409_100405450 3300031995 Bacteria 1303
148 Ga0307409_100527227 3300031995 Bacteria 1155
149 Ga0307416_100011232 3300032002 Bacteria 5956
150 Ga0307416_100480355 3300032002 Bacteria 1302
151 Ga0307411_10146584 3300032005 Bacteria 1748
152 Ga0307411_10315078 3300032005 Bacteria 1261
153 Ga0307411_10402991 3300032005 Bacteria 1131
154 Ga0307415_100190926 3300032126 Bacteria 1616
155 Ga0373931_0537326 3300035691 Bacteria 758
156 Ga0373927_0054190 3300035695 Bacteria 2594
157 Ga0373947_0089748 3300035725 Bacteria 1915
158 Ga0373925_0190934 3300037068 Bacteria 1625
159 Ga0395899_0108330 3300037312 Bacteria 1999
160 Ga0395900_0057325 3300037418 Bacteria 4010
161 Ga0395898_0064017 3300037466 Bacteria 3567
162 Ga0395905_0001205 3300037471 Bacteria 32309
163 Ga0395905_0079249 3300037471 Bacteria 3078
164 Ga0395901_0033814 3300038443 Bacteria 5278
165 Ga0436360_0076367 3300039438 Bacteria 2324
166 Ga0436360_0796445 3300039438 Bacteria 867
167 Ga0436360_0837218 3300039438 Bacteria 1316
168 Ga0436360_1298689 3300039438 Bacteria 2357
169 Ga0436361_0931668 3300039447 Bacteria 1822
170 Ga0439447_011411 3300041407 Bacteria 2595
171 Ga0439466_0047951 3300041411 Bacteria 1407
172 Ga0439465_0064685 3300041413 Bacteria 1217
173 Ga0495627_022011 3300046453 Bacteria 2102
174 Ga0495603_0051320 3300046455 Bacteria 2451
175 Ga0495580_0168532 3300046472 Bacteria 1514
176 Ga0495605_0021030 3300046474 Bacteria 3460
177 Ga0495583_0019049 3300046506 Bacteria 3592
178 Ga0495610_0100134 3300046512 Bacteria 1299
179 Ga0495616_0002803 3300046513 Bacteria 11377
180 Ga0495616_0024346 3300046513 Bacteria 3247
181 Ga0495631_0000082 3300046518 Bacteria 61773
182 Ga0495654_0123210 3300046530 Bacteria 1171
183 Ga0495665_0010969 3300046531 Bacteria 4903
184 Ga0495621_0017105 3300046539 Bacteria 2338
185 Ga0495622_0019640 3300046557 Bacteria 3146
186 Ga0495622_0083653 3300046557 Bacteria 1468
187 Ga0495633_0092327 3300046558 Bacteria 1407
188 Ga0495661_0070357 3300046665 Bacteria 2048
189 Ga0495588_0112444 3300046674 Bacteria 1434
190 Ga0495646_0309030 3300046680 Bacteria 835
191 Ga0495624_0029802 3300046690 Bacteria 3558
192 Ga0495624_0178625 3300046690 Bacteria 1294
193 Ga0495671_0000944 3300046692 Bacteria 20475
194 Ga0495649_0094012 3300046694 Bacteria 1596
195 Ga0495660_0037315 3300046810 Bacteria 2707
196 Ga0495674_0005629 3300047319 Bacteria 11999
197 Ga0495676_0014842 3300047321 Bacteria 6955
198 Ga0495683_0072574 3300047323 Bacteria 1688
199 Ga0495687_011726 3300047443 Bacteria 4689
200 Ga0495673_0028475 3300047469 Bacteria 2645
201 Ga0495686_0007369 3300047472 Bacteria 8254
202 Ga0495593_0004769 3300047673 Bacteria 8054
203 Ga0495602_0091651 3300048088 Bacteria 2520
204 Ga0495614_0044089 3300048089 Bacteria 1913
205 Ga0495626_0026375 3300048091 Bacteria 2833
206 Ga0496100_0000042 3300048903 Bacteria 89770
207 Ga0496100_0305568 3300048903 Bacteria 1191
208 Ga0496101_0004818 3300048904 Bacteria 8561
209 Ga0496101_0099275 3300048904 Bacteria 2176
210 Ga0496102_0000326 3300048905 Bacteria 59304
211 Ga0496103_0000615 3300048906 Bacteria 27646
212 Ga0496104_0014117 3300048907 Bacteria 7210
213 Ga0496104_0367265 3300048907 Bacteria 1351
214 Ga0496105_0054264 3300048908 Bacteria 3309
215 Ga0496106_0035040 3300048909 Bacteria 3751
216 Ga0496107_0436682 3300048910 Bacteria 973
217 Ga0496107_0437223 3300048910 Bacteria 972
218 Ga0496112_0081148 3300048915 Bacteria 3207
219 Ga0496112_0518111 3300048915 Unclassified 1127
220 Ga0496114_0900282 3300048917 Bacteria 766
221 Ga0496114_0922513 3300048917 Bacteria 755
222 Ga0496115_0065816 3300048918 Bacteria 2928
223 Ga0496116_0076788 3300048919 Bacteria 2091
224 Ga0496117_0000221 3300048920 Bacteria 107687
225 Ga0496118_0000107 3300048921 Bacteria 155470
226 Ga0496119_0073769 3300048922 Bacteria 1989
227 Ga0496121_0000256 3300048924 Bacteria 112931
228 Ga0496121_0006589 3300048924 Bacteria 14323
229 Ga0496122_0000380 3300048925 Bacteria 95108
230 Ga0496123_0000246 3300048926 Bacteria 109397
231 Ga0496123_0030395 3300048926 Bacteria 3954
232 Ga0496123_0258264 3300048926 Bacteria 855
233 Ga0496124_0131070 3300048927 Bacteria 1992
234 Ga0496125_0097648 3300048928 Bacteria 2176
235 Ga0496125_0137412 3300048928 Bacteria 1707
236 Ga0496125_0171003 3300048928 Bacteria 1461
237 Ga0496126_0023010 3300048929 Bacteria 6044
238 Ga0496126_0206407 3300048929 Bacteria 1656
239 Ga0495682_0036477 3300049460 Bacteria 1810
240 Ga0501034_0047878 3300049571 Bacteria 4315
241 Ga0501039_0187404 3300049575 Bacteria 1627
242 Ga0501039_0527531 3300049575 Bacteria 927
243 Ga0501040_0045569 3300049576 Bacteria 2992
244 Ga0501041_0025349 3300049577 Bacteria 3564
245 Ga0501068_0124340 3300049584 Bacteria 1610
246 Ga0501072_0021516 3300049588 Bacteria 5001
247 Ga0501072_0082571 3300049588 Bacteria 2547
248 Ga0501074_0204850 3300049590 Bacteria 1406
249 Ga0501077_0036348 3300049593 Bacteria 3137
250 Ga0501079_0112447 3300049741 Bacteria 2116
251 Ga0501080_0250749 3300049742 Bacteria 1614
252 Ga0501081_0045709 3300049743 Bacteria 3007
253 Ga0501045_0164690 3300049824 Bacteria 1651
254 nmdc:mga03683_1124_c1 3300050489 Bacteria 7840
255 nmdc:mga03683_1343_c1 3300050489 Bacteria 7293
256 nmdc:mga03n38_2363_c1 3300050490 Bacteria 5807
257 nmdc:mga0yw44_242933_c1 3300050492 Bacteria 1197
258 nmdc:mga06z11_3079_c1 3300050494 Bacteria 6421
259 nmdc:mga05p37_3969_c1 3300050507 Bacteria 17322
260 nmdc:mga09592_35783_c1 3300050508 Bacteria 4158
261 nmdc:mga09592_5504_c1 3300050508 Bacteria 10300
262 nmdc:mga09592_97180_c1 3300050508 Bacteria 2520
263 nmdc:mga0qj67_12648_c1 3300050509 Bacteria 6363
264 nmdc:mga0qj67_148656_c1 3300050509 Bacteria 1900
265 nmdc:mga0qj67_335113_c1 3300050509 Bacteria 1224
266 nmdc:mga0qj67_791_c1 3300050509 Bacteria 21533
267 nmdc:mga06r32_2580_c1 3300050510 Bacteria 16171
268 nmdc:mga06r32_439790_c1 3300050510 Bacteria 1284
269 nmdc:mga06r32_652_c1 3300050510 Bacteria 30296
270 nmdc:mga06r32_73105_c1 3300050510 Bacteria 3321
271 nmdc:mga08x19_257315_c1 3300050514 Bacteria 1206
272 nmdc:mga0a205_30029_c1 3300050515 Bacteria 5203
273 nmdc:mga0a205_931613_c1 3300050515 Bacteria 715
274 nmdc:mga0sz30_54856_c1 3300050516 Bacteria 1695
275 nmdc:mga0sz30_637_c1 3300050516 Bacteria 12980
276 Ga0500578_0031733 3300053086 Bacteria 3396
277 Ga0500651_0001107 3300053093 Bacteria 13327
278 Ga0500651_0155498 3300053093 Bacteria 1370
279 Ga0500651_0288082 3300053093 Bacteria 945
280 Ga0500641_0245539 3300053096 Bacteria 752
281 Ga0500560_029821 3300053107 Bacteria 1640
282 Ga0500562_009241 3300053108 Bacteria 2492
283 Ga0500569_107031 3300053109 Bacteria 921
284 Ga0500571_000039 3300053110 Bacteria 41202
285 Ga0500593_000221 3300053117 Bacteria 23510
286 Ga0500593_017606 3300053117 Bacteria 3106
287 Ga0500594_0000819 3300053118 Bacteria 6629
288 Ga0500597_011880 3300053120 Bacteria 3171
289 Ga0500607_001070 3300053121 Bacteria 25759
290 Ga0500608_004888 3300053122 Bacteria 5246
291 Ga0500608_229107 3300053122 Bacteria 743
292 Ga0500618_046956 3300053125 Bacteria 983
293 Ga0500626_008830 3300053128 Bacteria 4167
294 Ga0500655_000415 3300053133 Bacteria 8967
295 Ga0500658_0001361 3300053134 Bacteria 9890
296 Ga0500658_0001571 3300053134 Bacteria 9115
297 Ga0500559_0009619 3300053136 Bacteria 4175
298 Ga0500564_001576 3300053138 Bacteria 7966
299 Ga0500574_035153 3300053141 Bacteria 1371
300 Ga0500616_0000533 3300053153 Bacteria 47588
301 Ga0500627_0001883 3300053158 Bacteria 6012
302 Ga0500633_0150194 3300053160 Bacteria 873
303 Ga0500634_0011466 3300053161 Bacteria 4575
304 Ga0500634_0020736 3300053161 Bacteria 3557
305 Ga0500638_041701 3300053162 Bacteria 2229
306 Ga0500636_0199834 3300053177 Bacteria 1058
307 Ga0500645_002665 3300053730 Bacteria 7776
308 Ga0500645_081897 3300053730 Bacteria 920
309 Ga0501084_0196105 3300054114 Bacteria 1704
310 Ga0501082_0050903 3300060353 Bacteria 3571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0527531 Ga0501039_0527531_16_609 186
2 3300005549 Ga0070704_100444041 Ga0070704_1004440411 190
3 3300003794 Ga0055531_10001692 Ga0055531_1000169212 202
4 3300050515 nmdc:mga0a205_931613_c1 nmdc:mga0a205_931613_c1_38_691 203
5 3300053096 Ga0500641_0245539 Ga0500641_0245539_26_685 208
6 3300053109 Ga0500569_107031 Ga0500569_107031_228_887 208
7 3300053158 Ga0500627_0001883 Ga0500627_0001883_17_676 208
8 3300046690 Ga0495624_0178625 Ga0495624_0178625_261_923 209
9 3300031548 Ga0307408_100010012 Ga0307408_1000100122 215
10 3300031901 Ga0307406_10000594 Ga0307406_1000059417 215
11 3300053730 Ga0500645_081897 Ga0500645_081897_123_824 216
12 3300031824 Ga0307413_10494850 Ga0307413_104948502 219
13 3300031852 Ga0307410_10017580 Ga0307410_100175804 219
14 3300031903 Ga0307407_10048325 Ga0307407_100483252 219
15 3300031995 Ga0307409_100002515 Ga0307409_1000025152 219
16 3300032002 Ga0307416_100011232 Ga0307416_1000112323 219
17 3300032005 Ga0307411_10146584 Ga0307411_101465842 219
18 3300032126 Ga0307415_100190926 Ga0307415_1001909262 219
19 iso_pu_bacteria 2513237166 2514053544 219
20 iso_pu_bacteria 2562617112 2563064816 219
21 iso_pu_bacteria 2711768613 2713482195 219
22 iso_pu_bacteria 2904456579 2904461417 219
23 iso_pu_bacteria 2921643360 2921646471 219
24 iso_pu_bacteria 2928084124 2928086781 219
25 iso_pu_bacteria 2929520902 2929524315 219
26 iso_pu_bacteria 2945972063 2945972390 219
27 3300006844 Ga0075428_100000048 Ga0075428_10000004831 221
28 3300006846 Ga0075430_100001285 Ga0075430_10000128513 221
29 3300006847 Ga0075431_100000554 Ga0075431_10000055420 221
30 3300006880 Ga0075429_100001225 Ga0075429_1000012254 221
31 3300009147 Ga0114129_10000521 Ga0114129_1000052119 221
32 3300050507 nmdc:mga05p37_3969_c1 nmdc:mga05p37_3969_c1_11403_12152 221
33 3300050508 nmdc:mga09592_35783_c1 nmdc:mga09592_35783_c1_3021_3770 221
34 3300050509 nmdc:mga0qj67_791_c1 nmdc:mga0qj67_791_c1_20713_21462 221
35 3300050510 nmdc:mga06r32_652_c1 nmdc:mga06r32_652_c1_3461_4210 221
36 3300005330 Ga0070690_100341175 Ga0070690_1003411751 222
37 3300005336 Ga0070680_100359283 Ga0070680_1003592831 222
38 3300005444 Ga0070694_100649611 Ga0070694_1006496111 222
39 3300005468 Ga0070707_100000111 Ga0070707_10000011167 222
40 3300005518 Ga0070699_100247501 Ga0070699_1002475011 222
41 3300005536 Ga0070697_100025101 Ga0070697_1000251015 222
42 3300005536 Ga0070697_100395440 Ga0070697_1003954401 222
43 3300005545 Ga0070695_100082382 Ga0070695_1000823822 222
44 3300005841 Ga0068863_100272418 Ga0068863_1002724182 222
45 3300006844 Ga0075428_100209939 Ga0075428_1002099392 222
46 3300006846 Ga0075430_100012097 Ga0075430_1000120975 222
47 3300006852 Ga0075433_10139189 Ga0075433_101391891 222
48 3300006871 Ga0075434_100119517 Ga0075434_1001195173 222
49 3300006880 Ga0075429_100000770 Ga0075429_10000077023 222
50 3300009147 Ga0114129_10070013 Ga0114129_100700131 222
51 3300009147 Ga0114129_10187159 Ga0114129_101871592 222
52 3300025910 Ga0207684_10040917 Ga0207684_100409173 222
53 3300025912 Ga0207707_10216510 Ga0207707_102165101 222
54 3300025917 Ga0207660_10332281 Ga0207660_103322811 222
55 3300025922 Ga0207646_10000163 Ga0207646_1000016369 222
56 3300026118 Ga0207675_100819956 Ga0207675_1008199562 222
57 3300031235 Ga0265330_10200861 Ga0265330_102008611 222
58 3300031247 Ga0265340_10071144 Ga0265340_100711442 222
59 3300031711 Ga0265314_10002436 Ga0265314_100024368 222
60 3300048910 Ga0496107_0436682 Ga0496107_0436682_13_702 222
61 3300048917 Ga0496114_0922513 Ga0496114_0922513_46_735 222
62 3300050508 nmdc:mga09592_5504_c1 nmdc:mga09592_5504_c1_2602_3351 222
63 3300050509 nmdc:mga0qj67_12648_c1 nmdc:mga0qj67_12648_c1_622_1371 222
64 3300050510 nmdc:mga06r32_2580_c1 nmdc:mga06r32_2580_c1_634_1383 222
65 3300050514 nmdc:mga08x19_257315_c1 nmdc:mga08x19_257315_c1_54_764 222
66 3300050515 nmdc:mga0a205_30029_c1 nmdc:mga0a205_30029_c1_3276_3986 222
67 3300053093 Ga0500651_0288082 Ga0500651_0288082_98_787 222
68 3300054114 Ga0501084_0196105 Ga0501084_0196105_978_1688 222
69 3300003316 rootH1_10000260 rootH1_100002602 223
70 3300003322 rootL2_10123108 rootL2_101231086 223
71 3300003323 rootH1_10265892 rootH1_102658922 223
72 3300003354 JGI25160J50197_1000039 JGI25160J50197_100003983 223
73 3300003792 Ga0055540_1000851 Ga0055540_100085119 223
74 3300005262 Ga0065165_1000770 Ga0065165_100077031 223
75 3300005456 Ga0070678_100016771 Ga0070678_1000167712 223
76 3300005467 Ga0070706_100346197 Ga0070706_1003461972 223
77 3300005536 Ga0070697_100623704 Ga0070697_1006237042 223
78 3300005539 Ga0068853_100073668 Ga0068853_1000736683 223
79 3300005548 Ga0070665_100336175 Ga0070665_1003361752 223
80 3300005548 Ga0070665_100430265 Ga0070665_1004302652 223
81 3300005616 Ga0068852_100224977 Ga0068852_1002249772 223
82 3300006038 Ga0075365_10210488 Ga0075365_102104882 223
83 3300006048 Ga0075363_100021550 Ga0075363_1000215504 223
84 3300006048 Ga0075363_100111511 Ga0075363_1001115112 223
85 3300006177 Ga0075362_10000630 Ga0075362_100006307 223
86 3300006178 Ga0075367_10018112 Ga0075367_100181124 223
87 3300006186 Ga0075369_10000545 Ga0075369_100005453 223
88 3300006844 Ga0075428_100376950 Ga0075428_1003769501 223
89 3300006847 Ga0075431_100008254 Ga0075431_1000082549 223
90 3300006880 Ga0075429_100240187 Ga0075429_1002401872 223
91 3300007265 Ga0099794_10090307 Ga0099794_100903071 223
92 3300009036 Ga0105244_10013804 Ga0105244_100138042 223
93 3300009093 Ga0105240_10005714 Ga0105240_100057144 223
94 3300009147 Ga0114129_10011798 Ga0114129_100117987 223
95 3300009177 Ga0105248_10001760 Ga0105248_100017607 223
96 3300009177 Ga0105248_10108791 Ga0105248_101087914 223
97 3300009177 Ga0105248_10302626 Ga0105248_103026262 223
98 3300009545 Ga0105237_10001166 Ga0105237_1000116619 223
99 3300009551 Ga0105238_10001264 Ga0105238_1000126425 223
100 3300010159 Ga0099796_10013029 Ga0099796_100130292 223
101 3300010375 Ga0105239_10002608 Ga0105239_1000260819 223
102 3300011119 Ga0105246_10008555 Ga0105246_100085552 223
103 3300015265 Ga0182005_1096028 Ga0182005_10960281 223
104 3300017792 Ga0163161_10033737 Ga0163161_100337374 223
105 3300017792 Ga0163161_10217869 Ga0163161_102178692 223
106 3300021441 Ga0213871_10097052 Ga0213871_100970521 223
107 3300025284 Ga0209130_1015299 Ga0209130_10152993 223
108 3300025295 Ga0209564_1010370 Ga0209564_10103704 223
109 3300025302 Ga0207426_1000018 Ga0207426_1000018151 223
110 3300025303 Ga0209051_1000178 Ga0209051_100017861 223
111 3300025728 Ga0207655_1069613 Ga0207655_10696132 223
112 3300025913 Ga0207695_10003519 Ga0207695_1000351916 223
113 3300025914 Ga0207671_10007523 Ga0207671_100075232 223
114 3300025933 Ga0207706_10065019 Ga0207706_100650193 223
115 3300025941 Ga0207711_10019846 Ga0207711_100198462 223
116 3300025941 Ga0207711_10252676 Ga0207711_102526762 223
117 3300026095 Ga0207676_10611728 Ga0207676_106117282 223
118 3300026121 Ga0207683_10040956 Ga0207683_100409565 223
119 3300031456 Ga0307513_10212546 Ga0307513_102125462 223
120 3300031649 Ga0307514_10035390 Ga0307514_100353902 223
121 3300031649 Ga0307514_10279172 Ga0307514_102791721 223
122 3300032005 Ga0307411_10315078 Ga0307411_103150782 223
123 3300035695 Ga0373927_0054190 Ga0373927_0054190_1654_2358 223
124 3300035725 Ga0373947_0089748 Ga0373947_0089748_423_1127 223
125 3300037068 Ga0373925_0190934 Ga0373925_0190934_526_1230 223
126 3300039438 Ga0436360_0796445 Ga0436360_0796445_40_744 223
127 3300041411 Ga0439466_0047951 Ga0439466_0047951_380_1084 223
128 3300046453 Ga0495627_022011 Ga0495627_022011_163_867 223
129 3300046455 Ga0495603_0051320 Ga0495603_0051320_1040_1744 223
130 3300046472 Ga0495580_0168532 Ga0495580_0168532_512_1216 223
131 3300046474 Ga0495605_0021030 Ga0495605_0021030_1403_2107 223
132 3300046506 Ga0495583_0019049 Ga0495583_0019049_275_979 223
133 3300046512 Ga0495610_0100134 Ga0495610_0100134_309_1013 223
134 3300046513 Ga0495616_0002803 Ga0495616_0002803_10116_10820 223
135 3300046513 Ga0495616_0024346 Ga0495616_0024346_822_1526 223
136 3300046518 Ga0495631_0000082 Ga0495631_0000082_46015_46719 223
137 3300046530 Ga0495654_0123210 Ga0495654_0123210_92_796 223
138 3300046531 Ga0495665_0010969 Ga0495665_0010969_1669_2373 223
139 3300046539 Ga0495621_0017105 Ga0495621_0017105_940_1644 223
140 3300046557 Ga0495622_0019640 Ga0495622_0019640_2304_3008 223
141 3300046557 Ga0495622_0083653 Ga0495622_0083653_402_1106 223
142 3300046558 Ga0495633_0092327 Ga0495633_0092327_210_914 223
143 3300046665 Ga0495661_0070357 Ga0495661_0070357_925_1629 223
144 3300046674 Ga0495588_0112444 Ga0495588_0112444_107_811 223
145 3300046680 Ga0495646_0309030 Ga0495646_0309030_96_800 223
146 3300046690 Ga0495624_0029802 Ga0495624_0029802_2093_2797 223
147 3300046692 Ga0495671_0000944 Ga0495671_0000944_3183_3887 223
148 3300046694 Ga0495649_0094012 Ga0495649_0094012_95_799 223
149 3300046810 Ga0495660_0037315 Ga0495660_0037315_1172_1876 223
150 3300047319 Ga0495674_0005629 Ga0495674_0005629_189_893 223
151 3300047321 Ga0495676_0014842 Ga0495676_0014842_2108_2812 223
152 3300047323 Ga0495683_0072574 Ga0495683_0072574_108_812 223
153 3300047443 Ga0495687_011726 Ga0495687_011726_173_877 223
154 3300047469 Ga0495673_0028475 Ga0495673_0028475_506_1210 223
155 3300047472 Ga0495686_0007369 Ga0495686_0007369_4654_5358 223
156 3300047673 Ga0495593_0004769 Ga0495593_0004769_4712_5416 223
157 3300048088 Ga0495602_0091651 Ga0495602_0091651_1339_2043 223
158 3300048089 Ga0495614_0044089 Ga0495614_0044089_573_1277 223
159 3300048091 Ga0495626_0026375 Ga0495626_0026375_709_1413 223
160 3300048903 Ga0496100_0000042 Ga0496100_0000042_76246_76950 223
161 3300048903 Ga0496100_0305568 Ga0496100_0305568_246_950 223
162 3300048904 Ga0496101_0004818 Ga0496101_0004818_3589_4293 223
163 3300048904 Ga0496101_0099275 Ga0496101_0099275_1198_1902 223
164 3300048905 Ga0496102_0000326 Ga0496102_0000326_20335_21039 223
165 3300048906 Ga0496103_0000615 Ga0496103_0000615_22985_23689 223
166 3300048907 Ga0496104_0014117 Ga0496104_0014117_286_990 223
167 3300048907 Ga0496104_0367265 Ga0496104_0367265_473_1177 223
168 3300048908 Ga0496105_0054264 Ga0496105_0054264_1091_1795 223
169 3300048909 Ga0496106_0035040 Ga0496106_0035040_2561_3265 223
170 3300048910 Ga0496107_0437223 Ga0496107_0437223_150_854 223
171 3300048915 Ga0496112_0081148 Ga0496112_0081148_1103_1807 223
172 3300048917 Ga0496114_0900282 Ga0496114_0900282_41_745 223
173 3300048918 Ga0496115_0065816 Ga0496115_0065816_60_767 223
174 3300048919 Ga0496116_0076788 Ga0496116_0076788_1357_2061 223
175 3300048920 Ga0496117_0000221 Ga0496117_0000221_8417_9121 223
176 3300048921 Ga0496118_0000107 Ga0496118_0000107_105496_106200 223
177 3300048922 Ga0496119_0073769 Ga0496119_0073769_960_1664 223
178 3300048924 Ga0496121_0000256 Ga0496121_0000256_95167_95871 223
179 3300048924 Ga0496121_0006589 Ga0496121_0006589_118_822 223
180 3300048925 Ga0496122_0000380 Ga0496122_0000380_82368_83072 223
181 3300048926 Ga0496123_0000246 Ga0496123_0000246_27008_27712 223
182 3300048926 Ga0496123_0030395 Ga0496123_0030395_3091_3795 223
183 3300048926 Ga0496123_0258264 Ga0496123_0258264_28_732 223
184 3300048927 Ga0496124_0131070 Ga0496124_0131070_576_1280 223
185 3300048928 Ga0496125_0097648 Ga0496125_0097648_156_860 223
186 3300048928 Ga0496125_0137412 Ga0496125_0137412_762_1466 223
187 3300048928 Ga0496125_0171003 Ga0496125_0171003_443_1147 223
188 3300048929 Ga0496126_0023010 Ga0496126_0023010_2007_2714 223
189 3300048929 Ga0496126_0206407 Ga0496126_0206407_738_1442 223
190 3300049460 Ga0495682_0036477 Ga0495682_0036477_937_1641 223
191 3300049590 Ga0501074_0204850 Ga0501074_0204850_478_1182 223
192 3300050489 nmdc:mga03683_1124_c1 nmdc:mga03683_1124_c1_1950_2654 223
193 3300050489 nmdc:mga03683_1343_c1 nmdc:mga03683_1343_c1_4169_4873 223
194 3300050490 nmdc:mga03n38_2363_c1 nmdc:mga03n38_2363_c1_2089_2793 223
195 3300050492 nmdc:mga0yw44_242933_c1 nmdc:mga0yw44_242933_c1_296_1000 223
196 3300050494 nmdc:mga06z11_3079_c1 nmdc:mga06z11_3079_c1_357_1061 223
197 3300050508 nmdc:mga09592_97180_c1 nmdc:mga09592_97180_c1_1650_2354 223
198 3300050510 nmdc:mga06r32_73105_c1 nmdc:mga06r32_73105_c1_1679_2383 223
199 3300050516 nmdc:mga0sz30_54856_c1 nmdc:mga0sz30_54856_c1_498_1202 223
200 3300050516 nmdc:mga0sz30_637_c1 nmdc:mga0sz30_637_c1_2422_3126 223
201 3300053086 Ga0500578_0031733 Ga0500578_0031733_360_1064 223
202 3300053093 Ga0500651_0001107 Ga0500651_0001107_5329_6033 223
203 3300053093 Ga0500651_0155498 Ga0500651_0155498_15_719 223
204 3300053107 Ga0500560_029821 Ga0500560_029821_912_1616 223
205 3300053108 Ga0500562_009241 Ga0500562_009241_1174_1878 223
206 3300053110 Ga0500571_000039 Ga0500571_000039_15274_15978 223
207 3300053117 Ga0500593_000221 Ga0500593_000221_8265_8969 223
208 3300053118 Ga0500594_0000819 Ga0500594_0000819_992_1696 223
209 3300053120 Ga0500597_011880 Ga0500597_011880_2153_2857 223
210 3300053121 Ga0500607_001070 Ga0500607_001070_17220_17924 223
211 3300053122 Ga0500608_004888 Ga0500608_004888_3541_4245 223
212 3300053122 Ga0500608_229107 Ga0500608_229107_20_724 223
213 3300053125 Ga0500618_046956 Ga0500618_046956_166_870 223
214 3300053128 Ga0500626_008830 Ga0500626_008830_2458_3162 223
215 3300053133 Ga0500655_000415 Ga0500655_000415_3929_4633 223
216 3300053134 Ga0500658_0001361 Ga0500658_0001361_2791_3495 223
217 3300053134 Ga0500658_0001571 Ga0500658_0001571_2523_3227 223
218 3300053136 Ga0500559_0009619 Ga0500559_0009619_1868_2572 223
219 3300053138 Ga0500564_001576 Ga0500564_001576_1329_2033 223
220 3300053141 Ga0500574_035153 Ga0500574_035153_175_879 223
221 3300053160 Ga0500633_0150194 Ga0500633_0150194_77_781 223
222 3300053161 Ga0500634_0011466 Ga0500634_0011466_975_1679 223
223 3300053161 Ga0500634_0020736 Ga0500634_0020736_2534_3238 223
224 3300053162 Ga0500638_041701 Ga0500638_041701_933_1637 223
225 3300053177 Ga0500636_0199834 Ga0500636_0199834_152_856 223
226 3300053730 Ga0500645_002665 Ga0500645_002665_3100_3804 223
227 3300025292 Ga0209676_1000743 Ga0209676_100074345 224
228 3300025292 Ga0209676_1012944 Ga0209676_10129443 224
229 3300025294 Ga0209025_1004027 Ga0209025_100402714 224
230 3300025913 Ga0207695_10040855 Ga0207695_100408554 224
231 3300039438 Ga0436360_0837218 Ga0436360_0837218_289_984 224
232 3300039438 Ga0436360_1298689 Ga0436360_1298689_294_1001 224
233 3300039447 Ga0436361_0931668 Ga0436361_0931668_247_954 224
234 3300053117 Ga0500593_017606 Ga0500593_017606_2063_2758 224
235 3300035691 Ga0373931_0537326 Ga0373931_0537326_28_738 225
236 3300037312 Ga0395899_0108330 Ga0395899_0108330_239_943 225
237 3300037418 Ga0395900_0057325 Ga0395900_0057325_2124_2828 225
238 3300037466 Ga0395898_0064017 Ga0395898_0064017_551_1255 225
239 3300037471 Ga0395905_0079249 Ga0395905_0079249_2139_2843 225
240 3300038443 Ga0395901_0033814 Ga0395901_0033814_646_1350 225
241 3300049575 Ga0501039_0187404 Ga0501039_0187404_14_724 225
242 3300049576 Ga0501040_0045569 Ga0501040_0045569_28_738 225
243 3300049577 Ga0501041_0025349 Ga0501041_0025349_1197_1907 225
244 3300049584 Ga0501068_0124340 Ga0501068_0124340_49_759 225
245 3300049588 Ga0501072_0082571 Ga0501072_0082571_471_1181 225
246 3300049593 Ga0501077_0036348 Ga0501077_0036348_2338_3048 225
247 3300049741 Ga0501079_0112447 Ga0501079_0112447_1002_1712 225
248 3300049742 Ga0501080_0250749 Ga0501080_0250749_856_1566 225
249 3300049743 Ga0501081_0045709 Ga0501081_0045709_564_1274 225
250 3300049824 Ga0501045_0164690 Ga0501045_0164690_354_1064 225
251 3300060353 Ga0501082_0050903 Ga0501082_0050903_438_1148 225
252 3300005467 Ga0070706_100408726 Ga0070706_1004087262 226
253 3300005937 Ga0081455_10031367 Ga0081455_100313673 226
254 3300005985 Ga0081539_10026295 Ga0081539_100262953 226
255 3300025910 Ga0207684_10551427 Ga0207684_105514272 226
256 iso_pu_bacteria 2842333319 2842338250 226
257 iso_pu_bacteria 2842333319 2842339770 226
258 3300005356 Ga0070674_100105434 Ga0070674_1001054344 227
259 3300005441 Ga0070700_100287712 Ga0070700_1002877122 227
260 3300005458 Ga0070681_10513380 Ga0070681_105133801 227
261 3300005536 Ga0070697_100287011 Ga0070697_1002870112 227
262 3300005549 Ga0070704_100358566 Ga0070704_1003585661 227
263 3300013104 Ga0157370_10211193 Ga0157370_102111932 227
264 3300013105 Ga0157369_10027560 Ga0157369_100275603 227
265 3300013307 Ga0157372_10467513 Ga0157372_104675132 227
266 3300014326 Ga0157380_10135568 Ga0157380_101355683 227
267 3300025909 Ga0207705_10102465 Ga0207705_101024652 227
268 3300025912 Ga0207707_10306532 Ga0207707_103065322 227
269 3300025917 Ga0207660_10314600 Ga0207660_103146001 227
270 3300025921 Ga0207652_10245182 Ga0207652_102451822 227
271 3300025937 Ga0207669_10070985 Ga0207669_100709852 227
272 3300025938 Ga0207704_10157889 Ga0207704_101578892 227
273 3300026075 Ga0207708_10345512 Ga0207708_103455122 227
274 3300041413 Ga0439465_0064685 Ga0439465_0064685_20_703 227
275 3300048915 Ga0496112_0518111 Ga0496112_0518111_219_932 227
276 3300025972 Ga0207668_10503473 Ga0207668_105034731 228
277 3300037471 Ga0395905_0001205 Ga0395905_0001205_10188_10901 228
278 3300049588 Ga0501072_0021516 Ga0501072_0021516_1641_2402 228
279 3300039438 Ga0436360_0076367 Ga0436360_0076367_1522_2247 229
280 3300006846 Ga0075430_100280084 Ga0075430_1002800842 230
281 3300009094 Ga0111539_10567455 Ga0111539_105674551 230
282 3300031911 Ga0307412_10863601 Ga0307412_108636011 230
283 3300031995 Ga0307409_100527227 Ga0307409_1005272272 230
284 3300032005 Ga0307411_10402991 Ga0307411_104029912 230
285 3300041407 Ga0439447_011411 Ga0439447_011411_861_1553 230
286 3300050509 nmdc:mga0qj67_335113_c1 nmdc:mga0qj67_335113_c1_509_1201 230
287 iso_pu_bacteria 2509276021 2509386607 230
288 iso_pu_bacteria 2509276021 2509392847 230
289 iso_pu_bacteria 2524023209 2524461749 230
290 iso_pu_bacteria 2841859092 2841862997 230
291 iso_pu_bacteria 2841864319 2841866388 230
292 iso_pu_bacteria 2842298080 2842303223 230
293 iso_pu_bacteria 2842515876 2842519486 230
294 iso_pu_bacteria 2933011516 2933016691 230
295 iso_pu_bacteria 2933594066 2933598693 230
296 iso_pu_bacteria 2513237159 2513998702 231
297 iso_pu_bacteria 2643221610 2644068960 231
298 iso_pu_bacteria 2643221675 2644420031 231
299 iso_pu_bacteria 2643221680 2644453438 231
300 iso_pu_bacteria 2643221726 2644692137 231
301 iso_pu_bacteria 2791355094 2792643836 231
302 iso_pu_bacteria 2838729681 2838733548 231
303 iso_pu_bacteria 2838742623 2838746218 231
304 iso_pu_bacteria 2841851746 2841858130 231
305 iso_pu_bacteria 2842229732 2842234336 231
306 iso_pu_bacteria 2842243621 2842247858 231
307 iso_pu_bacteria 2842257432 2842259453 231
308 iso_pu_bacteria 2842402390 2842408316 231
309 iso_pu_bacteria 2842409023 2842414497 231
310 iso_pu_bacteria 2842415677 2842421566 231
311 iso_pu_bacteria 2842521101 2842523918 231
312 iso_pu_bacteria 2842922631 2842926578 231
313 iso_pu_bacteria 2844454524 2844459781 231
314 iso_pu_bacteria 2855872281 2855872802 231
315 iso_pu_bacteria 2857531043 2857533241 231
316 iso_pu_bacteria 2896384573 2896385490 231
317 iso_pu_bacteria 2919171160 2919176141 231
318 iso_pu_bacteria 2921257292 2921263221 231
319 iso_pu_bacteria 2926754445 2926759979 231
320 iso_pu_bacteria 2937023124 2937024503 231
321 iso_pu_bacteria 2957382221 2957385669 231
322 iso_pu_bacteria 2957395598 2957400687 231
323 iso_pu_bacteria 2957402308 2957406035 231
324 iso_pu_bacteria 2964615318 2964620888 231
325 iso_pu_bacteria 2967755722 2967756136 231
326 iso_pu_bacteria 2970102677 2970103907 231
327 iso_pu_bacteria 8005382845 8005386716 231
328 iso_pu_bacteria 8005382845 8005386982 231
329 iso_pu_bacteria 8056875544 8056875577 231
330 3300006844 Ga0075428_100152963 Ga0075428_1001529632 233
331 3300006846 Ga0075430_100222535 Ga0075430_1002225352 233
332 3300050509 nmdc:mga0qj67_148656_c1 nmdc:mga0qj67_148656_c1_1060_1821 233
333 3300050510 nmdc:mga06r32_439790_c1 nmdc:mga06r32_439790_c1_64_825 233
334 3300053153 Ga0500616_0000533 Ga0500616_0000533_27225_27929 234
335 3300002987 JGI25159J45721_1000026 JGI25159J45721_100002619 235
336 3300003215 JGI25153J46596_10013265 JGI25153J46596_100132653 235
337 3300003354 JGI25160J50197_1000013 JGI25160J50197_100001321 235
338 3300003374 JGI25161J50226_1001386 JGI25161J50226_10013863 235
339 3300003781 Ga0055536_1004541 Ga0055536_10045415 235
340 3300003790 Ga0055528_1030281 Ga0055528_10302812 235
341 3300003791 Ga0055530_10009229 Ga0055530_100092293 235
342 3300003792 Ga0055540_1001916 Ga0055540_100191613 235
343 3300004625 Ga0055543_1000132 Ga0055543_100013220 235
344 3300005262 Ga0065165_1000021 Ga0065165_100002121 235
345 3300006946 Ga0079104_1000183 Ga0079104_100018310 235
346 3300021320 Ga0214544_1000097 Ga0214544_100009723 235
347 3300021321 Ga0214542_1019485 Ga0214542_10194855 235
348 3300021327 Ga0214543_1014631 Ga0214543_10146312 235
349 3300025208 Ga0209436_100024 Ga0209436_10002488 235
350 3300025273 Ga0209673_1000905 Ga0209673_100090511 235
351 3300025284 Ga0209130_1000039 Ga0209130_1000039237 235
352 3300025294 Ga0209025_1013152 Ga0209025_10131525 235
353 3300025297 Ga0209758_1002277 Ga0209758_10022779 235
354 3300025298 Ga0209050_1011593 Ga0209050_10115933 235
355 3300025299 Ga0209256_1008917 Ga0209256_10089172 235
356 3300025302 Ga0207426_1000099 Ga0207426_1000099237 235
357 3300025303 Ga0209051_1007619 Ga0209051_10076194 235
358 3300025304 Ga0209257_1001965 Ga0209257_10019658 235
359 3300027111 Ga0209281_1000295 Ga0209281_100029532 235
360 3300031548 Ga0307408_100158214 Ga0307408_1001582142 235
361 3300031995 Ga0307409_100405450 Ga0307409_1004054502 235
362 3300032002 Ga0307416_100480355 Ga0307416_1004803552 235
363 3300049571 Ga0501034_0047878 Ga0501034_0047878_345_1052 235
364 iso_pu_bacteria 643692032 643824808 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

169

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9122 1 235
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9085 1 235
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8958 7 235
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.893 5 224
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8914 7 233
ID Description Score Start End Superfamily
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9147 7 232 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9134 3 232 3.40.50.300
af_Q9TXV8_581_832_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9014 5 225 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9 3 225 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8993 1 235 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1B1CKP2-F1-model_v4 ABC transporter ATP-binding protein 0.9914 4 235 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1B1CKP2-F1-model_v4 ABC transporter ATP-binding protein 0.9829 4 235 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A446D123-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein LivF 0.9809 35 235 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A4R2WYG1-F1-model_v4 deleted 0.9633 111 219
AF-A0A446D123-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein LivF 0.9621 35 235 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.65 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map