F423097

General Info

Members Datasets Scaffolds Average Seq Length
363 196 347 348

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0556182|Ga0496109_0556182_138_1058
Length 306
Sequence VVDLHALTVWQDPKELPRAIREVTAAFLACGIDPGKHIVFNQSQVHEHAELAWIFNCVARLGWLNRMTQFKEKASKDRENASVGLYAYPNLMAADILVYRATHVPVGEDQKQHVELARDIAQKFNNDYADSIAAHGFGDKFFPLPEPLIQGPATRVMSLRDGTKKMSKSDPSDYTRINLTDDADAIAQKIRKAKTDPEPLPSEEAGLEKRAEADNLVGIYAALAGSPRGQVLQEFGGAQFSTFKTALVDLAVAKLAPINSELKRLTQDPLYIDSVLSNGADRARALAAETMGPVKDIVGLVRAKPH

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
3 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
4 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
5 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
6 2842694124 Methylopila sp. R-72369 Isolate Unclassified
7 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
8 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
9 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
10 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
11 2902330777 Methylobacterium sp. 2A Isolate Unclassified
12 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
13 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
14 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
15 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
92 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
93 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
94 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
175 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
176 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
179 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
185 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
189 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
196 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.59
Metatranscriptomes 0
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 0.55
Rhizoplane 4.68
Rhizosphere 77.13
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000015 3300003203 Bacteria 91406
2 Ga0070658_10069631 3300005327 Bacteria 2879
3 Ga0070676_10084212 3300005328 Bacteria 1935
4 Ga0070689_100017980 3300005340 Bacteria 5199
5 Ga0070668_100040468 3300005347 Bacteria 3567
6 Ga0070671_100101423 3300005355 Bacteria 2415
7 Ga0070673_100128671 3300005364 Bacteria 2122
8 Ga0070705_100143900 3300005440 Bacteria 1573
9 Ga0070708_100086619 3300005445 Bacteria 2845
10 Ga0070707_100028707 3300005468 Bacteria 5295
11 Ga0070707_100063303 3300005468 Bacteria 3550
12 Ga0070698_100118728 3300005471 Bacteria 2606
13 Ga0070699_100092981 3300005518 Bacteria 2638
14 Ga0070684_100031381 3300005535 Bacteria 4523
15 Ga0068853_100100314 3300005539 Bacteria 2559
16 Ga0070696_100034785 3300005546 Bacteria 3467
17 Ga0070665_100176867 3300005548 Bacteria 2135
18 Ga0068862_100231785 3300005844 Bacteria 1676
19 Ga0081455_10010887 3300005937 Bacteria 9179
20 Ga0081539_10000064 3300005985 Bacteria 247020
21 Ga0081539_10145436 3300005985 Bacteria 1147
22 Ga0070717_10165424 3300006028 Bacteria 1921
23 Ga0075369_10004154 3300006186 Bacteria 5329
24 Ga0075366_10064588 3300006195 Bacteria 2177
25 Ga0075428_100003706 3300006844 Bacteria 16735
26 Ga0075428_100155652 3300006844 Bacteria 2483
27 Ga0075431_100000880 3300006847 Bacteria 26403
28 Ga0075431_100003945 3300006847 Bacteria 14448
29 Ga0075434_100033742 3300006871 Bacteria 5052
30 Ga0075434_100046728 3300006871 Bacteria 4295
31 Ga0075434_100244478 3300006871 Bacteria 1814
32 Ga0075429_100010871 3300006880 Bacteria 7872
33 Ga0075435_100074695 3300007076 Bacteria 2774
34 Ga0075435_100301905 3300007076 Bacteria 1369
35 Ga0111539_10000367 3300009094 Bacteria 55719
36 Ga0114129_10000825 3300009147 Bacteria 40003
37 Ga0114129_10024059 3300009147 Bacteria 8630
38 Ga0114129_10246205 3300009147 Bacteria 2401
39 Ga0114129_10304110 3300009147 Bacteria 2124
40 Ga0105238_10065513 3300009551 Bacteria 3634
41 Ga0163161_10167956 3300017792 Bacteria 1676
42 Ga0213876_10159558 3300021384 Bacteria 1200
43 Ga0209564_1000747 3300025295 Bacteria 46025
44 Ga0209564_1015863 3300025295 Bacteria 3040
45 Ga0209758_1009490 3300025297 Bacteria 6036
46 Ga0207688_10089437 3300025901 Bacteria 1767
47 Ga0207688_10127836 3300025901 Bacteria 1488
48 Ga0207645_10090899 3300025907 Bacteria 1963
49 Ga0207705_10037866 3300025909 Bacteria 3451
50 Ga0207684_10002963 3300025910 Bacteria 16822
51 Ga0207707_10138984 3300025912 Bacteria 2124
52 Ga0207693_10021699 3300025915 Bacteria 5104
53 Ga0207646_10023492 3300025922 Bacteria 5662
54 Ga0207694_10032544 3300025924 Bacteria 3992
55 Ga0207659_10056294 3300025926 Bacteria 2816
56 Ga0207664_10312990 3300025929 Bacteria 1384
57 Ga0207644_10132797 3300025931 Bacteria 1908
58 Ga0207706_10068695 3300025933 Bacteria 3117
59 Ga0207704_10023025 3300025938 Bacteria 3350
60 Ga0207678_10163461 3300026067 Bacteria 1901
61 Ga0207698_10298778 3300026142 Bacteria 1498
62 Ga0209813_10009912 3300027866 Bacteria 2451
63 Ga0207428_10009855 3300027907 Bacteria 8556
64 Ga0268264_10122135 3300028381 Bacteria 2297
65 Ga0265318_10004032 3300028577 Bacteria 7212
66 Ga0265330_10023870 3300031235 Bacteria 2774
67 Ga0265330_10087680 3300031235 Bacteria 1337
68 Ga0265328_10025163 3300031239 Bacteria 2243
69 Ga0265320_10032503 3300031240 Bacteria 2669
70 Ga0265325_10004992 3300031241 Bacteria 8267
71 Ga0265325_10011842 3300031241 Bacteria 5001
72 Ga0265340_10001851 3300031247 Bacteria 12075
73 Ga0265340_10007893 3300031247 Bacteria 5769
74 Ga0265339_10004942 3300031249 Bacteria 8980
75 Ga0265339_10019418 3300031249 Bacteria 3990
76 Ga0265339_10034305 3300031249 Bacteria 2852
77 Ga0265316_10011480 3300031344 Bacteria 7984
78 Ga0265316_10012572 3300031344 Bacteria 7582
79 Ga0265316_10017598 3300031344 Bacteria 6169
80 Ga0265316_10268777 3300031344 Bacteria 1248
81 Ga0265313_10001338 3300031595 Bacteria 23213
82 Ga0265313_10037233 3300031595 Bacteria 2435
83 Ga0265314_10002395 3300031711 Bacteria 19280
84 Ga0265314_10028650 3300031711 Bacteria 4150
85 Ga0265314_10102544 3300031711 Bacteria 1836
86 Ga0265314_10110490 3300031711 Bacteria 1747
87 Ga0265342_10001917 3300031712 Bacteria 18681
88 Ga0265342_10078701 3300031712 Bacteria 1908
89 Ga0373929_0006822 3300035085 Bacteria 2073
90 Ga0373931_0072404 3300035691 Bacteria 1884
91 Ga0373935_0169321 3300035692 Bacteria 1493
92 Ga0373947_0179008 3300035725 Bacteria 1379
93 Ga0316582_0029234 3300036647 Bacteria 3347
94 Ga0373925_0070467 3300037068 Bacteria 2643
95 Ga0395899_0020394 3300037312 Bacteria 5026
96 Ga0395900_0119391 3300037418 Bacteria 2706
97 Ga0395900_0180984 3300037418 Bacteria 2142
98 Ga0395898_0034160 3300037466 Bacteria 5070
99 Ga0395898_0170238 3300037466 Bacteria 2082
100 Ga0436364_1420296 3300037853 Bacteria 2730
101 Ga0395901_0057900 3300038443 Bacteria 4030
102 Ga0436361_0950726 3300039447 Bacteria 11725
103 Ga0439453_0011435 3300041408 Bacteria 1480
104 Ga0439466_0010593 3300041411 Bacteria 3427
105 Ga0439443_000459 3300042003 Bacteria 3599
106 Ga0439451_024633 3300042009 Bacteria 1212
107 Ga0466965_0116505 3300044683 Bacteria 1377
108 Ga0466959_0044992 3300045049 Bacteria 3252
109 Ga0495638_0008895 3300046460 Bacteria 7082
110 Ga0495638_0016972 3300046460 Bacteria 4866
111 Ga0495638_0082262 3300046460 Bacteria 1953
112 Ga0495651_0072508 3300046462 Bacteria 2616
113 Ga0495596_0070398 3300046500 Bacteria 1359
114 Ga0495606_0001109 3300046507 Bacteria 38467
115 Ga0495643_0145050 3300046522 Bacteria 1180
116 Ga0495648_0050846 3300046524 Bacteria 2529
117 Ga0495640_0044914 3300046533 Bacteria 3068
118 Ga0495598_0085511 3300046537 Bacteria 1019
119 Ga0495622_0005955 3300046557 Bacteria 5667
120 Ga0495661_0011215 3300046665 Bacteria 6081
121 Ga0496100_0035058 3300048903 Bacteria 3154
122 Ga0496104_0003329 3300048907 Bacteria 13872
123 Ga0496104_0085992 3300048907 Bacteria 3002
124 Ga0496104_0199306 3300048907 Bacteria 1914
125 Ga0496105_0000132 3300048908 Bacteria 50105
126 Ga0496105_0001618 3300048908 Bacteria 15993
127 Ga0496106_0050185 3300048909 Bacteria 3144
128 Ga0496107_0132447 3300048910 Bacteria 1841
129 Ga0496109_0104872 3300048912 Bacteria 2625
130 Ga0496109_0556182 3300048912 Bacteria 1082
131 Ga0496110_0004787 3300048913 Bacteria 10541
132 Ga0496110_0018162 3300048913 Bacteria 5892
133 Ga0496111_0270388 3300048914 Bacteria 1261
134 Ga0496112_0000015 3300048915 Bacteria 206423
135 Ga0496112_0004042 3300048915 Bacteria 12307
136 Ga0496113_0017183 3300048916 Bacteria 5016
137 Ga0496116_0020259 3300048919 Bacteria 5057
138 Ga0496117_0081231 3300048920 Bacteria 2128
139 Ga0496118_0018482 3300048921 Bacteria 6288
140 Ga0496118_0031703 3300048921 Bacteria 4374
141 Ga0496118_0033796 3300048921 Bacteria 4187
142 Ga0496119_0005517 3300048922 Bacteria 12070
143 Ga0496119_0036301 3300048922 Bacteria 3219
144 Ga0496121_0009514 3300048924 Bacteria 11148
145 Ga0496121_0259016 3300048924 Bacteria 1202
146 Ga0496122_0019688 3300048925 Bacteria 6150
147 Ga0496123_0022461 3300048926 Bacteria 4860
148 Ga0496124_0033566 3300048927 Bacteria 4514
149 Ga0496125_0000843 3300048928 Bacteria 49244
150 Ga0496125_0018319 3300048928 Bacteria 6653
151 Ga0496125_0050432 3300048928 Bacteria 3446
152 Ga0496126_0054765 3300048929 Bacteria 3611
153 Ga0501031_0000343 3300049568 Bacteria 27051
154 Ga0501031_0006892 3300049568 Bacteria 7414
155 Ga0501032_0000165 3300049569 Bacteria 53852
156 Ga0501032_0016789 3300049569 Bacteria 5144
157 Ga0501033_0000298 3300049570 Bacteria 47634
158 Ga0501033_0004277 3300049570 Bacteria 11477
159 Ga0501033_0010676 3300049570 Bacteria 7037
160 Ga0501033_0025076 3300049570 Bacteria 4493
161 Ga0501033_0101706 3300049570 Bacteria 2096
162 Ga0501034_0000058 3300049571 Bacteria 198554
163 Ga0501034_0021249 3300049571 Bacteria 6618
164 Ga0501034_0029842 3300049571 Bacteria 5542
165 Ga0501034_0030938 3300049571 Bacteria 5439
166 Ga0501034_0041146 3300049571 Bacteria 4675
167 Ga0501034_0079359 3300049571 Bacteria 3286
168 Ga0501034_0096644 3300049571 Bacteria 2949
169 Ga0501034_0102571 3300049571 Bacteria 2854
170 Ga0501034_0163560 3300049571 Bacteria 2195
171 Ga0501034_0179048 3300049571 Bacteria 2085
172 Ga0501034_0295755 3300049571 Bacteria 1556
173 Ga0501036_0000140 3300049572 Bacteria 46564
174 Ga0501036_0000939 3300049572 Bacteria 21877
175 Ga0501036_0016258 3300049572 Bacteria 6215
176 Ga0501036_0024496 3300049572 Bacteria 5088
177 Ga0501036_0037480 3300049572 Bacteria 4101
178 Ga0501036_0048315 3300049572 Bacteria 3603
179 Ga0501037_0000078 3300049573 Bacteria 90398
180 Ga0501037_0003451 3300049573 Bacteria 11485
181 Ga0501037_0004338 3300049573 Bacteria 10294
182 Ga0501037_0012047 3300049573 Bacteria 6367
183 Ga0501037_0017846 3300049573 Bacteria 5224
184 Ga0501037_0084854 3300049573 Bacteria 2293
185 Ga0501037_0166738 3300049573 Bacteria 1568
186 Ga0501037_0241331 3300049573 Bacteria 1266
187 Ga0501038_0000050 3300049574 Bacteria 99270
188 Ga0501038_0004381 3300049574 Bacteria 13129
189 Ga0501038_0006258 3300049574 Bacteria 11003
190 Ga0501038_0054615 3300049574 Bacteria 3435
191 Ga0501038_0058433 3300049574 Bacteria 3307
192 Ga0501038_0060975 3300049574 Bacteria 3226
193 Ga0501038_0104353 3300049574 Bacteria 2356
194 Ga0501038_0145012 3300049574 Bacteria 1939
195 Ga0501038_0161213 3300049574 Bacteria 1822
196 Ga0501039_0000078 3300049575 Bacteria 73768
197 Ga0501039_0005279 3300049575 Bacteria 9773
198 Ga0501039_0013808 3300049575 Bacteria 6178
199 Ga0501039_0036634 3300049575 Bacteria 3786
200 Ga0501039_0080481 3300049575 Bacteria 2535
201 Ga0501039_0249597 3300049575 Bacteria 1395
202 Ga0501040_0005780 3300049576 Bacteria 8008
203 Ga0501040_0013468 3300049576 Bacteria 5375
204 Ga0501041_0026249 3300049577 Bacteria 3503
205 Ga0501041_0030297 3300049577 Bacteria 3266
206 Ga0501042_0073187 3300049578 Bacteria 2451
207 Ga0501043_0001206 3300049579 Bacteria 22752
208 Ga0501043_0002964 3300049579 Bacteria 14143
209 Ga0501043_0020485 3300049579 Bacteria 5188
210 Ga0501043_0030669 3300049579 Bacteria 4227
211 Ga0501043_0057647 3300049579 Bacteria 3049
212 Ga0501043_0061301 3300049579 Bacteria 2954
213 Ga0501043_0150815 3300049579 Bacteria 1819
214 Ga0501043_0156148 3300049579 Bacteria 1784
215 Ga0501046_0000893 3300049580 Bacteria 29084
216 Ga0501046_0018035 3300049580 Bacteria 5882
217 Ga0501046_0021920 3300049580 Bacteria 5265
218 Ga0501046_0095754 3300049580 Bacteria 2280
219 Ga0501046_0189456 3300049580 Bacteria 1535
220 Ga0501047_0000108 3300049581 Bacteria 101252
221 Ga0501047_0006240 3300049581 Bacteria 11207
222 Ga0501047_0019740 3300049581 Bacteria 6468
223 Ga0501047_0026634 3300049581 Bacteria 5564
224 Ga0501047_0141383 3300049581 Bacteria 2285
225 Ga0501047_0158877 3300049581 Bacteria 2132
226 Ga0501047_0165309 3300049581 Bacteria 2083
227 Ga0501047_0290715 3300049581 Bacteria 1478
228 Ga0501047_0322547 3300049581 Bacteria 1384
229 Ga0501048_0000493 3300049582 Bacteria 27551
230 Ga0501048_0015632 3300049582 Bacteria 5601
231 Ga0501048_0065580 3300049582 Bacteria 2567
232 Ga0501067_0000237 3300049583 Bacteria 30588
233 Ga0501067_0002497 3300049583 Bacteria 10165
234 Ga0501067_0083765 3300049583 Bacteria 1769
235 Ga0501068_0000217 3300049584 Bacteria 27865
236 Ga0501068_0023223 3300049584 Bacteria 3633
237 Ga0501068_0060153 3300049584 Bacteria 2306
238 Ga0501068_0153571 3300049584 Bacteria 1448
239 Ga0501068_0202424 3300049584 Bacteria 1259
240 Ga0501069_0014788 3300049585 Bacteria 4176
241 Ga0501069_0094481 3300049585 Bacteria 1692
242 Ga0501070_0005723 3300049586 Bacteria 10599
243 Ga0501070_0006857 3300049586 Bacteria 9691
244 Ga0501070_0007472 3300049586 Bacteria 9283
245 Ga0501070_0031204 3300049586 Bacteria 4464
246 Ga0501070_0127096 3300049586 Bacteria 2106
247 Ga0501071_0129226 3300049587 Bacteria 1876
248 Ga0501072_0004481 3300049588 Bacteria 10608
249 Ga0501072_0046064 3300049588 Bacteria 3431
250 Ga0501073_0000061 3300049589 Bacteria 68332
251 Ga0501073_0004791 3300049589 Bacteria 10151
252 Ga0501073_0063144 3300049589 Bacteria 2584
253 Ga0501073_0096522 3300049589 Bacteria 2053
254 Ga0501074_0000022 3300049590 Bacteria 70431
255 Ga0501074_0008591 3300049590 Bacteria 7396
256 Ga0501074_0017697 3300049590 Bacteria 5176
257 Ga0501074_0063324 3300049590 Bacteria 2664
258 Ga0501074_0157366 3300049590 Bacteria 1623
259 Ga0501075_0019517 3300049591 Bacteria 4919
260 Ga0501076_0024536 3300049592 Bacteria 4661
261 Ga0501077_0001460 3300049593 Bacteria 14230
262 Ga0501079_0005976 3300049741 Bacteria 9113
263 Ga0501079_0034767 3300049741 Bacteria 3878
264 Ga0501080_0001065 3300049742 Bacteria 22565
265 Ga0501080_0001333 3300049742 Bacteria 20585
266 Ga0501080_0015744 3300049742 Bacteria 6975
267 Ga0501080_0018227 3300049742 Bacteria 6498
268 Ga0501080_0033390 3300049742 Bacteria 4802
269 Ga0501080_0245704 3300049742 Bacteria 1632
270 Ga0501081_0043609 3300049743 Bacteria 3077
271 Ga0501083_0005923 3300049744 Bacteria 8653
272 Ga0501083_0006475 3300049744 Bacteria 8307
273 Ga0501083_0036154 3300049744 Bacteria 3369
274 Ga0501083_0039014 3300049744 Bacteria 3226
275 Ga0501083_0109560 3300049744 Bacteria 1816
276 Ga0501083_0138454 3300049744 Bacteria 1594
277 Ga0501035_0001069 3300049822 Bacteria 28719
278 Ga0501035_0033514 3300049822 Bacteria 4671
279 Ga0501035_0073724 3300049822 Bacteria 3020
280 Ga0501035_0147518 3300049822 Bacteria 2042
281 Ga0501035_0169148 3300049822 Bacteria 1889
282 Ga0501035_0215018 3300049822 Bacteria 1643
283 Ga0501044_0000145 3300049823 Bacteria 87425
284 Ga0501044_0000998 3300049823 Bacteria 34042
285 Ga0501044_0001932 3300049823 Bacteria 23992
286 Ga0501044_0006144 3300049823 Bacteria 13263
287 Ga0501044_0015407 3300049823 Bacteria 8233
288 Ga0501044_0016894 3300049823 Bacteria 7829
289 Ga0501044_0043852 3300049823 Bacteria 4645
290 Ga0501044_0190586 3300049823 Bacteria 2013
291 Ga0501044_0201465 3300049823 Bacteria 1948
292 Ga0501044_0264515 3300049823 Bacteria 1657
293 Ga0501045_0001222 3300049824 Bacteria 17107
294 Ga0501045_0002357 3300049824 Bacteria 12832
295 Ga0501045_0075350 3300049824 Bacteria 2485
296 nmdc:mga03683_64784_c1 3300050489 Bacteria 1552
297 nmdc:mga0k408_212452_c1 3300050493 Bacteria 1155
298 nmdc:mga06z11_34867_c1 3300050494 Bacteria 2473
299 nmdc:mga07m45_39237_c1 3300050496 Bacteria 2646
300 nmdc:mga05p37_231165_c1 3300050507 Bacteria 2228
301 nmdc:mga05p37_508203_c1 3300050507 Bacteria 1381
302 nmdc:mga05p37_540_c1 3300050507 Bacteria 41709
303 nmdc:mga09592_9471_c1 3300050508 Bacteria 7916
304 nmdc:mga0qj67_9371_c1 3300050509 Bacteria 7283
305 nmdc:mga06r32_1215_c1 3300050510 Bacteria 23203
306 nmdc:mga06r32_3089_c1 3300050510 Bacteria 14903
307 nmdc:mga08y16_3123_c1 3300050511 Bacteria 17148
308 nmdc:mga0n895_134190_c1 3300050512 Bacteria 2501
309 nmdc:mga0rr50_150835_c1 3300050513 Bacteria 1878
310 nmdc:mga0rr50_68156_c1 3300050513 Bacteria 2705
311 nmdc:mga0sz30_3619_c2 3300050516 Bacteria 4773
312 Ga0500643_052599 3300053087 Bacteria 1160
313 Ga0500651_0009407 3300053093 Bacteria 5804
314 Ga0500651_0042429 3300053093 Bacteria 2866
315 Ga0500566_0000055 3300053094 Bacteria 54414
316 Ga0500641_0018525 3300053096 Bacteria 2620
317 Ga0500650_0000440 3300053098 Bacteria 10355
318 Ga0500556_0000006 3300053104 Bacteria 453982
319 Ga0500562_022350 3300053108 Bacteria 1649
320 Ga0500562_040169 3300053108 Bacteria 1243
321 Ga0500592_001955 3300053116 Bacteria 3311
322 Ga0500594_0062333 3300053118 Bacteria 1078
323 Ga0500595_012621 3300053119 Bacteria 3260
324 Ga0500608_013471 3300053122 Bacteria 3627
325 Ga0500618_006490 3300053125 Bacteria 3428
326 Ga0500642_0000004 3300053130 Bacteria 433122
327 Ga0500652_000836 3300053131 Bacteria 10216
328 Ga0500559_0001822 3300053136 Bacteria 11630
329 Ga0500568_0001050 3300053139 Bacteria 18834
330 Ga0500586_000544 3300053145 Bacteria 7610
331 Ga0500604_0000761 3300053151 Bacteria 8853
332 Ga0500616_0000022 3300053153 Bacteria 460463
333 Ga0500622_0000436 3300053156 Bacteria 39572
334 Ga0500634_0017761 3300053161 Bacteria 3812
335 Ga0500634_0040921 3300053161 Bacteria 2518
336 Ga0501084_0020271 3300054114 Bacteria 5543
337 Ga0501084_0030671 3300054114 Bacteria 4496
338 Ga0501084_0042654 3300054114 Bacteria 3795
339 Ga0501084_0065388 3300054114 Bacteria 3042
340 Ga0501084_0129262 3300054114 Bacteria 2126
341 Ga0501084_0172513 3300054114 Bacteria 1825
342 Ga0501084_0369860 3300054114 Bacteria 1211
343 Ga0501082_0000145 3300060353 Bacteria 58967
344 Ga0501082_0009771 3300060353 Bacteria 8264
345 Ga0501082_0047470 3300060353 Bacteria 3700
346 Ga0501082_0164274 3300060353 Bacteria 1929
347 Ga0530510_0000910 3300061734 Bacteria 19521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0556182 Ga0496109_0556182_138_1058 304
2 3300049583 Ga0501067_0002497 Ga0501067_0002497_28_954 308
3 3300053118 Ga0500594_0062333 Ga0500594_0062333_20_946 308
4 3300037418 Ga0395900_0180984 Ga0395900_0180984_53_985 310
5 3300046537 Ga0495598_0085511 Ga0495598_0085511_63_1007 314
6 3300006871 Ga0075434_100046728 Ga0075434_1000467282 319
7 3300009147 Ga0114129_10304110 Ga0114129_103041103 319
8 3300025901 Ga0207688_10127836 Ga0207688_101278362 319
9 3300049585 Ga0501069_0094481 Ga0501069_0094481_25_1062 319
10 3300050507 nmdc:mga05p37_508203_c1 nmdc:mga05p37_508203_c1_231_1265 319
11 3300050512 nmdc:mga0n895_134190_c1 nmdc:mga0n895_134190_c1_1199_2233 319
12 3300049573 Ga0501037_0012047 Ga0501037_0012047_10_996 328
13 3300049580 Ga0501046_0018035 Ga0501046_0018035_930_1943 330
14 3300049571 Ga0501034_0179048 Ga0501034_0179048_385_1458 331
15 iso_pu_bacteria 8054563764 8054565696 339
16 iso_pu_bacteria 2842694124 2842696405 341
17 3300031595 Ga0265313_10037233 Ga0265313_100372332 342
18 iso_pu_bacteria 2508501114 2509075093 342
19 iso_pu_bacteria 2775506901 2776257412 342
20 iso_pu_bacteria 2835312727 2835318326 342
21 iso_pu_bacteria 2861691609 2861695878 342
22 iso_pu_bacteria 2889306138 2889310467 342
23 iso_pu_bacteria 2902330777 2902335071 342
24 iso_pu_bacteria 2902405164 2902405857 342
25 iso_pu_bacteria 2928125067 2928125205 342
26 iso_pu_bacteria 3003665799 3003671185 342
27 3300021384 Ga0213876_10159558 Ga0213876_101595581 343
28 3300031239 Ga0265328_10025163 Ga0265328_100251632 343
29 3300031249 Ga0265339_10019418 Ga0265339_100194182 343
30 3300031344 Ga0265316_10012572 Ga0265316_100125721 343
31 3300031711 Ga0265314_10110490 Ga0265314_101104902 343
32 3300031712 Ga0265342_10078701 Ga0265342_100787011 343
33 3300045049 Ga0466959_0044992 Ga0466959_0044992_769_1803 343
34 3300048907 Ga0496104_0003329 Ga0496104_0003329_9960_10994 343
35 3300048907 Ga0496104_0085992 Ga0496104_0085992_1851_2885 343
36 3300048908 Ga0496105_0000132 Ga0496105_0000132_28068_29102 343
37 3300048908 Ga0496105_0001618 Ga0496105_0001618_11502_12536 343
38 3300048913 Ga0496110_0004787 Ga0496110_0004787_6627_7661 343
39 3300048914 Ga0496111_0270388 Ga0496111_0270388_133_1167 343
40 3300048915 Ga0496112_0004042 Ga0496112_0004042_9107_10141 343
41 3300048916 Ga0496113_0017183 Ga0496113_0017183_590_1624 343
42 3300048922 Ga0496119_0005517 Ga0496119_0005517_9932_10966 343
43 3300048928 Ga0496125_0050432 Ga0496125_0050432_1281_2315 343
44 3300005328 Ga0070676_10084212 Ga0070676_100842122 344
45 3300005340 Ga0070689_100017980 Ga0070689_1000179806 344
46 3300005347 Ga0070668_100040468 Ga0070668_1000404684 344
47 3300005355 Ga0070671_100101423 Ga0070671_1001014233 344
48 3300005364 Ga0070673_100128671 Ga0070673_1001286712 344
49 3300005468 Ga0070707_100028707 Ga0070707_1000287077 344
50 3300005471 Ga0070698_100118728 Ga0070698_1001187282 344
51 3300005546 Ga0070696_100034785 Ga0070696_1000347851 344
52 3300005844 Ga0068862_100231785 Ga0068862_1002317852 344
53 3300006195 Ga0075366_10064588 Ga0075366_100645883 344
54 3300006844 Ga0075428_100003706 Ga0075428_10000370612 344
55 3300006847 Ga0075431_100000880 Ga0075431_10000088016 344
56 3300006880 Ga0075429_100010871 Ga0075429_1000108719 344
57 3300009094 Ga0111539_10000367 Ga0111539_1000036716 344
58 3300009147 Ga0114129_10000825 Ga0114129_1000082516 344
59 3300025907 Ga0207645_10090899 Ga0207645_100908992 344
60 3300025912 Ga0207707_10138984 Ga0207707_101389842 344
61 3300025922 Ga0207646_10023492 Ga0207646_100234927 344
62 3300025926 Ga0207659_10056294 Ga0207659_100562944 344
63 3300025929 Ga0207664_10312990 Ga0207664_103129901 344
64 3300025931 Ga0207644_10132797 Ga0207644_101327972 344
65 3300025933 Ga0207706_10068695 Ga0207706_100686953 344
66 3300025938 Ga0207704_10023025 Ga0207704_100230254 344
67 3300027866 Ga0209813_10009912 Ga0209813_100099122 344
68 3300027907 Ga0207428_10009855 Ga0207428_1000985511 344
69 3300028381 Ga0268264_10122135 Ga0268264_101221353 344
70 3300031241 Ga0265325_10011842 Ga0265325_100118423 344
71 3300035085 Ga0373929_0006822 Ga0373929_0006822_350_1429 344
72 3300035691 Ga0373931_0072404 Ga0373931_0072404_389_1468 344
73 3300035692 Ga0373935_0169321 Ga0373935_0169321_135_1205 344
74 3300035725 Ga0373947_0179008 Ga0373947_0179008_290_1324 344
75 3300036647 Ga0316582_0029234 Ga0316582_0029234_38_1084 344
76 3300037068 Ga0373925_0070467 Ga0373925_0070467_743_1813 344
77 3300046460 Ga0495638_0082262 Ga0495638_0082262_709_1746 344
78 3300046533 Ga0495640_0044914 Ga0495640_0044914_1710_2780 344
79 3300048907 Ga0496104_0199306 Ga0496104_0199306_807_1841 344
80 3300048909 Ga0496106_0050185 Ga0496106_0050185_2029_3078 344
81 3300048910 Ga0496107_0132447 Ga0496107_0132447_709_1788 344
82 3300048912 Ga0496109_0104872 Ga0496109_0104872_1479_2558 344
83 3300049569 Ga0501032_0016789 Ga0501032_0016789_1315_2382 344
84 3300049571 Ga0501034_0021249 Ga0501034_0021249_2171_3238 344
85 3300049571 Ga0501034_0029842 Ga0501034_0029842_1555_2589 344
86 3300049571 Ga0501034_0102571 Ga0501034_0102571_819_1859 344
87 3300049572 Ga0501036_0000939 Ga0501036_0000939_6796_7836 344
88 3300049573 Ga0501037_0241331 Ga0501037_0241331_186_1253 344
89 3300049574 Ga0501038_0006258 Ga0501038_0006258_5644_6711 344
90 3300049574 Ga0501038_0145012 Ga0501038_0145012_261_1334 344
91 3300049575 Ga0501039_0036634 Ga0501039_0036634_65_1138 344
92 3300049579 Ga0501043_0001206 Ga0501043_0001206_20902_21942 344
93 3300049579 Ga0501043_0150815 Ga0501043_0150815_501_1568 344
94 3300049580 Ga0501046_0189456 Ga0501046_0189456_19_1056 344
95 3300049581 Ga0501047_0000108 Ga0501047_0000108_86171_87211 344
96 3300049581 Ga0501047_0006240 Ga0501047_0006240_850_1917 344
97 3300049581 Ga0501047_0290715 Ga0501047_0290715_425_1465 344
98 3300049582 Ga0501048_0000493 Ga0501048_0000493_17535_18575 344
99 3300049584 Ga0501068_0202424 Ga0501068_0202424_157_1224 344
100 3300049586 Ga0501070_0005723 Ga0501070_0005723_282_1322 344
101 3300049589 Ga0501073_0004791 Ga0501073_0004791_3460_4527 344
102 3300049589 Ga0501073_0096522 Ga0501073_0096522_482_1522 344
103 3300049590 Ga0501074_0008591 Ga0501074_0008591_1312_2352 344
104 3300049590 Ga0501074_0063324 Ga0501074_0063324_1498_2571 344
105 3300049590 Ga0501074_0157366 Ga0501074_0157366_538_1605 344
106 3300049742 Ga0501080_0001065 Ga0501080_0001065_8282_9322 344
107 3300049742 Ga0501080_0015744 Ga0501080_0015744_5641_6708 344
108 3300049742 Ga0501080_0018227 Ga0501080_0018227_4120_5154 344
109 3300049744 Ga0501083_0006475 Ga0501083_0006475_4823_5863 344
110 3300049823 Ga0501044_0000998 Ga0501044_0000998_19340_20380 344
111 3300049823 Ga0501044_0001932 Ga0501044_0001932_21054_22127 344
112 3300049823 Ga0501044_0016894 Ga0501044_0016894_4250_5317 344
113 3300050489 nmdc:mga03683_64784_c1 nmdc:mga03683_64784_c1_411_1445 344
114 3300050493 nmdc:mga0k408_212452_c1 nmdc:mga0k408_212452_c1_101_1138 344
115 3300050494 nmdc:mga06z11_34867_c1 nmdc:mga06z11_34867_c1_1122_2156 344
116 3300050496 nmdc:mga07m45_39237_c1 nmdc:mga07m45_39237_c1_917_1951 344
117 3300050507 nmdc:mga05p37_540_c1 nmdc:mga05p37_540_c1_12907_13941 344
118 3300050508 nmdc:mga09592_9471_c1 nmdc:mga09592_9471_c1_6334_7368 344
119 3300050509 nmdc:mga0qj67_9371_c1 nmdc:mga0qj67_9371_c1_6213_7247 344
120 3300050510 nmdc:mga06r32_3089_c1 nmdc:mga06r32_3089_c1_12505_13539 344
121 3300050511 nmdc:mga08y16_3123_c1 nmdc:mga08y16_3123_c1_12916_13950 344
122 3300053096 Ga0500641_0018525 Ga0500641_0018525_1484_2518 344
123 3300053108 Ga0500562_022350 Ga0500562_022350_507_1544 344
124 3300054114 Ga0501084_0042654 Ga0501084_0042654_549_1586 344
125 3300060353 Ga0501082_0164274 Ga0501082_0164274_461_1528 344
126 3300005327 Ga0070658_10069631 Ga0070658_100696313 345
127 3300006844 Ga0075428_100155652 Ga0075428_1001556522 345
128 3300006847 Ga0075431_100003945 Ga0075431_1000039453 345
129 3300009147 Ga0114129_10024059 Ga0114129_100240593 345
130 3300025901 Ga0207688_10089437 Ga0207688_100894371 345
131 3300037312 Ga0395899_0020394 Ga0395899_0020394_3469_4506 345
132 3300037418 Ga0395900_0119391 Ga0395900_0119391_1025_2062 345
133 3300037466 Ga0395898_0034160 Ga0395898_0034160_830_1867 345
134 3300037466 Ga0395898_0170238 Ga0395898_0170238_15_1079 345
135 3300037853 Ga0436364_1420296 Ga0436364_1420296_607_1656 345
136 3300038443 Ga0395901_0057900 Ga0395901_0057900_849_1886 345
137 3300041411 Ga0439466_0010593 Ga0439466_0010593_641_1687 345
138 3300044683 Ga0466965_0116505 Ga0466965_0116505_290_1354 345
139 3300046522 Ga0495643_0145050 Ga0495643_0145050_107_1147 345
140 3300049570 Ga0501033_0101706 Ga0501033_0101706_529_1566 345
141 3300049573 Ga0501037_0166738 Ga0501037_0166738_119_1177 345
142 3300049574 Ga0501038_0104353 Ga0501038_0104353_18_1076 345
143 3300049575 Ga0501039_0249597 Ga0501039_0249597_22_1080 345
144 3300049576 Ga0501040_0005780 Ga0501040_0005780_4409_5467 345
145 3300049577 Ga0501041_0026249 Ga0501041_0026249_288_1346 345
146 3300049582 Ga0501048_0065580 Ga0501048_0065580_786_1844 345
147 3300049583 Ga0501067_0083765 Ga0501067_0083765_75_1115 345
148 3300049585 Ga0501069_0014788 Ga0501069_0014788_122_1165 345
149 3300049586 Ga0501070_0127096 Ga0501070_0127096_874_1917 345
150 3300049588 Ga0501072_0046064 Ga0501072_0046064_2339_3397 345
151 3300049591 Ga0501075_0019517 Ga0501075_0019517_2022_3080 345
152 3300049592 Ga0501076_0024536 Ga0501076_0024536_2776_3834 345
153 3300049593 Ga0501077_0001460 Ga0501077_0001460_7576_8634 345
154 3300049741 Ga0501079_0005976 Ga0501079_0005976_250_1308 345
155 3300049742 Ga0501080_0033390 Ga0501080_0033390_3596_4654 345
156 3300049743 Ga0501081_0043609 Ga0501081_0043609_725_1783 345
157 3300049744 Ga0501083_0138454 Ga0501083_0138454_356_1399 345
158 3300049822 Ga0501035_0147518 Ga0501035_0147518_941_1978 345
159 3300049823 Ga0501044_0190586 Ga0501044_0190586_694_1737 345
160 3300049824 Ga0501045_0001222 Ga0501045_0001222_2458_3516 345
161 3300050507 nmdc:mga05p37_231165_c1 nmdc:mga05p37_231165_c1_1074_2120 345
162 3300050510 nmdc:mga06r32_1215_c1 nmdc:mga06r32_1215_c1_18313_19359 345
163 3300054114 Ga0501084_0020271 Ga0501084_0020271_3771_4829 345
164 3300060353 Ga0501082_0047470 Ga0501082_0047470_701_1759 345
165 3300061734 Ga0530510_0000910 Ga0530510_0000910_2884_3942 345
166 iso_pu_bacteria 2602042107 2603858668 345
167 iso_pu_bacteria 2857524615 2857526209 345
168 iso_pu_bacteria 2893066018 2893067518 345
169 iso_pu_bacteria 2919073203 2919073940 345
170 3300049568 Ga0501031_0006892 Ga0501031_0006892_222_1262 346
171 3300049570 Ga0501033_0010676 Ga0501033_0010676_1858_2898 346
172 3300049572 Ga0501036_0024496 Ga0501036_0024496_2823_3863 346
173 3300049572 Ga0501036_0048315 Ga0501036_0048315_1759_2799 346
174 3300049573 Ga0501037_0017846 Ga0501037_0017846_3465_4505 346
175 3300049574 Ga0501038_0004381 Ga0501038_0004381_9145_10185 346
176 3300049574 Ga0501038_0060975 Ga0501038_0060975_520_1560 346
177 3300049575 Ga0501039_0013808 Ga0501039_0013808_3284_4324 346
178 3300049576 Ga0501040_0013468 Ga0501040_0013468_1109_2149 346
179 3300049578 Ga0501042_0073187 Ga0501042_0073187_1026_2066 346
180 3300049579 Ga0501043_0057647 Ga0501043_0057647_310_1350 346
181 3300049579 Ga0501043_0156148 Ga0501043_0156148_227_1267 346
182 3300049580 Ga0501046_0021920 Ga0501046_0021920_2458_3498 346
183 3300049581 Ga0501047_0141383 Ga0501047_0141383_595_1635 346
184 3300049581 Ga0501047_0158877 Ga0501047_0158877_722_1762 346
185 3300049582 Ga0501048_0015632 Ga0501048_0015632_1611_2651 346
186 3300049584 Ga0501068_0060153 Ga0501068_0060153_138_1178 346
187 3300049586 Ga0501070_0007472 Ga0501070_0007472_7339_8379 346
188 3300049587 Ga0501071_0129226 Ga0501071_0129226_714_1754 346
189 3300049590 Ga0501074_0017697 Ga0501074_0017697_1707_2747 346
190 3300049741 Ga0501079_0034767 Ga0501079_0034767_212_1252 346
191 3300049744 Ga0501083_0036154 Ga0501083_0036154_519_1559 346
192 3300049822 Ga0501035_0033514 Ga0501035_0033514_398_1438 346
193 3300049823 Ga0501044_0015407 Ga0501044_0015407_1689_2729 346
194 3300049824 Ga0501045_0075350 Ga0501045_0075350_53_1093 346
195 iso_pu_bacteria 2671180139 2671693509 346
196 3300005539 Ga0068853_100100314 Ga0068853_1001003142 347
197 3300025909 Ga0207705_10037866 Ga0207705_100378663 347
198 3300026067 Ga0207678_10163461 Ga0207678_101634612 347
199 3300026142 Ga0207698_10298778 Ga0207698_102987781 347
200 3300031235 Ga0265330_10087680 Ga0265330_100876801 347
201 3300031247 Ga0265340_10001851 Ga0265340_100018514 347
202 3300031249 Ga0265339_10004942 Ga0265339_100049424 347
203 3300031344 Ga0265316_10017598 Ga0265316_100175981 347
204 3300031344 Ga0265316_10268777 Ga0265316_102687771 347
205 3300031595 Ga0265313_10001338 Ga0265313_100013388 347
206 3300031711 Ga0265314_10102544 Ga0265314_101025442 347
207 3300031712 Ga0265342_10001917 Ga0265342_100019176 347
208 3300046507 Ga0495606_0001109 Ga0495606_0001109_18403_19446 347
209 3300048903 Ga0496100_0035058 Ga0496100_0035058_1397_2473 347
210 3300049568 Ga0501031_0000343 Ga0501031_0000343_5290_6333 347
211 3300049569 Ga0501032_0000165 Ga0501032_0000165_424_1467 347
212 3300049570 Ga0501033_0000298 Ga0501033_0000298_26674_27717 347
213 3300049570 Ga0501033_0004277 Ga0501033_0004277_3190_4233 347
214 3300049571 Ga0501034_0000058 Ga0501034_0000058_72191_73234 347
215 3300049571 Ga0501034_0041146 Ga0501034_0041146_681_1727 347
216 3300049571 Ga0501034_0163560 Ga0501034_0163560_1016_2059 347
217 3300049571 Ga0501034_0295755 Ga0501034_0295755_191_1297 347
218 3300049572 Ga0501036_0000140 Ga0501036_0000140_21368_22411 347
219 3300049573 Ga0501037_0000078 Ga0501037_0000078_62682_63725 347
220 3300049573 Ga0501037_0084854 Ga0501037_0084854_488_1531 347
221 3300049574 Ga0501038_0000050 Ga0501038_0000050_72212_73255 347
222 3300049574 Ga0501038_0058433 Ga0501038_0058433_1882_2988 347
223 3300049574 Ga0501038_0161213 Ga0501038_0161213_565_1608 347
224 3300049575 Ga0501039_0000078 Ga0501039_0000078_2496_3539 347
225 3300049579 Ga0501043_0002964 Ga0501043_0002964_8095_9138 347
226 3300049580 Ga0501046_0000893 Ga0501046_0000893_26674_27717 347
227 3300049581 Ga0501047_0019740 Ga0501047_0019740_1368_2411 347
228 3300049583 Ga0501067_0000237 Ga0501067_0000237_6246_7289 347
229 3300049584 Ga0501068_0000217 Ga0501068_0000217_23972_25015 347
230 3300049584 Ga0501068_0153571 Ga0501068_0153571_370_1413 347
231 3300049586 Ga0501070_0006857 Ga0501070_0006857_4445_5488 347
232 3300049589 Ga0501073_0000061 Ga0501073_0000061_31304_32347 347
233 3300049590 Ga0501074_0000022 Ga0501074_0000022_64091_65134 347
234 3300049742 Ga0501080_0001333 Ga0501080_0001333_11777_12820 347
235 3300049742 Ga0501080_0245704 Ga0501080_0245704_269_1315 347
236 3300049744 Ga0501083_0005923 Ga0501083_0005923_3768_4811 347
237 3300049822 Ga0501035_0001069 Ga0501035_0001069_26674_27717 347
238 3300049822 Ga0501035_0073724 Ga0501035_0073724_198_1241 347
239 3300049822 Ga0501035_0169148 Ga0501035_0169148_365_1411 347
240 3300049823 Ga0501044_0000145 Ga0501044_0000145_14205_15248 347
241 3300049824 Ga0501045_0002357 Ga0501045_0002357_10062_11105 347
242 3300054114 Ga0501084_0030671 Ga0501084_0030671_928_1971 347
243 3300054114 Ga0501084_0129262 Ga0501084_0129262_84_1130 347
244 3300060353 Ga0501082_0009771 Ga0501082_0009771_179_1222 347
245 3300005440 Ga0070705_100143900 Ga0070705_1001439002 348
246 3300005445 Ga0070708_100086619 Ga0070708_1000866191 348
247 3300005468 Ga0070707_100063303 Ga0070707_1000633033 348
248 3300005518 Ga0070699_100092981 Ga0070699_1000929812 348
249 3300005535 Ga0070684_100031381 Ga0070684_1000313816 348
250 3300005548 Ga0070665_100176867 Ga0070665_1001768671 348
251 3300005937 Ga0081455_10010887 Ga0081455_100108878 348
252 3300006028 Ga0070717_10165424 Ga0070717_101654242 348
253 3300006871 Ga0075434_100244478 Ga0075434_1002444782 348
254 3300007076 Ga0075435_100301905 Ga0075435_1003019051 348
255 3300009147 Ga0114129_10246205 Ga0114129_102462052 348
256 3300009551 Ga0105238_10065513 Ga0105238_100655133 348
257 3300017792 Ga0163161_10167956 Ga0163161_101679562 348
258 3300025910 Ga0207684_10002963 Ga0207684_100029637 348
259 3300025915 Ga0207693_10021699 Ga0207693_100216992 348
260 3300025924 Ga0207694_10032544 Ga0207694_100325442 348
261 3300028577 Ga0265318_10004032 Ga0265318_100040327 348
262 3300031235 Ga0265330_10023870 Ga0265330_100238701 348
263 3300031240 Ga0265320_10032503 Ga0265320_100325031 348
264 3300031241 Ga0265325_10004992 Ga0265325_100049928 348
265 3300031247 Ga0265340_10007893 Ga0265340_100078934 348
266 3300031249 Ga0265339_10034305 Ga0265339_100343054 348
267 3300031344 Ga0265316_10011480 Ga0265316_100114801 348
268 3300039447 Ga0436361_0950726 Ga0436361_0950726_122_1204 348
269 3300041408 Ga0439453_0011435 Ga0439453_0011435_407_1453 348
270 3300042003 Ga0439443_000459 Ga0439443_000459_1561_2607 348
271 3300042009 Ga0439451_024633 Ga0439451_024633_111_1157 348
272 3300048913 Ga0496110_0018162 Ga0496110_0018162_2331_3413 348
273 3300049579 Ga0501043_0030669 Ga0501043_0030669_658_1704 348
274 3300049581 Ga0501047_0165309 Ga0501047_0165309_882_1928 348
275 3300049588 Ga0501072_0004481 Ga0501072_0004481_9197_10243 348
276 3300049823 Ga0501044_0006144 Ga0501044_0006144_11614_12660 348
277 3300049823 Ga0501044_0043852 Ga0501044_0043852_2924_3970 348
278 3300050513 nmdc:mga0rr50_150835_c1 nmdc:mga0rr50_150835_c1_763_1845 348
279 3300060353 Ga0501082_0000145 Ga0501082_0000145_18355_19503 348
280 3300003203 JGI25406J46586_10000015 JGI25406J46586_1000001559 349
281 3300005985 Ga0081539_10000064 Ga0081539_10000064224 349
282 3300005985 Ga0081539_10145436 Ga0081539_101454361 349
283 3300006186 Ga0075369_10004154 Ga0075369_100041543 349
284 3300006871 Ga0075434_100033742 Ga0075434_1000337423 349
285 3300007076 Ga0075435_100074695 Ga0075435_1000746953 349
286 3300025295 Ga0209564_1000747 Ga0209564_100074713 349
287 3300025295 Ga0209564_1015863 Ga0209564_10158632 349
288 3300025297 Ga0209758_1009490 Ga0209758_10094904 349
289 3300031711 Ga0265314_10002395 Ga0265314_1000239523 349
290 3300031711 Ga0265314_10028650 Ga0265314_100286502 349
291 3300046460 Ga0495638_0008895 Ga0495638_0008895_4836_5888 349
292 3300046460 Ga0495638_0016972 Ga0495638_0016972_2171_3223 349
293 3300046462 Ga0495651_0072508 Ga0495651_0072508_594_1643 349
294 3300046500 Ga0495596_0070398 Ga0495596_0070398_27_1079 349
295 3300046524 Ga0495648_0050846 Ga0495648_0050846_445_1494 349
296 3300046557 Ga0495622_0005955 Ga0495622_0005955_3075_4127 349
297 3300046665 Ga0495661_0011215 Ga0495661_0011215_635_1687 349
298 3300048915 Ga0496112_0000015 Ga0496112_0000015_133701_134750 349
299 3300048919 Ga0496116_0020259 Ga0496116_0020259_2971_4023 349
300 3300048920 Ga0496117_0081231 Ga0496117_0081231_591_1640 349
301 3300048921 Ga0496118_0018482 Ga0496118_0018482_2479_3531 349
302 3300048921 Ga0496118_0031703 Ga0496118_0031703_1441_2493 349
303 3300048921 Ga0496118_0033796 Ga0496118_0033796_679_1728 349
304 3300048922 Ga0496119_0036301 Ga0496119_0036301_1875_2924 349
305 3300048924 Ga0496121_0009514 Ga0496121_0009514_9554_10606 349
306 3300048924 Ga0496121_0259016 Ga0496121_0259016_129_1181 349
307 3300048925 Ga0496122_0019688 Ga0496122_0019688_236_1288 349
308 3300048926 Ga0496123_0022461 Ga0496123_0022461_144_1196 349
309 3300048927 Ga0496124_0033566 Ga0496124_0033566_2725_3777 349
310 3300048928 Ga0496125_0000843 Ga0496125_0000843_21031_22083 349
311 3300048928 Ga0496125_0018319 Ga0496125_0018319_4140_5192 349
312 3300048929 Ga0496126_0054765 Ga0496126_0054765_2184_3236 349
313 3300049570 Ga0501033_0025076 Ga0501033_0025076_2920_3975 349
314 3300049571 Ga0501034_0030938 Ga0501034_0030938_3729_4784 349
315 3300049571 Ga0501034_0079359 Ga0501034_0079359_1383_2486 349
316 3300049571 Ga0501034_0096644 Ga0501034_0096644_519_1571 349
317 3300049572 Ga0501036_0016258 Ga0501036_0016258_2155_3210 349
318 3300049572 Ga0501036_0037480 Ga0501036_0037480_191_1294 349
319 3300049573 Ga0501037_0003451 Ga0501037_0003451_7992_9047 349
320 3300049573 Ga0501037_0004338 Ga0501037_0004338_851_1954 349
321 3300049574 Ga0501038_0054615 Ga0501038_0054615_657_1712 349
322 3300049575 Ga0501039_0005279 Ga0501039_0005279_5735_6838 349
323 3300049575 Ga0501039_0080481 Ga0501039_0080481_442_1497 349
324 3300049577 Ga0501041_0030297 Ga0501041_0030297_796_1899 349
325 3300049579 Ga0501043_0020485 Ga0501043_0020485_36_1139 349
326 3300049579 Ga0501043_0061301 Ga0501043_0061301_1678_2733 349
327 3300049580 Ga0501046_0095754 Ga0501046_0095754_786_1889 349
328 3300049581 Ga0501047_0026634 Ga0501047_0026634_269_1324 349
329 3300049581 Ga0501047_0322547 Ga0501047_0322547_35_1087 349
330 3300049584 Ga0501068_0023223 Ga0501068_0023223_980_2083 349
331 3300049586 Ga0501070_0031204 Ga0501070_0031204_1294_2349 349
332 3300049589 Ga0501073_0063144 Ga0501073_0063144_327_1379 349
333 3300049744 Ga0501083_0039014 Ga0501083_0039014_482_1543 349
334 3300049744 Ga0501083_0109560 Ga0501083_0109560_321_1373 349
335 3300049822 Ga0501035_0215018 Ga0501035_0215018_473_1528 349
336 3300049823 Ga0501044_0201465 Ga0501044_0201465_519_1574 349
337 3300049823 Ga0501044_0264515 Ga0501044_0264515_77_1180 349
338 3300050513 nmdc:mga0rr50_68156_c1 nmdc:mga0rr50_68156_c1_243_1292 349
339 3300050516 nmdc:mga0sz30_3619_c2 nmdc:mga0sz30_3619_c2_1347_2399 349
340 3300053087 Ga0500643_052599 Ga0500643_052599_31_1083 349
341 3300053093 Ga0500651_0009407 Ga0500651_0009407_4425_5474 349
342 3300053093 Ga0500651_0042429 Ga0500651_0042429_1798_2850 349
343 3300053094 Ga0500566_0000055 Ga0500566_0000055_13729_14781 349
344 3300053098 Ga0500650_0000440 Ga0500650_0000440_3015_4067 349
345 3300053104 Ga0500556_0000006 Ga0500556_0000006_190682_191734 349
346 3300053108 Ga0500562_040169 Ga0500562_040169_136_1188 349
347 3300053116 Ga0500592_001955 Ga0500592_001955_1783_2835 349
348 3300053119 Ga0500595_012621 Ga0500595_012621_1434_2483 349
349 3300053122 Ga0500608_013471 Ga0500608_013471_419_1471 349
350 3300053125 Ga0500618_006490 Ga0500618_006490_920_1972 349
351 3300053130 Ga0500642_0000004 Ga0500642_0000004_292513_293565 349
352 3300053131 Ga0500652_000836 Ga0500652_000836_7105_8157 349
353 3300053136 Ga0500559_0001822 Ga0500559_0001822_172_1224 349
354 3300053139 Ga0500568_0001050 Ga0500568_0001050_13087_14139 349
355 3300053145 Ga0500586_000544 Ga0500586_000544_2839_3906 349
356 3300053151 Ga0500604_0000761 Ga0500604_0000761_7468_8520 349
357 3300053153 Ga0500616_0000022 Ga0500616_0000022_189943_190995 349
358 3300053156 Ga0500622_0000436 Ga0500622_0000436_25356_26408 349
359 3300053161 Ga0500634_0017761 Ga0500634_0017761_1203_2270 349
360 3300053161 Ga0500634_0040921 Ga0500634_0040921_201_1253 349
361 3300054114 Ga0501084_0065388 Ga0501084_0065388_450_1502 349
362 3300054114 Ga0501084_0172513 Ga0501084_0172513_547_1608 349
363 3300054114 Ga0501084_0369860 Ga0501084_0369860_39_1100 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

1

247

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3prh-assembly1.cif.gz_B tryptophanyl-trna synthetase val144pro mutant from b. subtilis 0.9422 5 347
6dfu-assembly1.cif.gz_B tryptophan--trna ligase from haemophilus influenzae. 0.9385 4 349
3fhj-assembly1.cif.gz_B independent saturation of three trprs subsites generates a partially-assembled state similar to those observed in molecular simulations 0.9382 4 347
3prh-assembly1.cif.gz_A tryptophanyl-trna synthetase val144pro mutant from b. subtilis 0.9372 5 347
1d2r-assembly3.cif.gz_C 2.9 a crystal structure of ligand-free tryptophanyl-trna synthetase: domain movements fragment the adenine nucleotide binding site. 0.9367 4 347
ID Description Score Start End Superfamily
af_Q86A90_233_346_1.10.240.10 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9496 201 315 1.10.240.10
3fhjD02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9363 201 312 1.10.240.10
af_Q86A90_233_346_1.10.240.10 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9336 201 315 1.10.240.10
af_Q8RXE9_260_370_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9289 201 312 3.40.50.620
1i6lA02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.928 202 309 1.10.240.10
ID Description Score Start End GO Terms
AF-A0A440IBG7-F1-model_v4 deleted 0.9939 202 288
AF-A0A258JKG7-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) 0.9722 2 331 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A440IBG7-F1-model_v4 deleted 0.9717 202 288
AF-A0A840AP78-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9707 1 349 GO:0004830
GO:0005524
GO:0005829
GO:0006436
AF-A0A7R7TAD0-F1-model_v4 Tryptophan--tRNA ligase (EC 6.1.1.2) (Tryptophanyl-tRNA synthetase) (TrpRS) 0.9684 1 349 GO:0004830
GO:0005524
GO:0005829
GO:0006436

Feature Viewer

pLDDT pTM Quality
89.05 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map