F423016

General Info

Members Datasets Scaffolds Average Seq Length
363 231 347 189

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10001143|Ga0307516_100011435
Length 212
Sequence MLCRYREIACIFARNVHLPKTSNLEFQTDIENCLKVLHAGGLILYPTDTVWGIGCDATNPIAVKAVYGLKRRDESKSLIVLMADERDVLKYISAPDLRIFEFLHTVQKPTTVIYEGPVGLAENLTGSDGTIAIRLVDEPFCKHLIKRFRKPLVSTSANISGSPAPAFFGEVGATVREGVDYIVRYRQDDDLPKQPSAVVKWNKDASVMVLRS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
5 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
6 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
7 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
8 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
9 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
10 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
11 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
12 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
13 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
14 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
15 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
16 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
17 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
135 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
136 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
137 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
159 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
162 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
202 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
203 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
206 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
207 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
208 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
209 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
210 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
211 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
216 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
217 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0.83
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 0.83
Rhizosphere 84.85
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_210851 2162886007 Bacteria 1088
2 SwRhRL2b_contig_3634020 2162886007 Bacteria 2028
3 JGI24737J22298_10060400 3300001990 Bacteria 1141
4 JGI25162J39368_1000107 3300002737 Bacteria 90782
5 JGI25162J39368_1001620 3300002737 Bacteria 11286
6 rootH2_10013110 3300003320 Bacteria 45132
7 rootH2_10019063 3300003320 Bacteria 8406
8 rootL2_10166616 3300003322 Bacteria 2709
9 rootH1_10162919 3300003323 Bacteria 5611
10 Ga0055531_10005359 3300003794 Bacteria 7520
11 Ga0058863_10827685 3300004799 Bacteria 2092
12 Ga0058861_11293557 3300004800 Bacteria 1546
13 Ga0058862_10780518 3300004803 Bacteria 794
14 Ga0065714_10096761 3300005288 Bacteria 1753
15 Ga0065712_10078098 3300005290 Bacteria 3378
16 Ga0070658_10532121 3300005327 Bacteria 1016
17 Ga0070683_100014276 3300005329 Bacteria 6944
18 Ga0070683_101021950 3300005329 Bacteria 794
19 Ga0070670_100033402 3300005331 Bacteria 4431
20 Ga0070670_100042195 3300005331 Bacteria 3921
21 Ga0070670_100403386 3300005331 Bacteria 1207
22 Ga0070670_100571901 3300005331 Bacteria 1009
23 Ga0068869_100100310 3300005334 Bacteria 2189
24 Ga0070680_100035828 3300005336 Bacteria 4007
25 Ga0070680_100233629 3300005336 Bacteria 1553
26 Ga0068868_101109250 3300005338 Bacteria 728
27 Ga0070689_100056938 3300005340 Bacteria 3033
28 Ga0070689_100235857 3300005340 Bacteria 1505
29 Ga0070691_10200247 3300005341 Bacteria 1049
30 Ga0070692_10523971 3300005345 Unclassified 772
31 Ga0070668_100079169 3300005347 Unclassified 2573
32 Ga0070668_100627577 3300005347 Bacteria 942
33 Ga0070671_100138763 3300005355 Bacteria 2051
34 Ga0070671_100767380 3300005355 Bacteria 838
35 Ga0070673_100303198 3300005364 Bacteria 1407
36 Ga0070688_100058278 3300005365 Bacteria 2431
37 Ga0070688_100421249 3300005365 Bacteria 992
38 Ga0070667_100019703 3300005367 Bacteria 5596
39 Ga0070667_100025692 3300005367 Bacteria 4897
40 Ga0070681_10008789 3300005458 Bacteria 9914
41 Ga0070681_10010876 3300005458 Bacteria 8995
42 Ga0070681_10099765 3300005458 Bacteria 2849
43 Ga0070685_10035569 3300005466 Bacteria 2810
44 Ga0070679_100029098 3300005530 Bacteria 5449
45 Ga0070679_100105604 3300005530 Bacteria 2803
46 Ga0070684_100002312 3300005535 Bacteria 14048
47 Ga0070672_100070016 3300005543 Bacteria 2786
48 Ga0070672_100836734 3300005543 Unclassified 811
49 Ga0070693_100104365 3300005547 Bacteria 1732
50 Ga0070665_100000074 3300005548 Bacteria 192944
51 Ga0068855_100039122 3300005563 Bacteria 5630
52 Ga0068855_100236029 3300005563 Bacteria 2045
53 Ga0068855_100389741 3300005563 Bacteria 1528
54 Ga0070664_100797326 3300005564 Bacteria 883
55 Ga0068857_100236927 3300005577 Bacteria 1670
56 Ga0068854_100571344 3300005578 Unclassified 962
57 Ga0068856_100077693 3300005614 Bacteria 3290
58 Ga0068856_100152936 3300005614 Unclassified 2316
59 Ga0068856_101032208 3300005614 Bacteria 840
60 Ga0068852_100010350 3300005616 Bacteria 6966
61 Ga0068852_100051596 3300005616 Bacteria 3531
62 Ga0068852_100319640 3300005616 Bacteria 1507
63 Ga0068852_100855619 3300005616 Bacteria 925
64 Ga0068859_100000037 3300005617 Bacteria 165480
65 Ga0068864_100448445 3300005618 Bacteria 1234
66 Ga0068851_10000199 3300005834 Bacteria 28976
67 Ga0068863_100002618 3300005841 Bacteria 17840
68 Ga0068863_100059275 3300005841 Bacteria 3622
69 Ga0068863_100128907 3300005841 Bacteria 2414
70 Ga0068858_100063431 3300005842 Bacteria 3419
71 Ga0068860_100013203 3300005843 Bacteria 8103
72 Ga0068860_100146917 3300005843 Unclassified 2269
73 Ga0075366_10004745 3300006195 Bacteria 7325
74 Ga0075366_10020037 3300006195 Bacteria 3878
75 Ga0097621_100001069 3300006237 Bacteria 19149
76 Ga0097621_100023617 3300006237 Bacteria 4789
77 Ga0097621_100357795 3300006237 Bacteria 1300
78 Ga0075370_10171272 3300006353 Bacteria 1276
79 Ga0068871_100018879 3300006358 Bacteria 5254
80 Ga0068871_100024861 3300006358 Bacteria 4651
81 Ga0068871_100391214 3300006358 Bacteria 1237
82 Ga0068871_100413561 3300006358 Unclassified 1203
83 Ga0075428_100032709 3300006844 Bacteria 5744
84 Ga0075431_100640424 3300006847 Bacteria 1044
85 Ga0068865_100110772 3300006881 Unclassified 2025
86 Ga0068865_100997603 3300006881 Bacteria 733
87 Ga0097620_100000037 3300006931 Bacteria 165480
88 Ga0097620_100149718 3300006931 Unclassified 2410
89 Ga0105240_10000008 3300009093 Bacteria 618862
90 Ga0105240_10000059 3300009093 Bacteria 219860
91 Ga0105240_10031339 3300009093 Bacteria 6897
92 Ga0105240_10045664 3300009093 Bacteria 5556
93 Ga0105240_10537814 3300009093 Bacteria 1294
94 Ga0105245_10138867 3300009098 Unclassified 2287
95 Ga0105243_10000009 3300009148 Bacteria 354419
96 Ga0105243_10035623 3300009148 Unclassified 3859
97 Ga0105241_10001055 3300009174 Bacteria 20990
98 Ga0105241_10040370 3300009174 Bacteria 3523
99 Ga0105241_11548588 3300009174 Bacteria 639
100 Ga0105242_10201205 3300009176 Bacteria 1769
101 Ga0105242_10324989 3300009176 Bacteria 1412
102 Ga0105242_11123533 3300009176 Bacteria 801
103 Ga0105248_10111698 3300009177 Bacteria 3082
104 Ga0105248_11993551 3300009177 Bacteria 659
105 Ga0105237_10001973 3300009545 Bacteria 26110
106 Ga0105237_10124822 3300009545 Unclassified 2569
107 Ga0105237_10353493 3300009545 Bacteria 1474
108 Ga0105238_10343678 3300009551 Bacteria 1481
109 Ga0105238_12086372 3300009551 Unclassified 601
110 Ga0105249_10001713 3300009553 Bacteria 19174
111 Ga0105249_10017145 3300009553 Bacteria 6429
112 Ga0105249_10162789 3300009553 Unclassified 2157
113 Ga0105239_10001797 3300010375 Bacteria 28154
114 Ga0105239_10009494 3300010375 Bacteria 10957
115 Ga0105239_10091532 3300010375 Bacteria 3356
116 Ga0105239_10105160 3300010375 Bacteria 3126
117 Ga0105239_10657727 3300010375 Bacteria 1197
118 Ga0105246_10039683 3300011119 Unclassified 3173
119 Ga0157373_10097437 3300013100 Bacteria 2070
120 Ga0157371_10065090 3300013102 Bacteria 2581
121 Ga0157371_10785763 3300013102 Bacteria 717
122 Ga0157370_10607989 3300013104 Unclassified 1001
123 Ga0157369_10117799 3300013105 Bacteria 2819
124 Ga0157369_10451285 3300013105 Bacteria 1331
125 Ga0157374_11446416 3300013296 Bacteria 710
126 Ga0157378_10004603 3300013297 Bacteria 12099
127 Ga0157378_10009754 3300013297 Bacteria 8368
128 Ga0157378_10097011 3300013297 Bacteria 2686
129 Ga0157378_10131732 3300013297 Bacteria 2315
130 Ga0157378_10132506 3300013297 Bacteria 2308
131 Ga0157378_10238883 3300013297 Bacteria 1735
132 Ga0157378_10516852 3300013297 Bacteria 1195
133 Ga0157378_11359926 3300013297 Bacteria 752
134 Ga0163162_10003204 3300013306 Bacteria 15653
135 Ga0163162_10003269 3300013306 Bacteria 15507
136 Ga0163162_10770041 3300013306 Bacteria 1081
137 Ga0157372_10188791 3300013307 Bacteria 2387
138 Ga0157372_10441733 3300013307 Bacteria 1516
139 Ga0157372_10562360 3300013307 Bacteria 1329
140 Ga0157372_10833344 3300013307 Bacteria 1071
141 Ga0157375_10000651 3300013308 Bacteria 30698
142 Ga0157375_10025535 3300013308 Bacteria 5491
143 Ga0157375_11164182 3300013308 Bacteria 904
144 Ga0163163_10259428 3300014325 Unclassified 1789
145 Ga0163163_10291118 3300014325 Bacteria 1685
146 Ga0157380_10036613 3300014326 Bacteria 3798
147 Ga0157379_10253315 3300014968 Unclassified 1598
148 Ga0157379_10358300 3300014968 Bacteria 1336
149 Ga0157376_10008723 3300014969 Bacteria 7326
150 Ga0157376_10012276 3300014969 Bacteria 6353
151 Ga0157376_10062153 3300014969 Unclassified 3142
152 Ga0157376_10274632 3300014969 Bacteria 1585
153 Ga0157376_10306189 3300014969 Bacteria 1506
154 Ga0182006_1005231 3300015261 Bacteria 6217
155 Ga0182005_1075241 3300015265 Bacteria 929
156 Ga0163161_10107243 3300017792 Bacteria 2085
157 Ga0163161_10198758 3300017792 Bacteria 1544
158 Ga0213876_10360355 3300021384 Bacteria 773
159 Ga0209026_1004405 3300025250 Bacteria 4184
160 Ga0209257_1000511 3300025304 Bacteria 67499
161 Ga0207680_10000619 3300025903 Bacteria 16749
162 Ga0207654_10043215 3300025911 Unclassified 2554
163 Ga0207707_10007687 3300025912 Bacteria 9388
164 Ga0207707_10065197 3300025912 Bacteria 3172
165 Ga0207695_10000021 3300025913 Bacteria 679399
166 Ga0207695_10000039 3300025913 Bacteria 454801
167 Ga0207695_10000073 3300025913 Bacteria 312565
168 Ga0207695_10069478 3300025913 Bacteria 3604
169 Ga0207671_10002513 3300025914 Bacteria 19573
170 Ga0207671_10086893 3300025914 Bacteria 2351
171 Ga0207660_10076271 3300025917 Bacteria 2451
172 Ga0207662_10256441 3300025918 Bacteria 1150
173 Ga0207652_10011055 3300025921 Bacteria 7275
174 Ga0207652_10056839 3300025921 Bacteria 3369
175 Ga0207652_10071284 3300025921 Bacteria 3019
176 Ga0207681_10100275 3300025923 Bacteria 2087
177 Ga0207694_10724861 3300025924 Bacteria 839
178 Ga0207650_10075515 3300025925 Bacteria 2544
179 Ga0207650_10164359 3300025925 Bacteria 1760
180 Ga0207650_10387886 3300025925 Bacteria 1154
181 Ga0207709_10000026 3300025935 Bacteria 354467
182 Ga0207670_10047418 3300025936 Bacteria 2861
183 Ga0207669_10225036 3300025937 Bacteria 1380
184 Ga0207704_10059755 3300025938 Unclassified 2355
185 Ga0207689_10004234 3300025942 Bacteria 13052
186 Ga0207661_10068907 3300025944 Unclassified 2882
187 Ga0207661_10929707 3300025944 Bacteria 801
188 Ga0207667_10004126 3300025949 Bacteria 17853
189 Ga0207667_10004578 3300025949 Bacteria 16953
190 Ga0207667_10014742 3300025949 Bacteria 8895
191 Ga0207667_10029581 3300025949 Bacteria 5938
192 Ga0207651_10828521 3300025960 Bacteria 821
193 Ga0207712_10036617 3300025961 Bacteria 3343
194 Ga0207712_10117236 3300025961 Bacteria 2008
195 Ga0207658_10049238 3300025986 Bacteria 3095
196 Ga0207658_10098083 3300025986 Unclassified 2289
197 Ga0207658_10398611 3300025986 Bacteria 1209
198 Ga0207677_10492663 3300026023 Bacteria 1058
199 Ga0207703_10037552 3300026035 Bacteria 3859
200 Ga0207639_10013384 3300026041 Bacteria 5742
201 Ga0207702_10211173 3300026078 Bacteria 1804
202 Ga0207641_10000226 3300026088 Bacteria 72539
203 Ga0207641_10022489 3300026088 Bacteria 5188
204 Ga0207641_10414230 3300026088 Unclassified 1296
205 Ga0207676_10368723 3300026095 Bacteria 1333
206 Ga0207676_10680045 3300026095 Bacteria 995
207 Ga0207676_10931421 3300026095 Bacteria 853
208 Ga0207698_10023281 3300026142 Bacteria 4324
209 Ga0207698_10059510 3300026142 Bacteria 2967
210 Ga0268266_10000010 3300028379 Bacteria 1030233
211 Ga0268264_10009695 3300028381 Bacteria 7975
212 Ga0268264_10125135 3300028381 Unclassified 2271
213 Ga0265318_10078372 3300028577 Bacteria 1221
214 Ga0307517_10001115 3300028786 Bacteria 45308
215 Ga0307515_10000469 3300028794 Bacteria 96345
216 Ga0307515_10216575 3300028794 Bacteria 1744
217 Ga0307515_10354443 3300028794 Bacteria 1112
218 Ga0265338_10000658 3300028800 Bacteria 59815
219 Ga0265338_10000703 3300028800 Bacteria 57346
220 Ga0316177_1006807 3300030731 Bacteria 14319
221 Ga0316176_1209624 3300030732 Bacteria 24194
222 Ga0316183_1095896 3300030742 Bacteria 133299
223 Ga0316181_1224191 3300030744 Bacteria 23228
224 Ga0265327_10059354 3300031251 Bacteria 1959
225 Ga0307513_10126199 3300031456 Unclassified 2514
226 Ga0307509_10116592 3300031507 Unclassified 2660
227 Ga0307509_10204227 3300031507 Bacteria 1808
228 Ga0307408_100145348 3300031548 Bacteria 1866
229 Ga0307508_10067215 3300031616 Bacteria 3153
230 Ga0316576_10003339 3300031727 Bacteria 9385
231 Ga0316578_10090842 3300031728 Bacteria 1823
232 Ga0316578_10121832 3300031728 Bacteria 1568
233 Ga0307516_10001143 3300031730 Bacteria 37055
234 Ga0307413_10024227 3300031824 Bacteria 3306
235 Ga0307410_10139976 3300031852 Bacteria 1789
236 Ga0307412_10088565 3300031911 Bacteria 2160
237 Ga0307416_100022237 3300032002 Unclassified 4573
238 Ga0307414_11065306 3300032004 Bacteria 746
239 Ga0307415_100222592 3300032126 Bacteria 1514
240 Ga0316580_10088192 3300032139 Bacteria 949
241 Ga0307510_10058276 3300033180 Bacteria 4000
242 Ga0373937_1294353 3300036401 Unclassified 677
243 Ga0316584_0060092 3300036712 Bacteria 2846
244 Ga0316584_0108382 3300036712 Bacteria 2078
245 Ga0395899_0000002 3300037312 Bacteria 1324310
246 Ga0395905_0317514 3300037471 Bacteria 1447
247 Ga0400490_45660 3300038726 Bacteria 57177
248 Ga0400489_12410 3300039093 Bacteria 1906
249 Ga0436365_0966128 3300039437 Bacteria 792
250 Ga0451795_0714795 3300041456 Bacteria 957
251 Ga0451795_0962500 3300041456 Bacteria 963
252 Ga0451855_0851418 3300041511 Bacteria 1137
253 Ga0439449_0046986 3300042007 Bacteria 1599
254 Ga0451577_0012740 3300042876 Bacteria 7889
255 Ga0451577_0022051 3300042876 Bacteria 5819
256 Ga0451577_0111372 3300042876 Unclassified 2449
257 Ga0451577_0256001 3300042876 Unclassified 1585
258 Ga0451577_1047458 3300042876 Bacteria 731
259 Ga0466972_0000422 3300044658 Bacteria 21982
260 Ga0453683_0000022 3300044673 Bacteria 269593
261 Ga0453683_0131134 3300044673 Unclassified 1579
262 Ga0453684_0001188 3300044712 Bacteria 80449
263 Ga0453684_0026073 3300044712 Bacteria 8461
264 Ga0453684_0026833 3300044712 Bacteria 8299
265 Ga0453684_0029715 3300044712 Bacteria 7748
266 Ga0453684_0035266 3300044712 Bacteria 6919
267 Ga0453684_0058174 3300044712 Bacteria 4995
268 Ga0453684_0909603 3300044712 Bacteria 942
269 Ga0466971_0068267 3300044719 Unclassified 1612
270 Ga0466970_0001701 3300044765 Bacteria 10578
271 Ga0466970_0284138 3300044765 Bacteria 931
272 Ga0466957_0402126 3300044842 Bacteria 937
273 Ga0466959_0009892 3300045049 Bacteria 6797
274 Ga0451576_0031425 3300045051 Bacteria 5660
275 Ga0451576_0034626 3300045051 Bacteria 5363
276 Ga0451576_0099830 3300045051 Bacteria 3019
277 Ga0451576_0263371 3300045051 Unclassified 1802
278 Ga0495592_0207953 3300046454 Bacteria 1316
279 Ga0495638_0040748 3300046460 Bacteria 2942
280 Ga0495644_0005560 3300046523 Bacteria 4919
281 Ga0495640_0228662 3300046533 Bacteria 1171
282 Ga0495621_0037833 3300046539 Bacteria 1680
283 Ga0495633_0058909 3300046558 Bacteria 1802
284 Ga0495668_0000803 3300046616 Bacteria 36102
285 Ga0495611_0000135 3300046648 Bacteria 51495
286 Ga0495661_0000739 3300046665 Bacteria 31861
287 Ga0495661_0212085 3300046665 Bacteria 1008
288 Ga0495670_0303124 3300046691 Bacteria 856
289 Ga0495600_0327823 3300046809 Bacteria 962
290 Ga0495680_0208920 3300047322 Bacteria 1398
291 Ga0495686_0000046 3300047472 Bacteria 281963
292 Ga0495686_0000994 3300047472 Bacteria 34556
293 Ga0495686_0001722 3300047472 Bacteria 22525
294 Ga0496114_0465884 3300048917 Unclassified 1118
295 Ga0496116_0005201 3300048919 Bacteria 12190
296 Ga0496117_0001253 3300048920 Bacteria 37795
297 Ga0496122_0001580 3300048925 Bacteria 35795
298 Ga0496123_0020365 3300048926 Bacteria 5190
299 Ga0496126_0021576 3300048929 Bacteria 6288
300 Ga0501298_032926 3300049521 Unclassified 1025
301 Ga0501033_0163773 3300049570 Bacteria 1600
302 Ga0501034_0014527 3300049571 Bacteria 8108
303 Ga0501038_0190619 3300049574 Bacteria 1650
304 Ga0501038_0352107 3300049574 Bacteria 1147
305 Ga0501040_0098211 3300049576 Bacteria 2041
306 Ga0501069_0053413 3300049585 Bacteria 2250
307 Ga0501069_0233134 3300049585 Bacteria 1072
308 Ga0501070_0273291 3300049586 Bacteria 1379
309 Ga0501070_0465467 3300049586 Bacteria 1018
310 Ga0501072_0240910 3300049588 Bacteria 1441
311 Ga0501074_0223372 3300049590 Bacteria 1341
312 Ga0501202_008420 3300049652 Bacteria 1879
313 Ga0501217_233112 3300049661 Unclassified 586
314 Ga0501222_009114 3300049662 Unclassified 1314
315 Ga0501223_049822 3300049663 Unclassified 813
316 Ga0501233_018231 3300049668 Bacteria 1474
317 Ga0501235_030590 3300049669 Unclassified 1214
318 Ga0501240_063734 3300049673 Unclassified 655
319 Ga0501252_002700 3300049682 Bacteria 1783
320 Ga0501256_005979 3300049685 Bacteria 1088
321 Ga0501261_011823 3300049690 Bacteria 1168
322 Ga0501221_000389 3300049704 Bacteria 6729
323 Ga0501225_0072148 3300049705 Bacteria 982
324 Ga0501245_006461 3300049708 Bacteria 1639
325 Ga0501080_0327256 3300049742 Bacteria 1386
326 Ga0501241_002066 3300049758 Bacteria 3932
327 Ga0501269_002172 3300049766 Bacteria 2443
328 Ga0501279_045385 3300049775 Unclassified 684
329 Ga0501044_0021995 3300049823 Bacteria 6800
330 Ga0501044_0048562 3300049823 Bacteria 4383
331 Ga0501044_0642092 3300049823 Bacteria 951
332 Ga0501044_0665701 3300049823 Bacteria 929
333 nmdc:mga0k408_44809_c1 3300050493 Bacteria 2551
334 nmdc:mga09592_16706_c1 3300050508 Bacteria 6007
335 Ga0500583_0022964 3300053092 Bacteria 2623
336 Ga0500641_0109976 3300053096 Bacteria 1186
337 Ga0500562_000017 3300053108 Bacteria 130556
338 Ga0500642_0237921 3300053130 Bacteria 839
339 Ga0500616_0002130 3300053153 Bacteria 17161
340 Ga0500622_0000303 3300053156 Bacteria 50358
341 Ga0500622_0000960 3300053156 Bacteria 24468
342 Ga0500622_0005533 3300053156 Bacteria 7555
343 Ga0500627_0015389 3300053158 Bacteria 2956
344 Ga0500645_023886 3300053730 Bacteria 1872
345 Ga0501084_0027666 3300054114 Bacteria 4738
346 Ga0500661_019459 3300055283 Bacteria 1209
347 Ga0501082_0205274 3300060353 Bacteria 1714

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053130 Ga0500642_0237921 Ga0500642_0237921_322_783 153
2 3300013297 Ga0157378_10131732 Ga0157378_101317322 172
3 3300005329 Ga0070683_101021950 Ga0070683_1010219501 173
4 3300005616 Ga0068852_100051596 Ga0068852_1000515963 173
5 3300013105 Ga0157369_10117799 Ga0157369_101177992 173
6 3300025944 Ga0207661_10929707 Ga0207661_109297071 173
7 3300025949 Ga0207667_10029581 Ga0207667_100295816 173
8 3300026041 Ga0207639_10013384 Ga0207639_100133842 173
9 3300026142 Ga0207698_10059510 Ga0207698_100595102 173
10 3300049661 Ga0501217_233112 Ga0501217_233112_33_563 176
11 3300049673 Ga0501240_063734 Ga0501240_063734_12_542 176
12 3300005345 Ga0070692_10523971 Ga0070692_105239712 177
13 3300005458 Ga0070681_10099765 Ga0070681_100997654 177
14 3300005530 Ga0070679_100105604 Ga0070679_1001056042 177
15 3300005614 Ga0068856_100077693 Ga0068856_1000776933 177
16 3300009174 Ga0105241_10040370 Ga0105241_100403705 177
17 3300013100 Ga0157373_10097437 Ga0157373_100974373 177
18 3300025912 Ga0207707_10065197 Ga0207707_100651972 177
19 3300025914 Ga0207671_10086893 Ga0207671_100868932 177
20 3300025921 Ga0207652_10056839 Ga0207652_100568394 177
21 3300026078 Ga0207702_10211173 Ga0207702_102111732 177
22 3300053156 Ga0500622_0005533 Ga0500622_0005533_6414_6989 177
23 3300005331 Ga0070670_100403386 Ga0070670_1004033862 182
24 3300009098 Ga0105245_10138867 Ga0105245_101388673 182
25 iso_pu_bacteria 2842903701 2842905853 183
26 iso_pu_bacteria 2881955468 2881957237 183
27 iso_pu_bacteria 2818991460 2819678661 184
28 iso_pu_bacteria 2977232053 2977233628 184
29 3300006195 Ga0075366_10020037 Ga0075366_100200372 185
30 3300013297 Ga0157378_10516852 Ga0157378_105168521 185
31 iso_pu_bacteria 2818991442 2819574451 185
32 iso_pu_bacteria 2821136567 2821137828 185
33 iso_pu_bacteria 2852623160 2852625280 185
34 iso_pu_bacteria 2884933994 2884934293 185
35 iso_pu_bacteria 2904467357 2904467421 185
36 3300005290 Ga0065712_10078098 Ga0065712_100780982 186
37 3300005331 Ga0070670_100033402 Ga0070670_1000334022 186
38 3300005340 Ga0070689_100056938 Ga0070689_1000569382 186
39 3300005365 Ga0070688_100058278 Ga0070688_1000582782 186
40 3300005466 Ga0070685_10035569 Ga0070685_100355693 186
41 3300005543 Ga0070672_100070016 Ga0070672_1000700162 186
42 3300005564 Ga0070664_100797326 Ga0070664_1007973261 186
43 3300005577 Ga0068857_100236927 Ga0068857_1002369272 186
44 3300005834 Ga0068851_10000199 Ga0068851_100001999 186
45 3300005841 Ga0068863_100128907 Ga0068863_1001289072 186
46 3300009176 Ga0105242_10324989 Ga0105242_103249892 186
47 3300009553 Ga0105249_10017145 Ga0105249_100171451 186
48 3300009553 Ga0105249_10162789 Ga0105249_101627892 186
49 3300013297 Ga0157378_10097011 Ga0157378_100970113 186
50 3300013297 Ga0157378_10238883 Ga0157378_102388832 186
51 3300013297 Ga0157378_11359926 Ga0157378_113599261 186
52 3300013306 Ga0163162_10770041 Ga0163162_107700412 186
53 3300013308 Ga0157375_10025535 Ga0157375_100255354 186
54 3300014969 Ga0157376_10306189 Ga0157376_103061892 186
55 3300017792 Ga0163161_10107243 Ga0163161_101072432 186
56 3300021384 Ga0213876_10360355 Ga0213876_103603552 186
57 3300025918 Ga0207662_10256441 Ga0207662_102564412 186
58 3300025923 Ga0207681_10100275 Ga0207681_101002752 186
59 3300025925 Ga0207650_10075515 Ga0207650_100755152 186
60 3300025936 Ga0207670_10047418 Ga0207670_100474183 186
61 3300025961 Ga0207712_10036617 Ga0207712_100366174 186
62 3300026095 Ga0207676_10680045 Ga0207676_106800452 186
63 3300028577 Ga0265318_10078372 Ga0265318_100783722 186
64 3300028794 Ga0307515_10000469 Ga0307515_100004693 186
65 3300028800 Ga0265338_10000703 Ga0265338_1000070336 186
66 3300039437 Ga0436365_0966128 Ga0436365_0966128_100_675 186
67 3300041511 Ga0451855_0851418 Ga0451855_0851418_29_610 186
68 3300046539 Ga0495621_0037833 Ga0495621_0037833_792_1367 186
69 3300049576 Ga0501040_0098211 Ga0501040_0098211_800_1360 186
70 3300049662 Ga0501222_009114 Ga0501222_009114_288_863 186
71 3300049668 Ga0501233_018231 Ga0501233_018231_322_897 186
72 3300049682 Ga0501252_002700 Ga0501252_002700_802_1377 186
73 3300049685 Ga0501256_005979 Ga0501256_005979_48_623 186
74 3300049690 Ga0501261_011823 Ga0501261_011823_533_1108 186
75 3300049704 Ga0501221_000389 Ga0501221_000389_56_631 186
76 3300049708 Ga0501245_006461 Ga0501245_006461_423_998 186
77 iso_pu_bacteria 2929154850 2929157324 186
78 3300003320 rootH2_10019063 rootH2_100190633 187
79 3300003322 rootL2_10166616 rootL2_101666162 187
80 3300003794 Ga0055531_10005359 Ga0055531_100053596 187
81 3300005327 Ga0070658_10532121 Ga0070658_105321212 187
82 3300005331 Ga0070670_100042195 Ga0070670_1000421952 187
83 3300005331 Ga0070670_100571901 Ga0070670_1005719012 187
84 3300005334 Ga0068869_100100310 Ga0068869_1001003102 187
85 3300005336 Ga0070680_100035828 Ga0070680_1000358283 187
86 3300005338 Ga0068868_101109250 Ga0068868_1011092501 187
87 3300005340 Ga0070689_100235857 Ga0070689_1002358572 187
88 3300005341 Ga0070691_10200247 Ga0070691_102002472 187
89 3300005347 Ga0070668_100079169 Ga0070668_1000791692 187
90 3300005355 Ga0070671_100138763 Ga0070671_1001387632 187
91 3300005355 Ga0070671_100767380 Ga0070671_1007673801 187
92 3300005364 Ga0070673_100303198 Ga0070673_1003031981 187
93 3300005365 Ga0070688_100421249 Ga0070688_1004212491 187
94 3300005367 Ga0070667_100019703 Ga0070667_1000197038 187
95 3300005367 Ga0070667_100025692 Ga0070667_1000256922 187
96 3300005535 Ga0070684_100002312 Ga0070684_10000231217 187
97 3300005543 Ga0070672_100836734 Ga0070672_1008367342 187
98 3300005547 Ga0070693_100104365 Ga0070693_1001043651 187
99 3300005563 Ga0068855_100039122 Ga0068855_1000391223 187
100 3300005578 Ga0068854_100571344 Ga0068854_1005713442 187
101 3300005616 Ga0068852_100010350 Ga0068852_1000103503 187
102 3300005617 Ga0068859_100000037 Ga0068859_10000003741 187
103 3300005841 Ga0068863_100002618 Ga0068863_10000261814 187
104 3300005841 Ga0068863_100059275 Ga0068863_1000592753 187
105 3300005842 Ga0068858_100063431 Ga0068858_1000634311 187
106 3300005843 Ga0068860_100013203 Ga0068860_1000132032 187
107 3300006237 Ga0097621_100001069 Ga0097621_10000106916 187
108 3300006237 Ga0097621_100023617 Ga0097621_1000236173 187
109 3300006237 Ga0097621_100357795 Ga0097621_1003577952 187
110 3300006358 Ga0068871_100018879 Ga0068871_1000188794 187
111 3300006358 Ga0068871_100024861 Ga0068871_1000248615 187
112 3300006358 Ga0068871_100391214 Ga0068871_1003912142 187
113 3300006358 Ga0068871_100413561 Ga0068871_1004135612 187
114 3300006844 Ga0075428_100032709 Ga0075428_1000327096 187
115 3300006847 Ga0075431_100640424 Ga0075431_1006404241 187
116 3300006881 Ga0068865_100110772 Ga0068865_1001107722 187
117 3300006881 Ga0068865_100997603 Ga0068865_1009976031 187
118 3300006931 Ga0097620_100000037 Ga0097620_10000003741 187
119 3300009093 Ga0105240_10000008 Ga0105240_10000008367 187
120 3300009093 Ga0105240_10000059 Ga0105240_10000059181 187
121 3300009093 Ga0105240_10031339 Ga0105240_100313395 187
122 3300009093 Ga0105240_10045664 Ga0105240_100456642 187
123 3300009093 Ga0105240_10537814 Ga0105240_105378142 187
124 3300009148 Ga0105243_10035623 Ga0105243_100356233 187
125 3300009174 Ga0105241_10001055 Ga0105241_1000105518 187
126 3300009176 Ga0105242_10201205 Ga0105242_102012052 187
127 3300009176 Ga0105242_11123533 Ga0105242_111235332 187
128 3300009177 Ga0105248_10111698 Ga0105248_101116984 187
129 3300009177 Ga0105248_11993551 Ga0105248_119935511 187
130 3300009545 Ga0105237_10001973 Ga0105237_100019739 187
131 3300009551 Ga0105238_10343678 Ga0105238_103436782 187
132 3300009551 Ga0105238_12086372 Ga0105238_120863721 187
133 3300009553 Ga0105249_10001713 Ga0105249_100017136 187
134 3300010375 Ga0105239_10001797 Ga0105239_100017975 187
135 3300010375 Ga0105239_10009494 Ga0105239_1000949412 187
136 3300010375 Ga0105239_10091532 Ga0105239_100915322 187
137 3300010375 Ga0105239_10105160 Ga0105239_101051602 187
138 3300010375 Ga0105239_10657727 Ga0105239_106577272 187
139 3300011119 Ga0105246_10039683 Ga0105246_100396832 187
140 3300013102 Ga0157371_10065090 Ga0157371_100650902 187
141 3300013102 Ga0157371_10785763 Ga0157371_107857632 187
142 3300013104 Ga0157370_10607989 Ga0157370_106079892 187
143 3300013105 Ga0157369_10451285 Ga0157369_104512852 187
144 3300013296 Ga0157374_11446416 Ga0157374_114464161 187
145 3300013297 Ga0157378_10009754 Ga0157378_100097544 187
146 3300013297 Ga0157378_10132506 Ga0157378_101325062 187
147 3300013306 Ga0163162_10003204 Ga0163162_100032041 187
148 3300013306 Ga0163162_10003269 Ga0163162_100032699 187
149 3300013307 Ga0157372_10188791 Ga0157372_101887913 187
150 3300013307 Ga0157372_10441733 Ga0157372_104417332 187
151 3300013307 Ga0157372_10562360 Ga0157372_105623602 187
152 3300013308 Ga0157375_10000651 Ga0157375_100006518 187
153 3300013308 Ga0157375_11164182 Ga0157375_111641821 187
154 3300014325 Ga0163163_10259428 Ga0163163_102594282 187
155 3300014325 Ga0163163_10291118 Ga0163163_102911182 187
156 3300014326 Ga0157380_10036613 Ga0157380_100366132 187
157 3300014968 Ga0157379_10253315 Ga0157379_102533152 187
158 3300014969 Ga0157376_10008723 Ga0157376_100087233 187
159 3300014969 Ga0157376_10012276 Ga0157376_100122764 187
160 3300014969 Ga0157376_10062153 Ga0157376_100621532 187
161 3300015265 Ga0182005_1075241 Ga0182005_10752411 187
162 3300017792 Ga0163161_10198758 Ga0163161_101987582 187
163 3300025304 Ga0209257_1000511 Ga0209257_100051166 187
164 3300025903 Ga0207680_10000619 Ga0207680_100006194 187
165 3300025911 Ga0207654_10043215 Ga0207654_100432152 187
166 3300025913 Ga0207695_10000021 Ga0207695_1000002134 187
167 3300025913 Ga0207695_10000039 Ga0207695_10000039236 187
168 3300025913 Ga0207695_10000073 Ga0207695_10000073138 187
169 3300025913 Ga0207695_10069478 Ga0207695_100694784 187
170 3300025914 Ga0207671_10002513 Ga0207671_100025136 187
171 3300025921 Ga0207652_10071284 Ga0207652_100712842 187
172 3300025924 Ga0207694_10724861 Ga0207694_107248612 187
173 3300025925 Ga0207650_10164359 Ga0207650_101643592 187
174 3300025925 Ga0207650_10387886 Ga0207650_103878862 187
175 3300025937 Ga0207669_10225036 Ga0207669_102250361 187
176 3300025938 Ga0207704_10059755 Ga0207704_100597553 187
177 3300025942 Ga0207689_10004234 Ga0207689_100042342 187
178 3300025944 Ga0207661_10068907 Ga0207661_100689073 187
179 3300025949 Ga0207667_10004126 Ga0207667_1000412611 187
180 3300025949 Ga0207667_10014742 Ga0207667_100147429 187
181 3300025960 Ga0207651_10828521 Ga0207651_108285212 187
182 3300025961 Ga0207712_10117236 Ga0207712_101172362 187
183 3300025986 Ga0207658_10049238 Ga0207658_100492383 187
184 3300025986 Ga0207658_10098083 Ga0207658_100980833 187
185 3300025986 Ga0207658_10398611 Ga0207658_103986112 187
186 3300026023 Ga0207677_10492663 Ga0207677_104926632 187
187 3300026035 Ga0207703_10037552 Ga0207703_100375522 187
188 3300026088 Ga0207641_10000226 Ga0207641_1000022611 187
189 3300026088 Ga0207641_10414230 Ga0207641_104142302 187
190 3300026095 Ga0207676_10368723 Ga0207676_103687232 187
191 3300026095 Ga0207676_10931421 Ga0207676_109314211 187
192 3300026142 Ga0207698_10023281 Ga0207698_100232813 187
193 3300028381 Ga0268264_10009695 Ga0268264_100096952 187
194 3300028800 Ga0265338_10000658 Ga0265338_100006587 187
195 3300030731 Ga0316177_1006807 Ga0316177_100680710 187
196 3300030732 Ga0316176_1209624 Ga0316176_12096242 187
197 3300030742 Ga0316183_1095896 Ga0316183_109589654 187
198 3300030744 Ga0316181_1224191 Ga0316181_12241915 187
199 3300031251 Ga0265327_10059354 Ga0265327_100593542 187
200 3300031507 Ga0307509_10116592 Ga0307509_101165923 187
201 3300031548 Ga0307408_100145348 Ga0307408_1001453482 187
202 3300031727 Ga0316576_10003339 Ga0316576_100033397 187
203 3300031728 Ga0316578_10090842 Ga0316578_100908422 187
204 3300031728 Ga0316578_10121832 Ga0316578_101218322 187
205 3300031824 Ga0307413_10024227 Ga0307413_100242273 187
206 3300031852 Ga0307410_10139976 Ga0307410_101399762 187
207 3300031911 Ga0307412_10088565 Ga0307412_100885652 187
208 3300032002 Ga0307416_100022237 Ga0307416_1000222372 187
209 3300032139 Ga0316580_10088192 Ga0316580_100881922 187
210 3300033180 Ga0307510_10058276 Ga0307510_100582764 187
211 3300036401 Ga0373937_1294353 Ga0373937_1294353_34_600 187
212 3300036712 Ga0316584_0060092 Ga0316584_0060092_918_1481 187
213 3300036712 Ga0316584_0108382 Ga0316584_0108382_100_663 187
214 3300037471 Ga0395905_0317514 Ga0395905_0317514_690_1253 187
215 3300038726 Ga0400490_45660 Ga0400490_45660_21371_21934 187
216 3300039093 Ga0400489_12410 Ga0400489_12410_869_1432 187
217 3300041456 Ga0451795_0962500 Ga0451795_0962500_155_730 187
218 3300042007 Ga0439449_0046986 Ga0439449_0046986_951_1520 187
219 3300042876 Ga0451577_0012740 Ga0451577_0012740_3810_4373 187
220 3300042876 Ga0451577_0022051 Ga0451577_0022051_1912_2475 187
221 3300042876 Ga0451577_0111372 Ga0451577_0111372_789_1358 187
222 3300042876 Ga0451577_0256001 Ga0451577_0256001_438_1022 187
223 3300044673 Ga0453683_0000022 Ga0453683_0000022_135013_135576 187
224 3300044673 Ga0453683_0131134 Ga0453683_0131134_733_1302 187
225 3300044712 Ga0453684_0001188 Ga0453684_0001188_54338_54907 187
226 3300044712 Ga0453684_0026073 Ga0453684_0026073_7532_8095 187
227 3300044712 Ga0453684_0026833 Ga0453684_0026833_4019_4582 187
228 3300044712 Ga0453684_0029715 Ga0453684_0029715_4226_4789 187
229 3300044712 Ga0453684_0035266 Ga0453684_0035266_4076_4639 187
230 3300044712 Ga0453684_0058174 Ga0453684_0058174_1096_1680 187
231 3300044712 Ga0453684_0909603 Ga0453684_0909603_128_691 187
232 3300044719 Ga0466971_0068267 Ga0466971_0068267_122_691 187
233 3300044765 Ga0466970_0284138 Ga0466970_0284138_174_743 187
234 3300044842 Ga0466957_0402126 Ga0466957_0402126_130_699 187
235 3300045049 Ga0466959_0009892 Ga0466959_0009892_1523_2092 187
236 3300045051 Ga0451576_0031425 Ga0451576_0031425_1522_2085 187
237 3300045051 Ga0451576_0034626 Ga0451576_0034626_2971_3540 187
238 3300045051 Ga0451576_0099830 Ga0451576_0099830_1859_2422 187
239 3300045051 Ga0451576_0263371 Ga0451576_0263371_814_1377 187
240 3300046454 Ga0495592_0207953 Ga0495592_0207953_375_941 187
241 3300046460 Ga0495638_0040748 Ga0495638_0040748_1571_2140 187
242 3300046533 Ga0495640_0228662 Ga0495640_0228662_221_787 187
243 3300046616 Ga0495668_0000803 Ga0495668_0000803_17239_17802 187
244 3300046809 Ga0495600_0327823 Ga0495600_0327823_110_676 187
245 3300047322 Ga0495680_0208920 Ga0495680_0208920_390_956 187
246 3300047472 Ga0495686_0000046 Ga0495686_0000046_111224_111793 187
247 3300047472 Ga0495686_0001722 Ga0495686_0001722_19571_20134 187
248 3300048917 Ga0496114_0465884 Ga0496114_0465884_354_923 187
249 3300048929 Ga0496126_0021576 Ga0496126_0021576_3446_4015 187
250 3300049521 Ga0501298_032926 Ga0501298_032926_338_925 187
251 3300049574 Ga0501038_0352107 Ga0501038_0352107_306_875 187
252 3300049585 Ga0501069_0053413 Ga0501069_0053413_651_1220 187
253 3300049586 Ga0501070_0273291 Ga0501070_0273291_313_882 187
254 3300049588 Ga0501072_0240910 Ga0501072_0240910_269_838 187
255 3300049590 Ga0501074_0223372 Ga0501074_0223372_282_851 187
256 3300049652 Ga0501202_008420 Ga0501202_008420_646_1221 187
257 3300049663 Ga0501223_049822 Ga0501223_049822_182_757 187
258 3300049669 Ga0501235_030590 Ga0501235_030590_494_1069 187
259 3300049705 Ga0501225_0072148 Ga0501225_0072148_364_939 187
260 3300049742 Ga0501080_0327256 Ga0501080_0327256_83_652 187
261 3300049758 Ga0501241_002066 Ga0501241_002066_2533_3102 187
262 3300049766 Ga0501269_002172 Ga0501269_002172_119_682 187
263 3300049775 Ga0501279_045385 Ga0501279_045385_34_609 187
264 3300049823 Ga0501044_0048562 Ga0501044_0048562_554_1126 187
265 3300049823 Ga0501044_0642092 Ga0501044_0642092_239_811 187
266 3300049823 Ga0501044_0665701 Ga0501044_0665701_307_876 187
267 3300050493 nmdc:mga0k408_44809_c1 nmdc:mga0k408_44809_c1_1831_2400 187
268 3300050508 nmdc:mga09592_16706_c1 nmdc:mga09592_16706_c1_770_1339 187
269 3300053092 Ga0500583_0022964 Ga0500583_0022964_679_1248 187
270 3300053096 Ga0500641_0109976 Ga0500641_0109976_222_785 187
271 3300053153 Ga0500616_0002130 Ga0500616_0002130_2158_2721 187
272 3300053156 Ga0500622_0000960 Ga0500622_0000960_5903_6472 187
273 3300053158 Ga0500627_0015389 Ga0500627_0015389_2039_2602 187
274 3300054114 Ga0501084_0027666 Ga0501084_0027666_2582_3151 187
275 3300060353 Ga0501082_0205274 Ga0501082_0205274_383_952 187
276 3300001990 JGI24737J22298_10060400 JGI24737J22298_100604002 188
277 3300002737 JGI25162J39368_1000107 JGI25162J39368_100010710 188
278 3300002737 JGI25162J39368_1001620 JGI25162J39368_100162010 188
279 3300003320 rootH2_10013110 rootH2_100131109 188
280 3300003323 rootH1_10162919 rootH1_101629196 188
281 3300004799 Ga0058863_10827685 Ga0058863_108276852 188
282 3300004800 Ga0058861_11293557 Ga0058861_112935572 188
283 3300004803 Ga0058862_10780518 Ga0058862_107805181 188
284 3300005288 Ga0065714_10096761 Ga0065714_100967611 188
285 3300005329 Ga0070683_100014276 Ga0070683_1000142762 188
286 3300005336 Ga0070680_100233629 Ga0070680_1002336292 188
287 3300005347 Ga0070668_100627577 Ga0070668_1006275771 188
288 3300005458 Ga0070681_10008789 Ga0070681_100087898 188
289 3300005530 Ga0070679_100029098 Ga0070679_1000290982 188
290 3300005563 Ga0068855_100236029 Ga0068855_1002360292 188
291 3300005563 Ga0068855_100389741 Ga0068855_1003897412 188
292 3300005614 Ga0068856_100152936 Ga0068856_1001529362 188
293 3300005614 Ga0068856_101032208 Ga0068856_1010322082 188
294 3300005616 Ga0068852_100319640 Ga0068852_1003196402 188
295 3300005616 Ga0068852_100855619 Ga0068852_1008556192 188
296 3300006195 Ga0075366_10004745 Ga0075366_100047455 188
297 3300006353 Ga0075370_10171272 Ga0075370_101712722 188
298 3300009174 Ga0105241_11548588 Ga0105241_115485881 188
299 3300009545 Ga0105237_10124822 Ga0105237_101248223 188
300 3300009545 Ga0105237_10353493 Ga0105237_103534932 188
301 3300013307 Ga0157372_10833344 Ga0157372_108333442 188
302 3300015261 Ga0182006_1005231 Ga0182006_10052312 188
303 3300025250 Ga0209026_1004405 Ga0209026_10044053 188
304 3300025912 Ga0207707_10007687 Ga0207707_100076872 188
305 3300025917 Ga0207660_10076271 Ga0207660_100762712 188
306 3300025921 Ga0207652_10011055 Ga0207652_100110552 188
307 3300025949 Ga0207667_10004578 Ga0207667_1000457813 188
308 3300028786 Ga0307517_10001115 Ga0307517_100011155 188
309 3300028794 Ga0307515_10216575 Ga0307515_102165752 188
310 3300028794 Ga0307515_10354443 Ga0307515_103544432 188
311 3300032004 Ga0307414_11065306 Ga0307414_110653062 188
312 3300032126 Ga0307415_100222592 Ga0307415_1002225922 188
313 3300037312 Ga0395899_0000002 Ga0395899_0000002_510894_511460 188
314 3300042876 Ga0451577_1047458 Ga0451577_1047458_101_700 188
315 3300044658 Ga0466972_0000422 Ga0466972_0000422_16838_17410 188
316 3300044765 Ga0466970_0001701 Ga0466970_0001701_8663_9235 188
317 3300046523 Ga0495644_0005560 Ga0495644_0005560_1958_2524 188
318 3300046558 Ga0495633_0058909 Ga0495633_0058909_726_1292 188
319 3300046648 Ga0495611_0000135 Ga0495611_0000135_18079_18651 188
320 3300046665 Ga0495661_0212085 Ga0495661_0212085_240_806 188
321 3300046691 Ga0495670_0303124 Ga0495670_0303124_153_719 188
322 3300047472 Ga0495686_0000994 Ga0495686_0000994_1361_1927 188
323 3300049570 Ga0501033_0163773 Ga0501033_0163773_179_751 188
324 3300049571 Ga0501034_0014527 Ga0501034_0014527_1705_2277 188
325 3300049574 Ga0501038_0190619 Ga0501038_0190619_183_755 188
326 3300049585 Ga0501069_0233134 Ga0501069_0233134_181_753 188
327 3300049586 Ga0501070_0465467 Ga0501070_0465467_326_898 188
328 3300049823 Ga0501044_0021995 Ga0501044_0021995_1617_2189 188
329 3300053156 Ga0500622_0000303 Ga0500622_0000303_27513_28079 188
330 iso_pu_bacteria 2721755487 2722726032 188
331 iso_pu_bacteria 2904780799 2904782636 188
332 iso_pu_bacteria 2919177583 2919180246 188
333 3300005458 Ga0070681_10010876 Ga0070681_1001087610 189
334 3300046665 Ga0495661_0000739 Ga0495661_0000739_9622_10191 189
335 3300053108 Ga0500562_000017 Ga0500562_000017_60750_61325 189
336 3300053730 Ga0500645_023886 Ga0500645_023886_135_710 189
337 3300055283 Ga0500661_019459 Ga0500661_019459_182_757 189
338 iso_pu_bacteria 2896317667 2896319360 189
339 iso_pu_bacteria 2896344016 2896344226 189
340 iso_pu_bacteria 3003233435 3003233460 189
341 3300005548 Ga0070665_100000074 Ga0070665_1000000745 190
342 3300028379 Ga0268266_10000010 Ga0268266_10000010628 190
343 3300031507 Ga0307509_10204227 Ga0307509_102042273 190
344 3300005618 Ga0068864_100448445 Ga0068864_1004484451 191
345 3300005843 Ga0068860_100146917 Ga0068860_1001469174 191
346 3300006931 Ga0097620_100149718 Ga0097620_1001497184 191
347 3300013297 Ga0157378_10004603 Ga0157378_100046033 191
348 3300014968 Ga0157379_10358300 Ga0157379_103583001 191
349 3300014969 Ga0157376_10274632 Ga0157376_102746322 191
350 3300026088 Ga0207641_10022489 Ga0207641_100224893 191
351 3300028381 Ga0268264_10125135 Ga0268264_101251351 191
352 3300031456 Ga0307513_10126199 Ga0307513_101261992 191
353 3300031616 Ga0307508_10067215 Ga0307508_100672152 191
354 2162886007 SwRhRL2b_contig_210851 SwRhRL2b_0104.00003970 192
355 2162886007 SwRhRL2b_contig_3634020 SwRhRL2b_0607.00003540 192
356 3300009148 Ga0105243_10000009 Ga0105243_1000000955 192
357 3300025935 Ga0207709_10000026 Ga0207709_1000002656 192
358 3300031730 Ga0307516_10001143 Ga0307516_100011435 192
359 3300041456 Ga0451795_0714795 Ga0451795_0714795_96_677 192
360 3300048919 Ga0496116_0005201 Ga0496116_0005201_11414_11992 192
361 3300048920 Ga0496117_0001253 Ga0496117_0001253_9744_10322 192
362 3300048925 Ga0496122_0001580 Ga0496122_0001580_19460_20038 192
363 3300048926 Ga0496123_0020365 Ga0496123_0020365_405_983 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

35

212

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.9034 3 180
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.9008 2 182
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.8973 4 191
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.8906 2 181
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.8825 1 182
ID Description Score Start End Superfamily
af_F1R994_49_249_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9019 8 192 3.90.870.10
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.899 4 191 3.90.870.10
af_A0A1D8PQL4_32_243_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8861 4 180 3.90.870.10
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.8798 4 192 3.90.870.10
af_P9WGC9_2_211_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.879 8 191 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A4Q3UCM4-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9936 8 163 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A4Q3E5B6-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9934 7 141 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A4Q3F7R2-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9923 7 168 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A077XMY6-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9908 69 192 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A101HFF6-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.9892 6 192 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779

Feature Viewer

pLDDT pTM Quality
92.54 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map