F422909
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 363 | 201 | 361 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100028296|Ga0068863_1000282962 |
| Length | 92 |
| Sequence | MGGLSIWHWLVVGIVVMLLFGKGRFSDMMGDVAKGIKSFKKGMTDDEDAAASTPPAKPVQQIEAQKVEPQPQSADPVAPPAATPVPEEHKQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 2 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 3 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 66 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 67 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 110 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 111 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 126 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 127 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 128 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 129 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 130 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 131 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 132 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 133 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 150 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 151 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 152 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 153 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 154 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 155 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 156 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 157 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 158 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 159 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 160 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 164 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 177 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 178 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 179 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 181 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 182 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 183 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 184 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 185 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 189 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 190 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 193 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 194 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 195 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 198 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 199 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 200 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 201 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.9 |
| Metatranscriptomes | 0.55 |
| Isolates | 0.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.19 |
| Nodule | 0 |
| Rhizoplane | 3.03 |
| Rhizosphere | 77.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J14986_104728 | 3300001432 | Bacteria | 561 |
| 2 | JGI24752J21851_1000861 | 3300001976 | Bacteria | 4117 |
| 3 | JGI24748J21848_1000097 | 3300002074 | Bacteria | 23021 |
| 4 | JGI24034J26672_10000060 | 3300002239 | Bacteria | 41095 |
| 5 | JGI24742J22300_10039560 | 3300002244 | Bacteria | 838 |
| 6 | JGI24751J29686_10009164 | 3300002459 | Bacteria | 2032 |
| 7 | Ga0055536_1002976 | 3300003781 | Bacteria | 9281 |
| 8 | Ga0055536_1003397 | 3300003781 | Bacteria | 8570 |
| 9 | Ga0055536_1018865 | 3300003781 | Bacteria | 2191 |
| 10 | Ga0055530_10000013 | 3300003791 | Bacteria | 153390 |
| 11 | Ga0055530_10047246 | 3300003791 | Bacteria | 1018 |
| 12 | Ga0070658_10000086 | 3300005327 | Bacteria | 86563 |
| 13 | Ga0070670_100220735 | 3300005331 | Bacteria | 1649 |
| 14 | Ga0070666_10000069 | 3300005335 | Bacteria | 75768 |
| 15 | Ga0070666_10000129 | 3300005335 | Bacteria | 53219 |
| 16 | Ga0070666_10047456 | 3300005335 | Bacteria | 2883 |
| 17 | Ga0068868_100000503 | 3300005338 | Bacteria | 26082 |
| 18 | Ga0070660_100000197 | 3300005339 | Bacteria | 40265 |
| 19 | Ga0070660_100000856 | 3300005339 | Bacteria | 20282 |
| 20 | Ga0070660_100055989 | 3300005339 | Bacteria | 3050 |
| 21 | Ga0070660_101848148 | 3300005339 | Bacteria | 515 |
| 22 | Ga0070689_100003334 | 3300005340 | Bacteria | 10668 |
| 23 | Ga0070689_101192512 | 3300005340 | Bacteria | 683 |
| 24 | Ga0070661_100000011 | 3300005344 | Bacteria | 175355 |
| 25 | Ga0070692_10003531 | 3300005345 | Bacteria | 6356 |
| 26 | Ga0070668_100005753 | 3300005347 | Bacteria | 9197 |
| 27 | Ga0070668_100039704 | 3300005347 | Bacteria | 3599 |
| 28 | Ga0070668_100165852 | 3300005347 | Bacteria | 1795 |
| 29 | Ga0070668_100350533 | 3300005347 | Bacteria | 1249 |
| 30 | Ga0070668_100459315 | 3300005347 | Bacteria | 1096 |
| 31 | Ga0070669_100000004 | 3300005353 | Bacteria | 314707 |
| 32 | Ga0070669_100000167 | 3300005353 | Bacteria | 57589 |
| 33 | Ga0070669_100451890 | 3300005353 | Bacteria | 1059 |
| 34 | Ga0070669_100526896 | 3300005353 | Bacteria | 983 |
| 35 | Ga0070671_100000004 | 3300005355 | Bacteria | 262155 |
| 36 | Ga0070671_100012110 | 3300005355 | Bacteria | 6941 |
| 37 | Ga0070671_100973485 | 3300005355 | Bacteria | 743 |
| 38 | Ga0070674_100572421 | 3300005356 | Bacteria | 951 |
| 39 | Ga0070688_100004979 | 3300005365 | Bacteria | 6950 |
| 40 | Ga0070659_100000159 | 3300005366 | Bacteria | 51703 |
| 41 | Ga0070659_100002714 | 3300005366 | Bacteria | 12587 |
| 42 | Ga0070659_100054626 | 3300005366 | Bacteria | 3146 |
| 43 | Ga0070659_101986222 | 3300005366 | Bacteria | 522 |
| 44 | Ga0070667_100000036 | 3300005367 | Bacteria | 172536 |
| 45 | Ga0070667_100064227 | 3300005367 | Bacteria | 3114 |
| 46 | Ga0070700_100569346 | 3300005441 | Bacteria | 883 |
| 47 | Ga0070700_100970211 | 3300005441 | Bacteria | 697 |
| 48 | Ga0070708_100355842 | 3300005445 | Bacteria | 1380 |
| 49 | Ga0070708_100772724 | 3300005445 | Bacteria | 903 |
| 50 | Ga0070678_100736769 | 3300005456 | Bacteria | 890 |
| 51 | Ga0070662_100553847 | 3300005457 | Bacteria | 964 |
| 52 | Ga0070685_10000036 | 3300005466 | Bacteria | 80641 |
| 53 | Ga0068853_100691996 | 3300005539 | Bacteria | 972 |
| 54 | Ga0070686_100000045 | 3300005544 | Bacteria | 101988 |
| 55 | Ga0070696_101097464 | 3300005546 | Bacteria | 669 |
| 56 | Ga0070665_100000042 | 3300005548 | Bacteria | 292582 |
| 57 | Ga0070665_100034565 | 3300005548 | Bacteria | 5083 |
| 58 | Ga0070704_101170748 | 3300005549 | Bacteria | 700 |
| 59 | Ga0068857_101099510 | 3300005577 | Bacteria | 767 |
| 60 | Ga0068854_102064006 | 3300005578 | Bacteria | 526 |
| 61 | Ga0068852_101349400 | 3300005616 | Bacteria | 735 |
| 62 | Ga0068859_100008727 | 3300005617 | Bacteria | 10240 |
| 63 | Ga0068859_100026991 | 3300005617 | Bacteria | 5761 |
| 64 | Ga0068859_100086420 | 3300005617 | Bacteria | 3183 |
| 65 | Ga0068859_100156542 | 3300005617 | Bacteria | 2356 |
| 66 | Ga0068859_100384456 | 3300005617 | Bacteria | 1499 |
| 67 | Ga0068864_100000736 | 3300005618 | Bacteria | 27421 |
| 68 | Ga0068861_100005577 | 3300005719 | Bacteria | 8530 |
| 69 | Ga0068861_101303667 | 3300005719 | Bacteria | 706 |
| 70 | Ga0068863_100000239 | 3300005841 | Bacteria | 58509 |
| 71 | Ga0068863_100000845 | 3300005841 | Bacteria | 30656 |
| 72 | Ga0068863_100004067 | 3300005841 | Bacteria | 14443 |
| 73 | Ga0068863_100028296 | 3300005841 | Bacteria | 5351 |
| 74 | Ga0068858_100000659 | 3300005842 | Bacteria | 36067 |
| 75 | Ga0068858_100003763 | 3300005842 | Bacteria | 15003 |
| 76 | Ga0068858_101414752 | 3300005842 | Bacteria | 685 |
| 77 | Ga0068860_100000063 | 3300005843 | Bacteria | 189519 |
| 78 | Ga0068860_100000182 | 3300005843 | Bacteria | 100888 |
| 79 | Ga0068860_100002979 | 3300005843 | Bacteria | 17493 |
| 80 | Ga0068860_100571226 | 3300005843 | Bacteria | 1134 |
| 81 | Ga0068860_101111201 | 3300005843 | Bacteria | 810 |
| 82 | Ga0068860_101882225 | 3300005843 | Bacteria | 620 |
| 83 | Ga0068862_100000067 | 3300005844 | Bacteria | 123668 |
| 84 | Ga0068862_100000392 | 3300005844 | Bacteria | 47165 |
| 85 | Ga0068862_100001195 | 3300005844 | Bacteria | 24489 |
| 86 | Ga0068862_100005835 | 3300005844 | Bacteria | 10261 |
| 87 | Ga0068862_100302671 | 3300005844 | Bacteria | 1471 |
| 88 | Ga0068862_101719104 | 3300005844 | Bacteria | 636 |
| 89 | Ga0075430_100007566 | 3300006846 | Bacteria | 9175 |
| 90 | Ga0097620_100008726 | 3300006931 | Bacteria | 10240 |
| 91 | Ga0097620_100026991 | 3300006931 | Bacteria | 5761 |
| 92 | Ga0097620_100086416 | 3300006931 | Bacteria | 3183 |
| 93 | Ga0097620_100156538 | 3300006931 | Bacteria | 2356 |
| 94 | Ga0097620_100384436 | 3300006931 | Bacteria | 1499 |
| 95 | Ga0105250_10011581 | 3300009092 | Bacteria | 3657 |
| 96 | Ga0111539_11292568 | 3300009094 | Bacteria | 847 |
| 97 | Ga0105245_10161479 | 3300009098 | Bacteria | 2127 |
| 98 | Ga0105245_10161701 | 3300009098 | Bacteria | 2125 |
| 99 | Ga0105247_10014686 | 3300009101 | Bacteria | 4694 |
| 100 | Ga0105247_10231573 | 3300009101 | Bacteria | 1255 |
| 101 | Ga0105248_10214434 | 3300009177 | Bacteria | 2168 |
| 102 | Ga0105248_10229550 | 3300009177 | Bacteria | 2089 |
| 103 | Ga0105249_10000012 | 3300009553 | Bacteria | 292640 |
| 104 | Ga0105249_10000105 | 3300009553 | Bacteria | 117181 |
| 105 | Ga0105249_10032169 | 3300009553 | Bacteria | 4745 |
| 106 | Ga0105249_10083720 | 3300009553 | Bacteria | 2970 |
| 107 | Ga0105249_10174207 | 3300009553 | Bacteria | 2088 |
| 108 | Ga0105249_11227729 | 3300009553 | Bacteria | 821 |
| 109 | Ga0105148_103453 | 3300009978 | Bacteria | 1120 |
| 110 | Ga0157373_10404722 | 3300013100 | Bacteria | 978 |
| 111 | Ga0157370_10451308 | 3300013104 | Bacteria | 1182 |
| 112 | Ga0157370_10934350 | 3300013104 | Bacteria | 786 |
| 113 | Ga0157369_10067925 | 3300013105 | Bacteria | 3830 |
| 114 | Ga0163162_10065894 | 3300013306 | Bacteria | 3671 |
| 115 | Ga0163162_10326940 | 3300013306 | Bacteria | 1666 |
| 116 | Ga0163162_10638187 | 3300013306 | Bacteria | 1189 |
| 117 | Ga0163162_11275452 | 3300013306 | Bacteria | 834 |
| 118 | Ga0157372_10401395 | 3300013307 | Bacteria | 1597 |
| 119 | Ga0157372_10632303 | 3300013307 | Bacteria | 1247 |
| 120 | Ga0157375_10189103 | 3300013308 | Bacteria | 2213 |
| 121 | Ga0163163_10131728 | 3300014325 | Bacteria | 2541 |
| 122 | Ga0163163_10248142 | 3300014325 | Bacteria | 1831 |
| 123 | Ga0157380_10001468 | 3300014326 | Bacteria | 15436 |
| 124 | Ga0157380_10001964 | 3300014326 | Bacteria | 13685 |
| 125 | Ga0157380_10331000 | 3300014326 | Bacteria | 1416 |
| 126 | Ga0157379_10011656 | 3300014968 | Bacteria | 7676 |
| 127 | Ga0157379_10163230 | 3300014968 | Bacteria | 2011 |
| 128 | Ga0157379_10304243 | 3300014968 | Bacteria | 1453 |
| 129 | Ga0163161_10000387 | 3300017792 | Bacteria | 36952 |
| 130 | Ga0213873_10000042 | 3300021358 | Bacteria | 30839 |
| 131 | Ga0213876_10000050 | 3300021384 | Bacteria | 144836 |
| 132 | Ga0213876_10001602 | 3300021384 | Bacteria | 13897 |
| 133 | Ga0207672_1001171 | 3300025223 | Bacteria | 2285 |
| 134 | Ga0209675_1000275 | 3300025291 | Bacteria | 49474 |
| 135 | Ga0209676_1000349 | 3300025292 | Bacteria | 87517 |
| 136 | Ga0209676_1000453 | 3300025292 | Bacteria | 69137 |
| 137 | Ga0209676_1000648 | 3300025292 | Bacteria | 49941 |
| 138 | Ga0209676_1023969 | 3300025292 | Bacteria | 1987 |
| 139 | Ga0209025_1015485 | 3300025294 | Bacteria | 4592 |
| 140 | Ga0209758_1099264 | 3300025297 | Bacteria | 832 |
| 141 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 142 | Ga0209050_1000822 | 3300025298 | Bacteria | 43254 |
| 143 | Ga0209050_1038989 | 3300025298 | Bacteria | 1345 |
| 144 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 145 | Ga0207697_10000502 | 3300025315 | Bacteria | 22013 |
| 146 | Ga0207696_1153544 | 3300025711 | Bacteria | 614 |
| 147 | Ga0207710_10002821 | 3300025900 | Bacteria | 7922 |
| 148 | Ga0207710_10125201 | 3300025900 | Bacteria | 1230 |
| 149 | Ga0207680_10000012 | 3300025903 | Bacteria | 293810 |
| 150 | Ga0207680_10000106 | 3300025903 | Bacteria | 38390 |
| 151 | Ga0207680_10053560 | 3300025903 | Bacteria | 2423 |
| 152 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 153 | Ga0207657_10006128 | 3300025919 | Bacteria | 12497 |
| 154 | Ga0207657_10013217 | 3300025919 | Bacteria | 8103 |
| 155 | Ga0207657_10049485 | 3300025919 | Bacteria | 3662 |
| 156 | Ga0207649_10000221 | 3300025920 | Bacteria | 46316 |
| 157 | Ga0207652_11703060 | 3300025921 | Bacteria | 535 |
| 158 | Ga0207681_10000010 | 3300025923 | Bacteria | 403379 |
| 159 | Ga0207681_10000076 | 3300025923 | Bacteria | 89353 |
| 160 | Ga0207650_10118113 | 3300025925 | Bacteria | 2061 |
| 161 | Ga0207650_10180957 | 3300025925 | Bacteria | 1680 |
| 162 | Ga0207659_10111132 | 3300025926 | Bacteria | 2084 |
| 163 | Ga0207687_10130685 | 3300025927 | Bacteria | 1892 |
| 164 | Ga0207687_10223224 | 3300025927 | Bacteria | 1485 |
| 165 | Ga0207644_10000007 | 3300025931 | Bacteria | 381778 |
| 166 | Ga0207644_10011602 | 3300025931 | Bacteria | 5833 |
| 167 | Ga0207644_10851554 | 3300025931 | Bacteria | 763 |
| 168 | Ga0207690_10000177 | 3300025932 | Bacteria | 49108 |
| 169 | Ga0207690_10001952 | 3300025932 | Bacteria | 12643 |
| 170 | Ga0207706_10092075 | 3300025933 | Bacteria | 2666 |
| 171 | Ga0207670_10386629 | 3300025936 | Bacteria | 1116 |
| 172 | Ga0207670_11080939 | 3300025936 | Bacteria | 677 |
| 173 | Ga0207711_10053556 | 3300025941 | Bacteria | 3460 |
| 174 | Ga0207711_10135504 | 3300025941 | Bacteria | 2211 |
| 175 | Ga0207651_12131796 | 3300025960 | Bacteria | 503 |
| 176 | Ga0207712_10000015 | 3300025961 | Bacteria | 346689 |
| 177 | Ga0207712_10000021 | 3300025961 | Bacteria | 292649 |
| 178 | Ga0207712_10071807 | 3300025961 | Bacteria | 2490 |
| 179 | Ga0207712_10561612 | 3300025961 | Bacteria | 983 |
| 180 | Ga0207712_10718816 | 3300025961 | Bacteria | 873 |
| 181 | Ga0207668_10000156 | 3300025972 | Bacteria | 47336 |
| 182 | Ga0207668_10008280 | 3300025972 | Bacteria | 6195 |
| 183 | Ga0207668_10083261 | 3300025972 | Bacteria | 2327 |
| 184 | Ga0207668_10193370 | 3300025972 | Bacteria | 1614 |
| 185 | Ga0207668_10979047 | 3300025972 | Bacteria | 755 |
| 186 | Ga0207668_11828255 | 3300025972 | Bacteria | 548 |
| 187 | Ga0207640_10014352 | 3300025981 | Bacteria | 4559 |
| 188 | Ga0207640_10758096 | 3300025981 | Bacteria | 837 |
| 189 | Ga0207658_10000083 | 3300025986 | Bacteria | 104502 |
| 190 | Ga0207658_10000826 | 3300025986 | Bacteria | 25872 |
| 191 | Ga0207677_10001450 | 3300026023 | Bacteria | 12555 |
| 192 | Ga0207703_10001618 | 3300026035 | Bacteria | 20317 |
| 193 | Ga0207703_10094183 | 3300026035 | Bacteria | 2524 |
| 194 | Ga0207639_10390542 | 3300026041 | Bacteria | 1252 |
| 195 | Ga0207708_10622744 | 3300026075 | Bacteria | 916 |
| 196 | Ga0207641_10000410 | 3300026088 | Bacteria | 50167 |
| 197 | Ga0207641_10004799 | 3300026088 | Bacteria | 11651 |
| 198 | Ga0207641_10021668 | 3300026088 | Bacteria | 5279 |
| 199 | Ga0207641_10172618 | 3300026088 | Bacteria | 1974 |
| 200 | Ga0207648_12004065 | 3300026089 | Bacteria | 540 |
| 201 | Ga0207676_10005009 | 3300026095 | Bacteria | 9384 |
| 202 | Ga0207676_10202626 | 3300026095 | Bacteria | 1754 |
| 203 | Ga0207675_100000075 | 3300026118 | Bacteria | 76201 |
| 204 | Ga0207675_100013675 | 3300026118 | Bacteria | 7574 |
| 205 | Ga0207675_101165311 | 3300026118 | Bacteria | 791 |
| 206 | Ga0207698_11188877 | 3300026142 | Bacteria | 776 |
| 207 | Ga0209998_10028737 | 3300027717 | Bacteria | 1223 |
| 208 | Ga0268266_10000054 | 3300028379 | Bacteria | 292717 |
| 209 | Ga0268266_10006558 | 3300028379 | Bacteria | 10641 |
| 210 | Ga0268266_11132212 | 3300028379 | Bacteria | 757 |
| 211 | Ga0268266_11680332 | 3300028379 | Bacteria | 610 |
| 212 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 213 | Ga0268265_10000278 | 3300028380 | Bacteria | 58293 |
| 214 | Ga0268265_10001179 | 3300028380 | Bacteria | 22889 |
| 215 | Ga0268265_10019888 | 3300028380 | Bacteria | 4676 |
| 216 | Ga0268265_10039089 | 3300028380 | Bacteria | 3494 |
| 217 | Ga0268264_10000083 | 3300028381 | Bacteria | 245366 |
| 218 | Ga0268264_10000106 | 3300028381 | Bacteria | 210031 |
| 219 | Ga0268264_10000764 | 3300028381 | Bacteria | 35781 |
| 220 | Ga0268264_10003943 | 3300028381 | Bacteria | 12705 |
| 221 | Ga0268264_10051497 | 3300028381 | Bacteria | 3431 |
| 222 | Ga0268264_11090069 | 3300028381 | Bacteria | 807 |
| 223 | Ga0307517_10390841 | 3300028786 | Bacteria | 740 |
| 224 | Ga0316183_1210559 | 3300030742 | Bacteria | 1453 |
| 225 | Ga0316182_1269164 | 3300030745 | Bacteria | 582 |
| 226 | Ga0307513_10170931 | 3300031456 | Bacteria | 2051 |
| 227 | Ga0307408_100025798 | 3300031548 | Bacteria | 4028 |
| 228 | Ga0307408_100059846 | 3300031548 | Bacteria | 2774 |
| 229 | Ga0307408_100159743 | 3300031548 | Bacteria | 1789 |
| 230 | Ga0307405_10004719 | 3300031731 | Bacteria | 6487 |
| 231 | Ga0307405_10012331 | 3300031731 | Bacteria | 4518 |
| 232 | Ga0307410_10652279 | 3300031852 | Bacteria | 883 |
| 233 | Ga0307406_10001642 | 3300031901 | Bacteria | 12289 |
| 234 | Ga0307412_10001919 | 3300031911 | Bacteria | 11484 |
| 235 | Ga0307412_10002795 | 3300031911 | Bacteria | 9694 |
| 236 | Ga0307412_10009604 | 3300031911 | Bacteria | 5556 |
| 237 | Ga0307412_10391954 | 3300031911 | Bacteria | 1128 |
| 238 | Ga0307412_11007917 | 3300031911 | Bacteria | 736 |
| 239 | Ga0307416_100021750 | 3300032002 | Bacteria | 4612 |
| 240 | Ga0307416_100305941 | 3300032002 | Bacteria | 1583 |
| 241 | Ga0307416_101185615 | 3300032002 | Bacteria | 869 |
| 242 | Ga0307416_102772434 | 3300032002 | Bacteria | 586 |
| 243 | Ga0307414_10001123 | 3300032004 | Bacteria | 13682 |
| 244 | Ga0307414_10008032 | 3300032004 | Bacteria | 5965 |
| 245 | Ga0307414_10048300 | 3300032004 | Bacteria | 2935 |
| 246 | Ga0307414_10461475 | 3300032004 | Bacteria | 1116 |
| 247 | Ga0307414_10536722 | 3300032004 | Bacteria | 1040 |
| 248 | Ga0307411_10055119 | 3300032005 | Bacteria | 2614 |
| 249 | Ga0307411_10371537 | 3300032005 | Bacteria | 1173 |
| 250 | Ga0307411_11914375 | 3300032005 | Bacteria | 552 |
| 251 | Ga0307415_102425608 | 3300032126 | Bacteria | 516 |
| 252 | Ga0307510_10046515 | 3300033180 | Bacteria | 4664 |
| 253 | Ga0395905_0216150 | 3300037471 | Bacteria | 1795 |
| 254 | Ga0395901_0068076 | 3300038443 | Bacteria | 3709 |
| 255 | Ga0395901_0223048 | 3300038443 | Bacteria | 1970 |
| 256 | Ga0436365_0083893 | 3300039437 | Bacteria | 1171 |
| 257 | Ga0436365_1595987 | 3300039437 | Bacteria | 26536 |
| 258 | Ga0436365_1697258 | 3300039437 | Bacteria | 30915 |
| 259 | Ga0436363_0702332 | 3300039450 | Bacteria | 2106 |
| 260 | Ga0436362_1132945 | 3300039453 | Bacteria | 19454 |
| 261 | Ga0439461_0120312 | 3300041410 | Bacteria | 656 |
| 262 | Ga0451791_0426158 | 3300041451 | Bacteria | 609 |
| 263 | Ga0451797_0725346 | 3300041453 | Bacteria | 674 |
| 264 | Ga0439445_0093039 | 3300042004 | Bacteria | 850 |
| 265 | Ga0439434_0188174 | 3300042435 | Bacteria | 693 |
| 266 | Ga0495620_0276638 | 3300046515 | Bacteria | 639 |
| 267 | Ga0495663_0250841 | 3300046525 | Bacteria | 628 |
| 268 | Ga0495654_0000999 | 3300046530 | Bacteria | 20769 |
| 269 | Ga0495654_0138190 | 3300046530 | Bacteria | 1088 |
| 270 | Ga0495668_0006190 | 3300046616 | Bacteria | 7906 |
| 271 | Ga0495668_0012944 | 3300046616 | Bacteria | 4938 |
| 272 | Ga0495625_0000652 | 3300046660 | Bacteria | 49796 |
| 273 | Ga0495670_0042357 | 3300046691 | Bacteria | 2271 |
| 274 | Ga0495671_0180652 | 3300046692 | Bacteria | 1025 |
| 275 | Ga0495589_0047816 | 3300046794 | Bacteria | 2119 |
| 276 | Ga0495673_0043055 | 3300047469 | Bacteria | 2023 |
| 277 | Ga0495681_0204586 | 3300047470 | Bacteria | 799 |
| 278 | Ga0495686_0304605 | 3300047472 | Bacteria | 878 |
| 279 | Ga0496101_0443686 | 3300048904 | Bacteria | 1024 |
| 280 | Ga0496102_0000010 | 3300048905 | Bacteria | 324617 |
| 281 | Ga0496102_0002069 | 3300048905 | Bacteria | 17283 |
| 282 | Ga0496103_0000029 | 3300048906 | Bacteria | 213326 |
| 283 | Ga0496103_0011551 | 3300048906 | Bacteria | 5235 |
| 284 | Ga0496104_0127839 | 3300048907 | Bacteria | 2440 |
| 285 | Ga0496106_0717801 | 3300048909 | Bacteria | 796 |
| 286 | Ga0496107_0257426 | 3300048910 | Bacteria | 1299 |
| 287 | Ga0496111_0549159 | 3300048914 | Bacteria | 848 |
| 288 | Ga0496116_0002331 | 3300048919 | Bacteria | 20105 |
| 289 | Ga0496117_0000037 | 3300048920 | Bacteria | 324960 |
| 290 | Ga0496117_0009462 | 3300048920 | Bacteria | 9064 |
| 291 | Ga0496117_0012147 | 3300048920 | Bacteria | 7628 |
| 292 | Ga0496118_0000034 | 3300048921 | Bacteria | 322764 |
| 293 | Ga0496118_0000811 | 3300048921 | Bacteria | 49879 |
| 294 | Ga0496118_0188896 | 3300048921 | Bacteria | 1234 |
| 295 | Ga0496119_0230268 | 3300048922 | Bacteria | 943 |
| 296 | Ga0496120_0164149 | 3300048923 | Bacteria | 1104 |
| 297 | Ga0496121_0033968 | 3300048924 | Bacteria | 4602 |
| 298 | Ga0496122_0407546 | 3300048925 | Bacteria | 688 |
| 299 | Ga0496123_0013439 | 3300048926 | Bacteria | 6874 |
| 300 | Ga0496123_0246398 | 3300048926 | Bacteria | 884 |
| 301 | Ga0496124_0000033 | 3300048927 | Bacteria | 330586 |
| 302 | Ga0496124_0118730 | 3300048927 | Bacteria | 2117 |
| 303 | Ga0496124_0220408 | 3300048927 | Bacteria | 1427 |
| 304 | Ga0496124_0671941 | 3300048927 | Bacteria | 661 |
| 305 | Ga0496125_0252752 | 3300048928 | Bacteria | 1111 |
| 306 | Ga0496125_0706696 | 3300048928 | Bacteria | 534 |
| 307 | Ga0496126_0264071 | 3300048929 | Bacteria | 1431 |
| 308 | Ga0496126_0836927 | 3300048929 | Bacteria | 703 |
| 309 | Ga0496126_1161552 | 3300048929 | Bacteria | 570 |
| 310 | Ga0495678_149587 | 3300049459 | Bacteria | 755 |
| 311 | Ga0501290_091072 | 3300049513 | Bacteria | 531 |
| 312 | Ga0501314_000311 | 3300049530 | Bacteria | 2881 |
| 313 | Ga0501335_020962 | 3300049551 | Bacteria | 698 |
| 314 | Ga0501032_0119275 | 3300049569 | Bacteria | 1744 |
| 315 | Ga0501033_0287546 | 3300049570 | Bacteria | 1159 |
| 316 | Ga0501034_0006999 | 3300049571 | Bacteria | 12042 |
| 317 | Ga0501034_0068953 | 3300049571 | Bacteria | 3547 |
| 318 | Ga0501036_0209944 | 3300049572 | Bacteria | 1636 |
| 319 | Ga0501037_0134197 | 3300049573 | Bacteria | 1773 |
| 320 | Ga0501038_0031513 | 3300049574 | Bacteria | 4685 |
| 321 | Ga0501039_0389669 | 3300049575 | Bacteria | 1094 |
| 322 | Ga0501043_0045523 | 3300049579 | Bacteria | 3451 |
| 323 | Ga0501046_0176618 | 3300049580 | Bacteria | 1599 |
| 324 | Ga0501070_0572056 | 3300049586 | Bacteria | 903 |
| 325 | Ga0501223_000227 | 3300049663 | Bacteria | 14454 |
| 326 | Ga0501223_028808 | 3300049663 | Bacteria | 1081 |
| 327 | Ga0501224_000030 | 3300049664 | Bacteria | 45775 |
| 328 | Ga0501233_002383 | 3300049668 | Bacteria | 3305 |
| 329 | Ga0501235_049936 | 3300049669 | Bacteria | 968 |
| 330 | Ga0501257_000019 | 3300049686 | Bacteria | 47149 |
| 331 | Ga0501225_0000009 | 3300049705 | Bacteria | 90065 |
| 332 | Ga0501229_034179 | 3300049706 | Bacteria | 706 |
| 333 | Ga0501234_002981 | 3300049707 | Bacteria | 2658 |
| 334 | Ga0501280_001184 | 3300049776 | Bacteria | 5114 |
| 335 | Ga0501035_0149915 | 3300049822 | Bacteria | 2024 |
| 336 | Ga0501044_0056725 | 3300049823 | Bacteria | 4021 |
| 337 | Ga0501045_1073349 | 3300049824 | Bacteria | 589 |
| 338 | Ga0501226_000054 | 3300049853 | Bacteria | 39689 |
| 339 | nmdc:mga0k408_163766_c1 | 3300050493 | Bacteria | 1325 |
| 340 | nmdc:mga0qj67_158416_c1 | 3300050509 | Bacteria | 1838 |
| 341 | nmdc:mga08y16_1166447_c1 | 3300050511 | Bacteria | 742 |
| 342 | Ga0500643_000151 | 3300053087 | Bacteria | 70674 |
| 343 | Ga0500646_0033566 | 3300053090 | Bacteria | 1420 |
| 344 | Ga0500592_000316 | 3300053116 | Bacteria | 8295 |
| 345 | Ga0500592_001181 | 3300053116 | Bacteria | 4252 |
| 346 | Ga0500592_025783 | 3300053116 | Bacteria | 948 |
| 347 | Ga0500592_077988 | 3300053116 | Bacteria | 549 |
| 348 | Ga0500618_148181 | 3300053125 | Bacteria | 535 |
| 349 | Ga0500658_0032270 | 3300053134 | Bacteria | 2053 |
| 350 | Ga0500658_0478150 | 3300053134 | Bacteria | 565 |
| 351 | Ga0500568_0001107 | 3300053139 | Bacteria | 18110 |
| 352 | Ga0500577_0348956 | 3300053142 | Bacteria | 647 |
| 353 | Ga0500604_0000017 | 3300053151 | Bacteria | 82010 |
| 354 | Ga0500604_0020018 | 3300053151 | Bacteria | 1879 |
| 355 | Ga0500627_0000005 | 3300053158 | Bacteria | 167950 |
| 356 | Ga0500627_0000495 | 3300053158 | Bacteria | 10626 |
| 357 | Ga0500627_0007085 | 3300053158 | Bacteria | 3874 |
| 358 | Ga0500627_0107933 | 3300053158 | Bacteria | 1252 |
| 359 | Ga0500627_0260946 | 3300053158 | Bacteria | 764 |
| 360 | Ga0500627_0507621 | 3300053158 | Bacteria | 501 |
| 361 | Ga0500611_053764 | 3300053727 | Bacteria | 931 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100054626 | Ga0070659_1000546264 | 69 |
| 2 | 3300005578 | Ga0068854_102064006 | Ga0068854_1020640062 | 69 |
| 3 | 3300005335 | Ga0070666_10000129 | Ga0070666_1000012938 | 70 |
| 4 | 3300005340 | Ga0070689_101192512 | Ga0070689_1011925122 | 70 |
| 5 | 3300005353 | Ga0070669_100000004 | Ga0070669_100000004206 | 70 |
| 6 | 3300005548 | Ga0070665_100034565 | Ga0070665_1000345654 | 70 |
| 7 | 3300005844 | Ga0068862_100001195 | Ga0068862_10000119518 | 70 |
| 8 | 3300009553 | Ga0105249_10083720 | Ga0105249_100837202 | 70 |
| 9 | 3300013306 | Ga0163162_11275452 | Ga0163162_112754522 | 70 |
| 10 | 3300025315 | Ga0207697_10000502 | Ga0207697_1000050221 | 70 |
| 11 | 3300025903 | Ga0207680_10000106 | Ga0207680_1000010626 | 70 |
| 12 | 3300025923 | Ga0207681_10000010 | Ga0207681_10000010201 | 70 |
| 13 | 3300025936 | Ga0207670_11080939 | Ga0207670_110809392 | 70 |
| 14 | 3300028379 | Ga0268266_10006558 | Ga0268266_100065587 | 70 |
| 15 | 3300028380 | Ga0268265_10001179 | Ga0268265_1000117918 | 70 |
| 16 | 3300005456 | Ga0070678_100736769 | Ga0070678_1007367692 | 71 |
| 17 | 3300005457 | Ga0070662_100553847 | Ga0070662_1005538472 | 71 |
| 18 | 3300005539 | Ga0068853_100691996 | Ga0068853_1006919962 | 71 |
| 19 | 3300025933 | Ga0207706_10092075 | Ga0207706_100920752 | 71 |
| 20 | 3300026041 | Ga0207639_10390542 | Ga0207639_103905422 | 71 |
| 21 | 3300026089 | Ga0207648_12004065 | Ga0207648_120040652 | 71 |
| 22 | 3300039437 | Ga0436365_0083893 | Ga0436365_0083893_41_286 | 71 |
| 23 | 3300005355 | Ga0070671_100000004 | Ga0070671_100000004184 | 72 |
| 24 | 3300005618 | Ga0068864_100000736 | Ga0068864_10000073626 | 72 |
| 25 | 3300014325 | Ga0163163_10131728 | Ga0163163_101317282 | 72 |
| 26 | 3300014326 | Ga0157380_10331000 | Ga0157380_103310003 | 72 |
| 27 | 3300014968 | Ga0157379_10163230 | Ga0157379_101632303 | 72 |
| 28 | 3300014968 | Ga0157379_10304243 | Ga0157379_103042433 | 72 |
| 29 | 3300025931 | Ga0207644_10000007 | Ga0207644_10000007188 | 72 |
| 30 | 3300025961 | Ga0207712_10561612 | Ga0207712_105616121 | 72 |
| 31 | 3300026095 | Ga0207676_10005009 | Ga0207676_100050095 | 72 |
| 32 | 3300005327 | Ga0070658_10000086 | Ga0070658_100000863 | 73 |
| 33 | 3300005339 | Ga0070660_100000197 | Ga0070660_1000001972 | 73 |
| 34 | 3300005339 | Ga0070660_100055989 | Ga0070660_1000559896 | 73 |
| 35 | 3300005344 | Ga0070661_100000011 | Ga0070661_10000001125 | 73 |
| 36 | 3300005366 | Ga0070659_100002714 | Ga0070659_10000271415 | 73 |
| 37 | 3300005441 | Ga0070700_100569346 | Ga0070700_1005693461 | 73 |
| 38 | 3300013104 | Ga0157370_10934350 | Ga0157370_109343502 | 73 |
| 39 | 3300025292 | Ga0209676_1023969 | Ga0209676_10239693 | 73 |
| 40 | 3300025909 | Ga0207705_10000002 | Ga0207705_1000000245 | 73 |
| 41 | 3300025919 | Ga0207657_10013217 | Ga0207657_100132178 | 73 |
| 42 | 3300025919 | Ga0207657_10049485 | Ga0207657_100494853 | 73 |
| 43 | 3300025920 | Ga0207649_10000221 | Ga0207649_1000022124 | 73 |
| 44 | 3300025932 | Ga0207690_10001952 | Ga0207690_100019522 | 73 |
| 45 | 3300030742 | Ga0316183_1210559 | Ga0316183_12105593 | 73 |
| 46 | 3300030745 | Ga0316182_1269164 | Ga0316182_12691641 | 73 |
| 47 | 3300032004 | Ga0307414_10001123 | Ga0307414_1000112316 | 73 |
| 48 | 3300046530 | Ga0495654_0138190 | Ga0495654_0138190_476_706 | 73 |
| 49 | 3300053090 | Ga0500646_0033566 | Ga0500646_0033566_760_1041 | 73 |
| 50 | 3300053116 | Ga0500592_001181 | Ga0500592_001181_2660_2890 | 73 |
| 51 | 3300053116 | Ga0500592_077988 | Ga0500592_077988_86_316 | 73 |
| 52 | 3300053158 | Ga0500627_0000005 | Ga0500627_0000005_59043_59273 | 73 |
| 53 | 3300003781 | Ga0055536_1002976 | Ga0055536_100297612 | 74 |
| 54 | 3300003781 | Ga0055536_1003397 | Ga0055536_10033975 | 74 |
| 55 | 3300003781 | Ga0055536_1018865 | Ga0055536_10188652 | 74 |
| 56 | 3300003791 | Ga0055530_10000013 | Ga0055530_10000013140 | 74 |
| 57 | 3300003791 | Ga0055530_10047246 | Ga0055530_100472463 | 74 |
| 58 | 3300005445 | Ga0070708_100355842 | Ga0070708_1003558423 | 74 |
| 59 | 3300013104 | Ga0157370_10451308 | Ga0157370_104513082 | 74 |
| 60 | 3300025291 | Ga0209675_1000275 | Ga0209675_100027516 | 74 |
| 61 | 3300025292 | Ga0209676_1000349 | Ga0209676_100034970 | 74 |
| 62 | 3300025292 | Ga0209676_1000453 | Ga0209676_100045313 | 74 |
| 63 | 3300025292 | Ga0209676_1000648 | Ga0209676_100064818 | 74 |
| 64 | 3300025294 | Ga0209025_1015485 | Ga0209025_10154855 | 74 |
| 65 | 3300025297 | Ga0209758_1099264 | Ga0209758_10992642 | 74 |
| 66 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042250 | 74 |
| 67 | 3300025298 | Ga0209050_1000822 | Ga0209050_100082236 | 74 |
| 68 | 3300025298 | Ga0209050_1038989 | Ga0209050_10389892 | 74 |
| 69 | 3300025304 | Ga0209257_1000135 | Ga0209257_1000135137 | 74 |
| 70 | 3300031911 | Ga0307412_10009604 | Ga0307412_100096043 | 74 |
| 71 | 3300031911 | Ga0307412_10391954 | Ga0307412_103919543 | 74 |
| 72 | 3300032002 | Ga0307416_100305941 | Ga0307416_1003059413 | 74 |
| 73 | 3300032002 | Ga0307416_101185615 | Ga0307416_1011856152 | 74 |
| 74 | 3300032002 | Ga0307416_102772434 | Ga0307416_1027724341 | 74 |
| 75 | 3300032004 | Ga0307414_10008032 | Ga0307414_100080328 | 74 |
| 76 | 3300032004 | Ga0307414_10048300 | Ga0307414_100483003 | 74 |
| 77 | 3300032004 | Ga0307414_10461475 | Ga0307414_104614753 | 74 |
| 78 | 3300032005 | Ga0307411_10055119 | Ga0307411_100551193 | 74 |
| 79 | 3300032005 | Ga0307411_10371537 | Ga0307411_103715372 | 74 |
| 80 | 3300046525 | Ga0495663_0250841 | Ga0495663_0250841_195_428 | 74 |
| 81 | 3300046660 | Ga0495625_0000652 | Ga0495625_0000652_31878_32111 | 74 |
| 82 | 3300047470 | Ga0495681_0204586 | Ga0495681_0204586_305_538 | 74 |
| 83 | 3300048928 | Ga0496125_0706696 | Ga0496125_0706696_256_489 | 74 |
| 84 | 3300049569 | Ga0501032_0119275 | Ga0501032_0119275_1402_1641 | 74 |
| 85 | 3300049570 | Ga0501033_0287546 | Ga0501033_0287546_888_1127 | 74 |
| 86 | 3300049571 | Ga0501034_0068953 | Ga0501034_0068953_1024_1263 | 74 |
| 87 | 3300049572 | Ga0501036_0209944 | Ga0501036_0209944_666_905 | 74 |
| 88 | 3300049573 | Ga0501037_0134197 | Ga0501037_0134197_1420_1659 | 74 |
| 89 | 3300049574 | Ga0501038_0031513 | Ga0501038_0031513_13_252 | 74 |
| 90 | 3300049575 | Ga0501039_0389669 | Ga0501039_0389669_453_692 | 74 |
| 91 | 3300049579 | Ga0501043_0045523 | Ga0501043_0045523_373_612 | 74 |
| 92 | 3300049580 | Ga0501046_0176618 | Ga0501046_0176618_1061_1300 | 74 |
| 93 | 3300049822 | Ga0501035_0149915 | Ga0501035_0149915_1140_1379 | 74 |
| 94 | 3300049823 | Ga0501044_0056725 | Ga0501044_0056725_426_665 | 74 |
| 95 | 3300049824 | Ga0501045_1073349 | Ga0501045_1073349_125_364 | 74 |
| 96 | 3300053116 | Ga0500592_025783 | Ga0500592_025783_429_662 | 74 |
| 97 | 3300053134 | Ga0500658_0032270 | Ga0500658_0032270_899_1132 | 74 |
| 98 | 3300053139 | Ga0500568_0001107 | Ga0500568_0001107_13134_13367 | 74 |
| 99 | 3300009098 | Ga0105245_10161701 | Ga0105245_101617012 | 75 |
| 100 | 3300013307 | Ga0157372_10401395 | Ga0157372_104013951 | 75 |
| 101 | 3300025927 | Ga0207687_10223224 | Ga0207687_102232242 | 75 |
| 102 | 3300031548 | Ga0307408_100059846 | Ga0307408_1000598463 | 75 |
| 103 | 3300031731 | Ga0307405_10004719 | Ga0307405_100047192 | 75 |
| 104 | 3300031911 | Ga0307412_10002795 | Ga0307412_100027952 | 75 |
| 105 | 3300032004 | Ga0307414_10536722 | Ga0307414_105367222 | 75 |
| 106 | 3300041451 | Ga0451791_0426158 | Ga0451791_0426158_14_250 | 75 |
| 107 | 3300041453 | Ga0451797_0725346 | Ga0451797_0725346_266_502 | 75 |
| 108 | 3300046616 | Ga0495668_0012944 | Ga0495668_0012944_4289_4540 | 75 |
| 109 | 3300048929 | Ga0496126_0264071 | Ga0496126_0264071_542_778 | 75 |
| 110 | 3300049530 | Ga0501314_000311 | Ga0501314_000311_490_726 | 75 |
| 111 | 3300049551 | Ga0501335_020962 | Ga0501335_020962_72_311 | 75 |
| 112 | 3300049571 | Ga0501034_0006999 | Ga0501034_0006999_10423_10659 | 75 |
| 113 | 3300049663 | Ga0501223_000227 | Ga0501223_000227_11587_11823 | 75 |
| 114 | 3300049664 | Ga0501224_000030 | Ga0501224_000030_17057_17293 | 75 |
| 115 | 3300049668 | Ga0501233_002383 | Ga0501233_002383_1830_2066 | 75 |
| 116 | 3300049669 | Ga0501235_049936 | Ga0501235_049936_360_596 | 75 |
| 117 | 3300049705 | Ga0501225_0000009 | Ga0501225_0000009_25310_25546 | 75 |
| 118 | 3300049706 | Ga0501229_034179 | Ga0501229_034179_338_574 | 75 |
| 119 | 3300049707 | Ga0501234_002981 | Ga0501234_002981_2125_2361 | 75 |
| 120 | 3300049853 | Ga0501226_000054 | Ga0501226_000054_10986_11222 | 75 |
| 121 | 3300053151 | Ga0500604_0000017 | Ga0500604_0000017_33157_33438 | 75 |
| 122 | 3300005339 | Ga0070660_101848148 | Ga0070660_1018481481 | 76 |
| 123 | 3300005347 | Ga0070668_100165852 | Ga0070668_1001658523 | 76 |
| 124 | 3300005353 | Ga0070669_100526896 | Ga0070669_1005268962 | 76 |
| 125 | 3300005356 | Ga0070674_100572421 | Ga0070674_1005724212 | 76 |
| 126 | 3300005366 | Ga0070659_101986222 | Ga0070659_1019862221 | 76 |
| 127 | 3300005549 | Ga0070704_101170748 | Ga0070704_1011707481 | 76 |
| 128 | 3300005844 | Ga0068862_101719104 | Ga0068862_1017191041 | 76 |
| 129 | 3300009094 | Ga0111539_11292568 | Ga0111539_112925681 | 76 |
| 130 | 3300025926 | Ga0207659_10111132 | Ga0207659_101111321 | 76 |
| 131 | 3300025960 | Ga0207651_12131796 | Ga0207651_121317961 | 76 |
| 132 | 3300025972 | Ga0207668_10979047 | Ga0207668_109790472 | 76 |
| 133 | 3300025972 | Ga0207668_11828255 | Ga0207668_118282551 | 76 |
| 134 | 3300026118 | Ga0207675_101165311 | Ga0207675_1011653112 | 76 |
| 135 | 3300028379 | Ga0268266_11680332 | Ga0268266_116803322 | 76 |
| 136 | 3300038443 | Ga0395901_0068076 | Ga0395901_0068076_2411_2644 | 76 |
| 137 | 3300046691 | Ga0495670_0042357 | Ga0495670_0042357_1872_2102 | 76 |
| 138 | 3300050511 | nmdc:mga08y16_1166447_c1 | nmdc:mga08y16_1166447_c1_455_709 | 76 |
| 139 | 3300005441 | Ga0070700_100970211 | Ga0070700_1009702112 | 77 |
| 140 | 3300005617 | Ga0068859_100026991 | Ga0068859_1000269916 | 77 |
| 141 | 3300005841 | Ga0068863_100004067 | Ga0068863_10000406714 | 77 |
| 142 | 3300005843 | Ga0068860_100002979 | Ga0068860_10000297921 | 77 |
| 143 | 3300005844 | Ga0068862_100000067 | Ga0068862_1000000677 | 77 |
| 144 | 3300006931 | Ga0097620_100026991 | Ga0097620_1000269916 | 77 |
| 145 | 3300009101 | Ga0105247_10014686 | Ga0105247_100146862 | 77 |
| 146 | 3300009553 | Ga0105249_10000105 | Ga0105249_100001055 | 77 |
| 147 | 3300021358 | Ga0213873_10000042 | Ga0213873_1000004210 | 77 |
| 148 | 3300021384 | Ga0213876_10000050 | Ga0213876_10000050157 | 77 |
| 149 | 3300025900 | Ga0207710_10002821 | Ga0207710_100028216 | 77 |
| 150 | 3300025921 | Ga0207652_11703060 | Ga0207652_117030601 | 77 |
| 151 | 3300025961 | Ga0207712_10000015 | Ga0207712_100000155 | 77 |
| 152 | 3300026075 | Ga0207708_10622744 | Ga0207708_106227442 | 77 |
| 153 | 3300026088 | Ga0207641_10004799 | Ga0207641_100047997 | 77 |
| 154 | 3300028380 | Ga0268265_10000021 | Ga0268265_10000021224 | 77 |
| 155 | 3300028381 | Ga0268264_10003943 | Ga0268264_100039435 | 77 |
| 156 | 3300031456 | Ga0307513_10170931 | Ga0307513_101709311 | 77 |
| 157 | 3300037471 | Ga0395905_0216150 | Ga0395905_0216150_1542_1778 | 77 |
| 158 | 3300038443 | Ga0395901_0223048 | Ga0395901_0223048_1281_1517 | 77 |
| 159 | 3300039437 | Ga0436365_1697258 | Ga0436365_1697258_7364_7624 | 77 |
| 160 | 3300039453 | Ga0436362_1132945 | Ga0436362_1132945_7364_7624 | 77 |
| 161 | 3300046515 | Ga0495620_0276638 | Ga0495620_0276638_182_439 | 77 |
| 162 | 3300049586 | Ga0501070_0572056 | Ga0501070_0572056_464_700 | 77 |
| 163 | 3300005331 | Ga0070670_100220735 | Ga0070670_1002207352 | 78 |
| 164 | 3300005338 | Ga0068868_100000503 | Ga0068868_1000005037 | 78 |
| 165 | 3300005339 | Ga0070660_100000856 | Ga0070660_1000008567 | 78 |
| 166 | 3300005345 | Ga0070692_10003531 | Ga0070692_100035313 | 78 |
| 167 | 3300005366 | Ga0070659_100000159 | Ga0070659_10000015910 | 78 |
| 168 | 3300005617 | Ga0068859_100086420 | Ga0068859_1000864205 | 78 |
| 169 | 3300005844 | Ga0068862_100302671 | Ga0068862_1003026713 | 78 |
| 170 | 3300006931 | Ga0097620_100086416 | Ga0097620_1000864165 | 78 |
| 171 | 3300009098 | Ga0105245_10161479 | Ga0105245_101614793 | 78 |
| 172 | 3300009553 | Ga0105249_10032169 | Ga0105249_100321695 | 78 |
| 173 | 3300013105 | Ga0157369_10067925 | Ga0157369_100679254 | 78 |
| 174 | 3300013308 | Ga0157375_10189103 | Ga0157375_101891034 | 78 |
| 175 | 3300025919 | Ga0207657_10006128 | Ga0207657_1000612812 | 78 |
| 176 | 3300025925 | Ga0207650_10180957 | Ga0207650_101809573 | 78 |
| 177 | 3300025927 | Ga0207687_10130685 | Ga0207687_101306853 | 78 |
| 178 | 3300025932 | Ga0207690_10000177 | Ga0207690_1000017761 | 78 |
| 179 | 3300025961 | Ga0207712_10718816 | Ga0207712_107188161 | 78 |
| 180 | 3300025981 | Ga0207640_10758096 | Ga0207640_107580962 | 78 |
| 181 | 3300026023 | Ga0207677_10001450 | Ga0207677_100014507 | 78 |
| 182 | 3300028380 | Ga0268265_10019888 | Ga0268265_100198885 | 78 |
| 183 | 3300028381 | Ga0268264_10051497 | Ga0268264_100514974 | 78 |
| 184 | 3300041410 | Ga0439461_0120312 | Ga0439461_0120312_258_494 | 78 |
| 185 | 3300042004 | Ga0439445_0093039 | Ga0439445_0093039_323_559 | 78 |
| 186 | 3300042435 | Ga0439434_0188174 | Ga0439434_0188174_68_304 | 78 |
| 187 | 3300050493 | nmdc:mga0k408_163766_c1 | nmdc:mga0k408_163766_c1_879_1136 | 78 |
| 188 | iso_pu_bacteria | 2643221606 | 2644042893 | 78 |
| 189 | iso_pu_bacteria | 2643221671 | 2644395676 | 78 |
| 190 | 3300005445 | Ga0070708_100772724 | Ga0070708_1007727243 | 79 |
| 191 | 3300006846 | Ga0075430_100007566 | Ga0075430_1000075669 | 79 |
| 192 | 3300021384 | Ga0213876_10001602 | Ga0213876_1000160215 | 79 |
| 193 | 3300032005 | Ga0307411_11914375 | Ga0307411_119143752 | 79 |
| 194 | 3300032126 | Ga0307415_102425608 | Ga0307415_1024256082 | 79 |
| 195 | 3300039437 | Ga0436365_1595987 | Ga0436365_1595987_12911_13186 | 79 |
| 196 | 3300046530 | Ga0495654_0000999 | Ga0495654_0000999_6300_6548 | 79 |
| 197 | 3300046616 | Ga0495668_0006190 | Ga0495668_0006190_5218_5466 | 79 |
| 198 | 3300046794 | Ga0495589_0047816 | Ga0495589_0047816_1684_1932 | 79 |
| 199 | 3300049459 | Ga0495678_149587 | Ga0495678_149587_229_477 | 79 |
| 200 | 3300049513 | Ga0501290_091072 | Ga0501290_091072_183_422 | 79 |
| 201 | 3300049663 | Ga0501223_028808 | Ga0501223_028808_575_814 | 79 |
| 202 | 3300049686 | Ga0501257_000019 | Ga0501257_000019_40921_41160 | 79 |
| 203 | 3300049776 | Ga0501280_001184 | Ga0501280_001184_702_941 | 79 |
| 204 | 3300050509 | nmdc:mga0qj67_158416_c1 | nmdc:mga0qj67_158416_c1_1049_1288 | 79 |
| 205 | 3300053151 | Ga0500604_0020018 | Ga0500604_0020018_117_365 | 79 |
| 206 | 3300053158 | Ga0500627_0000495 | Ga0500627_0000495_1463_1711 | 79 |
| 207 | 3300005347 | Ga0070668_100005753 | Ga0070668_10000575311 | 80 |
| 208 | 3300005347 | Ga0070668_100039704 | Ga0070668_1000397043 | 80 |
| 209 | 3300005353 | Ga0070669_100451890 | Ga0070669_1004518901 | 80 |
| 210 | 3300005355 | Ga0070671_100973485 | Ga0070671_1009734852 | 80 |
| 211 | 3300005546 | Ga0070696_101097464 | Ga0070696_1010974641 | 80 |
| 212 | 3300005719 | Ga0068861_100005577 | Ga0068861_1000055772 | 80 |
| 213 | 3300005842 | Ga0068858_100003763 | Ga0068858_10000376312 | 80 |
| 214 | 3300005843 | Ga0068860_101882225 | Ga0068860_1018822252 | 80 |
| 215 | 3300005844 | Ga0068862_100005835 | Ga0068862_10000583510 | 80 |
| 216 | 3300009177 | Ga0105248_10214434 | Ga0105248_102144344 | 80 |
| 217 | 3300009978 | Ga0105148_103453 | Ga0105148_1034532 | 80 |
| 218 | 3300013306 | Ga0163162_10326940 | Ga0163162_103269403 | 80 |
| 219 | 3300014326 | Ga0157380_10001468 | Ga0157380_1000146812 | 80 |
| 220 | 3300025931 | Ga0207644_10851554 | Ga0207644_108515542 | 80 |
| 221 | 3300025941 | Ga0207711_10135504 | Ga0207711_101355043 | 80 |
| 222 | 3300025972 | Ga0207668_10000156 | Ga0207668_1000015620 | 80 |
| 223 | 3300025972 | Ga0207668_10008280 | Ga0207668_100082809 | 80 |
| 224 | 3300026035 | Ga0207703_10094183 | Ga0207703_100941831 | 80 |
| 225 | 3300026118 | Ga0207675_100000075 | Ga0207675_10000007527 | 80 |
| 226 | 3300027717 | Ga0209998_10028737 | Ga0209998_100287373 | 80 |
| 227 | 3300028380 | Ga0268265_10039089 | Ga0268265_100390892 | 80 |
| 228 | 3300028381 | Ga0268264_10000106 | Ga0268264_10000106104 | 80 |
| 229 | 3300031548 | Ga0307408_100025798 | Ga0307408_1000257985 | 80 |
| 230 | 3300031731 | Ga0307405_10012331 | Ga0307405_100123316 | 80 |
| 231 | 3300031901 | Ga0307406_10001642 | Ga0307406_100016423 | 80 |
| 232 | 3300031911 | Ga0307412_10001919 | Ga0307412_100019196 | 80 |
| 233 | 3300032002 | Ga0307416_100021750 | Ga0307416_1000217506 | 80 |
| 234 | 3300033180 | Ga0307510_10046515 | Ga0307510_100465157 | 80 |
| 235 | 3300039450 | Ga0436363_0702332 | Ga0436363_0702332_1067_1345 | 80 |
| 236 | 3300048920 | Ga0496117_0009462 | Ga0496117_0009462_3602_3844 | 80 |
| 237 | 3300048921 | Ga0496118_0000811 | Ga0496118_0000811_29465_29707 | 80 |
| 238 | 3300048924 | Ga0496121_0033968 | Ga0496121_0033968_1517_1759 | 80 |
| 239 | 3300048925 | Ga0496122_0407546 | Ga0496122_0407546_192_434 | 80 |
| 240 | 3300048926 | Ga0496123_0246398 | Ga0496123_0246398_418_660 | 80 |
| 241 | 3300048927 | Ga0496124_0220408 | Ga0496124_0220408_555_797 | 80 |
| 242 | 3300053087 | Ga0500643_000151 | Ga0500643_000151_42270_42518 | 80 |
| 243 | 3300053158 | Ga0500627_0507621 | Ga0500627_0507621_57_299 | 80 |
| 244 | 3300005841 | Ga0068863_100028296 | Ga0068863_1000282962 | 81 |
| 245 | 3300013306 | Ga0163162_10638187 | Ga0163162_106381873 | 81 |
| 246 | 3300026088 | Ga0207641_10172618 | Ga0207641_101726184 | 81 |
| 247 | 3300028786 | Ga0307517_10390841 | Ga0307517_103908411 | 81 |
| 248 | 3300046692 | Ga0495671_0180652 | Ga0495671_0180652_398_646 | 81 |
| 249 | 3300047469 | Ga0495673_0043055 | Ga0495673_0043055_949_1197 | 81 |
| 250 | 3300048905 | Ga0496102_0000010 | Ga0496102_0000010_247226_247474 | 81 |
| 251 | 3300048906 | Ga0496103_0000029 | Ga0496103_0000029_135935_136183 | 81 |
| 252 | 3300048919 | Ga0496116_0002331 | Ga0496116_0002331_7678_7926 | 81 |
| 253 | 3300048920 | Ga0496117_0000037 | Ga0496117_0000037_247828_248076 | 81 |
| 254 | 3300048921 | Ga0496118_0000034 | Ga0496118_0000034_245632_245880 | 81 |
| 255 | 3300048922 | Ga0496119_0230268 | Ga0496119_0230268_236_484 | 81 |
| 256 | 3300048923 | Ga0496120_0164149 | Ga0496120_0164149_230_478 | 81 |
| 257 | 3300048926 | Ga0496123_0013439 | Ga0496123_0013439_2047_2295 | 81 |
| 258 | 3300048927 | Ga0496124_0000033 | Ga0496124_0000033_245632_245880 | 81 |
| 259 | 3300048927 | Ga0496124_0671941 | Ga0496124_0671941_166_414 | 81 |
| 260 | 3300048929 | Ga0496126_1161552 | Ga0496126_1161552_238_486 | 81 |
| 261 | 3300053158 | Ga0500627_0107933 | Ga0500627_0107933_858_1109 | 81 |
| 262 | 3300053727 | Ga0500611_053764 | Ga0500611_053764_374_625 | 81 |
| 263 | 3300001432 | JGI24034J14986_104728 | JGI24034J14986_1047281 | 82 |
| 264 | 3300001976 | JGI24752J21851_1000861 | JGI24752J21851_10008613 | 82 |
| 265 | 3300002074 | JGI24748J21848_1000097 | JGI24748J21848_100009711 | 82 |
| 266 | 3300002239 | JGI24034J26672_10000060 | JGI24034J26672_1000006016 | 82 |
| 267 | 3300002244 | JGI24742J22300_10039560 | JGI24742J22300_100395601 | 82 |
| 268 | 3300002459 | JGI24751J29686_10009164 | JGI24751J29686_100091646 | 82 |
| 269 | 3300005335 | Ga0070666_10000069 | Ga0070666_1000006947 | 82 |
| 270 | 3300005335 | Ga0070666_10047456 | Ga0070666_100474563 | 82 |
| 271 | 3300005340 | Ga0070689_100003334 | Ga0070689_1000033344 | 82 |
| 272 | 3300005347 | Ga0070668_100350533 | Ga0070668_1003505332 | 82 |
| 273 | 3300005347 | Ga0070668_100459315 | Ga0070668_1004593153 | 82 |
| 274 | 3300005353 | Ga0070669_100000167 | Ga0070669_10000016724 | 82 |
| 275 | 3300005355 | Ga0070671_100012110 | Ga0070671_10001211010 | 82 |
| 276 | 3300005365 | Ga0070688_100004979 | Ga0070688_1000049792 | 82 |
| 277 | 3300005367 | Ga0070667_100000036 | Ga0070667_100000036145 | 82 |
| 278 | 3300005367 | Ga0070667_100064227 | Ga0070667_1000642274 | 82 |
| 279 | 3300005466 | Ga0070685_10000036 | Ga0070685_1000003628 | 82 |
| 280 | 3300005544 | Ga0070686_100000045 | Ga0070686_10000004531 | 82 |
| 281 | 3300005548 | Ga0070665_100000042 | Ga0070665_100000042260 | 82 |
| 282 | 3300005577 | Ga0068857_101099510 | Ga0068857_1010995102 | 82 |
| 283 | 3300005616 | Ga0068852_101349400 | Ga0068852_1013494001 | 82 |
| 284 | 3300005617 | Ga0068859_100008727 | Ga0068859_1000087278 | 82 |
| 285 | 3300005617 | Ga0068859_100156542 | Ga0068859_1001565424 | 82 |
| 286 | 3300005617 | Ga0068859_100384456 | Ga0068859_1003844562 | 82 |
| 287 | 3300005719 | Ga0068861_101303667 | Ga0068861_1013036672 | 82 |
| 288 | 3300005841 | Ga0068863_100000239 | Ga0068863_10000023922 | 82 |
| 289 | 3300005841 | Ga0068863_100000845 | Ga0068863_10000084519 | 82 |
| 290 | 3300005842 | Ga0068858_100000659 | Ga0068858_10000065930 | 82 |
| 291 | 3300005842 | Ga0068858_101414752 | Ga0068858_1014147522 | 82 |
| 292 | 3300005843 | Ga0068860_100000063 | Ga0068860_10000006320 | 82 |
| 293 | 3300005843 | Ga0068860_100000182 | Ga0068860_10000018231 | 82 |
| 294 | 3300005843 | Ga0068860_100571226 | Ga0068860_1005712263 | 82 |
| 295 | 3300005843 | Ga0068860_101111201 | Ga0068860_1011112012 | 82 |
| 296 | 3300005844 | Ga0068862_100000392 | Ga0068862_10000039221 | 82 |
| 297 | 3300006931 | Ga0097620_100008726 | Ga0097620_1000087265 | 82 |
| 298 | 3300006931 | Ga0097620_100156538 | Ga0097620_1001565384 | 82 |
| 299 | 3300006931 | Ga0097620_100384436 | Ga0097620_1003844362 | 82 |
| 300 | 3300009092 | Ga0105250_10011581 | Ga0105250_100115814 | 82 |
| 301 | 3300009101 | Ga0105247_10231573 | Ga0105247_102315732 | 82 |
| 302 | 3300009177 | Ga0105248_10229550 | Ga0105248_102295503 | 82 |
| 303 | 3300009553 | Ga0105249_10000012 | Ga0105249_1000001230 | 82 |
| 304 | 3300009553 | Ga0105249_10174207 | Ga0105249_101742074 | 82 |
| 305 | 3300009553 | Ga0105249_11227729 | Ga0105249_112277292 | 82 |
| 306 | 3300013100 | Ga0157373_10404722 | Ga0157373_104047222 | 82 |
| 307 | 3300013306 | Ga0163162_10065894 | Ga0163162_100658944 | 82 |
| 308 | 3300013307 | Ga0157372_10632303 | Ga0157372_106323032 | 82 |
| 309 | 3300014325 | Ga0163163_10248142 | Ga0163163_102481422 | 82 |
| 310 | 3300014326 | Ga0157380_10001964 | Ga0157380_100019644 | 82 |
| 311 | 3300014968 | Ga0157379_10011656 | Ga0157379_100116565 | 82 |
| 312 | 3300017792 | Ga0163161_10000387 | Ga0163161_100003879 | 82 |
| 313 | 3300025223 | Ga0207672_1001171 | Ga0207672_10011712 | 82 |
| 314 | 3300025711 | Ga0207696_1153544 | Ga0207696_11535442 | 82 |
| 315 | 3300025900 | Ga0207710_10125201 | Ga0207710_101252013 | 82 |
| 316 | 3300025903 | Ga0207680_10000012 | Ga0207680_10000012256 | 82 |
| 317 | 3300025903 | Ga0207680_10053560 | Ga0207680_100535603 | 82 |
| 318 | 3300025923 | Ga0207681_10000076 | Ga0207681_1000007624 | 82 |
| 319 | 3300025925 | Ga0207650_10118113 | Ga0207650_101181133 | 82 |
| 320 | 3300025931 | Ga0207644_10011602 | Ga0207644_100116021 | 82 |
| 321 | 3300025936 | Ga0207670_10386629 | Ga0207670_103866292 | 82 |
| 322 | 3300025941 | Ga0207711_10053556 | Ga0207711_100535562 | 82 |
| 323 | 3300025961 | Ga0207712_10000021 | Ga0207712_10000021256 | 82 |
| 324 | 3300025961 | Ga0207712_10071807 | Ga0207712_100718074 | 82 |
| 325 | 3300025972 | Ga0207668_10083261 | Ga0207668_100832615 | 82 |
| 326 | 3300025972 | Ga0207668_10193370 | Ga0207668_101933703 | 82 |
| 327 | 3300025981 | Ga0207640_10014352 | Ga0207640_100143527 | 82 |
| 328 | 3300025986 | Ga0207658_10000083 | Ga0207658_1000008389 | 82 |
| 329 | 3300025986 | Ga0207658_10000826 | Ga0207658_100008266 | 82 |
| 330 | 3300026035 | Ga0207703_10001618 | Ga0207703_1000161817 | 82 |
| 331 | 3300026088 | Ga0207641_10000410 | Ga0207641_1000041056 | 82 |
| 332 | 3300026088 | Ga0207641_10021668 | Ga0207641_100216682 | 82 |
| 333 | 3300026095 | Ga0207676_10202626 | Ga0207676_102026263 | 82 |
| 334 | 3300026118 | Ga0207675_100013675 | Ga0207675_1000136753 | 82 |
| 335 | 3300026142 | Ga0207698_11188877 | Ga0207698_111888771 | 82 |
| 336 | 3300028379 | Ga0268266_10000054 | Ga0268266_10000054255 | 82 |
| 337 | 3300028379 | Ga0268266_11132212 | Ga0268266_111322121 | 82 |
| 338 | 3300028380 | Ga0268265_10000278 | Ga0268265_1000027826 | 82 |
| 339 | 3300028381 | Ga0268264_10000083 | Ga0268264_1000008375 | 82 |
| 340 | 3300028381 | Ga0268264_10000764 | Ga0268264_1000076430 | 82 |
| 341 | 3300028381 | Ga0268264_11090069 | Ga0268264_110900692 | 82 |
| 342 | 3300031548 | Ga0307408_100159743 | Ga0307408_1001597434 | 82 |
| 343 | 3300031852 | Ga0307410_10652279 | Ga0307410_106522793 | 82 |
| 344 | 3300031911 | Ga0307412_11007917 | Ga0307412_110079172 | 82 |
| 345 | 3300047472 | Ga0495686_0304605 | Ga0495686_0304605_137_388 | 82 |
| 346 | 3300048904 | Ga0496101_0443686 | Ga0496101_0443686_49_297 | 82 |
| 347 | 3300048905 | Ga0496102_0002069 | Ga0496102_0002069_14745_14993 | 82 |
| 348 | 3300048906 | Ga0496103_0011551 | Ga0496103_0011551_2935_3183 | 82 |
| 349 | 3300048907 | Ga0496104_0127839 | Ga0496104_0127839_807_1055 | 82 |
| 350 | 3300048909 | Ga0496106_0717801 | Ga0496106_0717801_83_331 | 82 |
| 351 | 3300048910 | Ga0496107_0257426 | Ga0496107_0257426_233_481 | 82 |
| 352 | 3300048914 | Ga0496111_0549159 | Ga0496111_0549159_335_583 | 82 |
| 353 | 3300048920 | Ga0496117_0012147 | Ga0496117_0012147_867_1115 | 82 |
| 354 | 3300048921 | Ga0496118_0188896 | Ga0496118_0188896_653_901 | 82 |
| 355 | 3300048927 | Ga0496124_0118730 | Ga0496124_0118730_387_635 | 82 |
| 356 | 3300048928 | Ga0496125_0252752 | Ga0496125_0252752_647_895 | 82 |
| 357 | 3300048929 | Ga0496126_0836927 | Ga0496126_0836927_233_481 | 82 |
| 358 | 3300053116 | Ga0500592_000316 | Ga0500592_000316_1407_1655 | 82 |
| 359 | 3300053125 | Ga0500618_148181 | Ga0500618_148181_102_353 | 82 |
| 360 | 3300053134 | Ga0500658_0478150 | Ga0500658_0478150_37_285 | 82 |
| 361 | 3300053142 | Ga0500577_0348956 | Ga0500577_0348956_241_495 | 82 |
| 362 | 3300053158 | Ga0500627_0007085 | Ga0500627_0007085_3597_3845 | 82 |
| 363 | 3300053158 | Ga0500627_0260946 | Ga0500627_0260946_487_735 | 82 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar