F422896

General Info

Members Datasets Scaffolds Average Seq Length
363 183 726 130

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_101483653|Ga0070684_1014836531
Length 144
Sequence MRNFAREQRLSHEFGMGINLLMIFPQLAQFTDVALLLLRVMVGIVFISSGWKHLKDPEARSKDIGMSKGFTVFLGAAEVAGGLGVMLXXLTQLVMLGAIQKKIFVWHTGFWGKSGTDGWSYDTMLVVMNLVILTTGGGNLSLWK

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.09
Rhizosphere 89.81
Stem 0
Stem Tuber 0
Unclassified 47.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_101483653 3300005535 Unclassified 639
2 JGI25405J52794_10040148 3300003911 Unclassified 989
3 Ga0065704_10015921 3300005289 Bacteria 1838
4 Ga0065704_10592406 3300005289 Unclassified 611
5 Ga0065715_10007555 3300005293 Unclassified 2777
6 Ga0065715_10517772 3300005293 Bacteria 764
7 Ga0065707_10122838 3300005295 Bacteria 2079
8 Ga0070683_100377546 3300005329 Bacteria 1351
9 Ga0070683_101717583 3300005329 Unclassified 604
10 Ga0070666_11193839 3300005335 Unclassified 567
11 Ga0070680_100709554 3300005336 Unclassified 866
12 Ga0068868_100020889 3300005338 Bacteria 4927
13 Ga0070689_101493733 3300005340 Unclassified 612
14 Ga0070671_100144512 3300005355 Bacteria 2008
15 Ga0070671_100175030 3300005355 Unclassified 1815
16 Ga0070674_100077447 3300005356 Unclassified 2367
17 Ga0070673_100124726 3300005364 Bacteria 2153
18 Ga0070673_101144241 3300005364 Unclassified 728
19 Ga0070688_100448973 3300005365 Unclassified 964
20 Ga0070688_100903561 3300005365 Bacteria 697
21 Ga0070659_101835700 3300005366 Unclassified 543
22 Ga0070709_10130724 3300005434 Bacteria 1714
23 Ga0070709_10710800 3300005434 Unclassified 782
24 Ga0070709_10903567 3300005434 Unclassified 698
25 Ga0070709_11158462 3300005434 Bacteria 620
26 Ga0070714_100004620 3300005435 Bacteria 10388
27 Ga0070714_100094261 3300005435 Bacteria 2628
28 Ga0070714_100149318 3300005435 Bacteria 2104
29 Ga0070714_100272478 3300005435 Unclassified 1570
30 Ga0070714_100355482 3300005435 Bacteria 1376
31 Ga0070714_100472969 3300005435 Unclassified 1192
32 Ga0070714_100519678 3300005435 Bacteria 1137
33 Ga0070714_100701825 3300005435 Unclassified 976
34 Ga0070714_101070985 3300005435 Bacteria 785
35 Ga0070714_101225900 3300005435 Unclassified 732
36 Ga0070714_101483221 3300005435 Bacteria 662
37 Ga0070713_100047991 3300005436 Bacteria 3513
38 Ga0070713_100284732 3300005436 Bacteria 1517
39 Ga0070713_100456578 3300005436 Bacteria 1201
40 Ga0070713_100586929 3300005436 Bacteria 1057
41 Ga0070713_100866276 3300005436 Unclassified 868
42 Ga0070713_102473928 3300005436 Unclassified 502
43 Ga0070710_10100337 3300005437 Bacteria 1723
44 Ga0070710_10153561 3300005437 Unclassified 1422
45 Ga0070710_10215274 3300005437 Unclassified 1220
46 Ga0070710_10300594 3300005437 Unclassified 1047
47 Ga0070710_10427282 3300005437 Bacteria 893
48 Ga0070711_100008748 3300005439 Bacteria 6212
49 Ga0070711_100209530 3300005439 Bacteria 1508
50 Ga0070711_100244940 3300005439 Bacteria 1403
51 Ga0070711_100301335 3300005439 Bacteria 1275
52 Ga0070711_100540143 3300005439 Bacteria 966
53 Ga0070711_100798177 3300005439 Unclassified 800
54 Ga0070705_100871356 3300005440 Unclassified 722
55 Ga0070708_101244768 3300005445 Unclassified 696
56 Ga0070678_100816716 3300005456 Bacteria 847
57 Ga0070681_10043473 3300005458 Bacteria 4501
58 Ga0070681_10228790 3300005458 Bacteria 1774
59 Ga0070681_10256322 3300005458 Bacteria 1661
60 Ga0070681_10422172 3300005458 Bacteria 1245
61 Ga0070706_101337043 3300005467 Unclassified 657
62 Ga0070699_100002981 3300005518 Bacteria 15034
63 Ga0070699_100241401 3300005518 Bacteria 1613
64 Ga0070699_101656077 3300005518 Unclassified 586
65 Ga0070679_100327786 3300005530 Unclassified 1480
66 Ga0070679_101492369 3300005530 Bacteria 623
67 Ga0070679_101701936 3300005530 Unclassified 579
68 Ga0070684_100141067 3300005535 Bacteria 2179
69 Ga0070684_100492226 3300005535 Bacteria 1135
70 Ga0070684_100759249 3300005535 Unclassified 905
71 Ga0070697_100384864 3300005536 Bacteria 1215
72 Ga0070697_100939886 3300005536 Bacteria 768
73 Ga0068853_100031671 3300005539 Bacteria 4474
74 Ga0068853_100950100 3300005539 Unclassified 826
75 Ga0068853_100959629 3300005539 Unclassified 822
76 Ga0070686_101219223 3300005544 Bacteria 626
77 Ga0070695_100018314 3300005545 Bacteria 4253
78 Ga0070695_100095331 3300005545 Bacteria 1994
79 Ga0070693_100258037 3300005547 Unclassified 1158
80 Ga0070665_100426756 3300005548 Bacteria 1334
81 Ga0070665_100460050 3300005548 Bacteria 1282
82 Ga0068855_100194965 3300005563 Bacteria 2282
83 Ga0068855_100977132 3300005563 Bacteria 891
84 Ga0070664_100866618 3300005564 Unclassified 846
85 Ga0068857_100150066 3300005577 Unclassified 2111
86 Ga0068854_100397879 3300005578 Unclassified 1139
87 Ga0068854_101921542 3300005578 Unclassified 544
88 Ga0068856_100017172 3300005614 Bacteria 7013
89 Ga0068856_100050453 3300005614 Bacteria 4102
90 Ga0068856_100632743 3300005614 Bacteria 1090
91 Ga0070702_100524733 3300005615 Unclassified 874
92 Ga0068852_100606318 3300005616 Unclassified 1099
93 Ga0068864_101235960 3300005618 Unclassified 746
94 Ga0068866_10126120 3300005718 Unclassified 1449
95 Ga0068861_100045755 3300005719 Unclassified 3297
96 Ga0068851_10206323 3300005834 Unclassified 1099
97 Ga0068860_102152247 3300005843 Unclassified 579
98 Ga0081455_10040778 3300005937 Bacteria 4091
99 Ga0070717_10005888 3300006028 Bacteria 8977
100 Ga0070717_10028753 3300006028 Bacteria 4453
101 Ga0070717_10063553 3300006028 Bacteria 3064
102 Ga0070717_10139838 3300006028 Unclassified 2087
103 Ga0070717_10158725 3300006028 Unclassified 1961
104 Ga0070717_10262041 3300006028 Bacteria 1529
105 Ga0070717_10279210 3300006028 Unclassified 1481
106 Ga0070717_10429817 3300006028 Unclassified 1188
107 Ga0070717_10430345 3300006028 Bacteria 1187
108 Ga0070717_11073900 3300006028 Bacteria 733
109 Ga0070715_10160182 3300006163 Unclassified 1111
110 Ga0070715_10237841 3300006163 Unclassified 945
111 Ga0070715_10305657 3300006163 Bacteria 853
112 Ga0070715_10762957 3300006163 Unclassified 584
113 Ga0070716_100082636 3300006173 Bacteria 1921
114 Ga0070716_101134316 3300006173 Bacteria 625
115 Ga0070712_100054800 3300006175 Bacteria 2789
116 Ga0070712_100271518 3300006175 Unclassified 1363
117 Ga0070712_100365994 3300006175 Bacteria 1184
118 Ga0070712_100387225 3300006175 Unclassified 1152
119 Ga0070712_100495101 3300006175 Unclassified 1024
120 Ga0070712_100541885 3300006175 Unclassified 980
121 Ga0097621_100489735 3300006237 Bacteria 1112
122 Ga0068871_100882576 3300006358 Unclassified 828
123 Ga0075434_100522546 3300006871 Bacteria 1207
124 Ga0075434_100656292 3300006871 Bacteria 1067
125 Ga0075434_101371357 3300006871 Unclassified 717
126 Ga0075436_100005986 3300006914 Bacteria 8351
127 Ga0075436_100137942 3300006914 Bacteria 1713
128 Ga0075435_100261340 3300007076 Bacteria 1475
129 Ga0099794_10033017 3300007265 Bacteria 2432
130 Ga0099794_10075547 3300007265 Unclassified 1656
131 Ga0099795_10021493 3300007788 Bacteria 2117
132 Ga0105240_10024210 3300009093 Bacteria 8011
133 Ga0105240_10341008 3300009093 Bacteria 1702
134 Ga0105245_10025237 3300009098 Bacteria 5225
135 Ga0105245_10624896 3300009098 Bacteria 1105
136 Ga0105247_10074887 3300009101 Unclassified 2124
137 Ga0105241_10302198 3300009174 Bacteria 1374
138 Ga0105241_10508325 3300009174 Unclassified 1075
139 Ga0105241_10867696 3300009174 Unclassified 836
140 Ga0105242_12992619 3300009176 Unclassified 523
141 Ga0105237_11200117 3300009545 Unclassified 765
142 Ga0105237_11973655 3300009545 Unclassified 592
143 Ga0105238_10059358 3300009551 Bacteria 3832
144 Ga0105238_10121679 3300009551 Bacteria 2589
145 Ga0105238_10893751 3300009551 Unclassified 906
146 Ga0105238_11938299 3300009551 Unclassified 622
147 Ga0105239_10445001 3300010375 Unclassified 1469
148 Ga0105239_11017614 3300010375 Unclassified 953
149 Ga0157370_10891816 3300013104 Unclassified 807
150 Ga0157369_10154975 3300013105 Unclassified 2420
151 Ga0157369_10284868 3300013105 Bacteria 1721
152 Ga0157369_10886003 3300013105 Unclassified 915
153 Ga0157374_10178489 3300013296 Bacteria 2073
154 Ga0157374_10235768 3300013296 Unclassified 1798
155 Ga0157374_10371104 3300013296 Unclassified 1424
156 Ga0157378_10075055 3300013297 Unclassified 3043
157 Ga0157378_10713883 3300013297 Bacteria 1023
158 Ga0157378_12195796 3300013297 Unclassified 603
159 Ga0163162_10063280 3300013306 Bacteria 3741
160 Ga0157372_10219733 3300013307 Unclassified 2203
161 Ga0157372_10222665 3300013307 Bacteria 2187
162 Ga0157372_10226328 3300013307 Bacteria 2168
163 Ga0157372_10561057 3300013307 Bacteria 1331
164 Ga0157372_11214129 3300013307 Unclassified 871
165 Ga0157372_11272602 3300013307 Unclassified 849
166 Ga0157372_11311015 3300013307 Unclassified 835
167 Ga0157372_12618749 3300013307 Unclassified 579
168 Ga0157372_13024616 3300013307 Unclassified 537
169 Ga0163163_10077038 3300014325 Bacteria 3330
170 Ga0157376_10612323 3300014969 Bacteria 1085
171 Ga0157376_10782085 3300014969 Bacteria 966
172 Ga0213875_10277373 3300021388 Bacteria 792
173 Ga0213871_10010060 3300021441 Bacteria 2136
174 Ga0224712_10241676 3300022467 Unclassified 832
175 Ga0207697_10019138 3300025315 Unclassified 2804
176 Ga0207697_10118960 3300025315 Bacteria 1136
177 Ga0207697_10220706 3300025315 Unclassified 836
178 Ga0207692_10095884 3300025898 Bacteria 1619
179 Ga0207692_10283052 3300025898 Bacteria 1004
180 Ga0207692_10632543 3300025898 Unclassified 690
181 Ga0207685_10015636 3300025905 Unclassified 2409
182 Ga0207685_10212608 3300025905 Bacteria 915
183 Ga0207685_10607251 3300025905 Unclassified 588
184 Ga0207699_10126174 3300025906 Bacteria 1662
185 Ga0207699_10277822 3300025906 Bacteria 1163
186 Ga0207699_10496911 3300025906 Unclassified 880
187 Ga0207699_10729289 3300025906 Unclassified 726
188 Ga0207699_10751286 3300025906 Unclassified 715
189 Ga0207699_10837332 3300025906 Unclassified 677
190 Ga0207699_11449295 3300025906 Unclassified 508
191 Ga0207645_10010852 3300025907 Bacteria 6241
192 Ga0207684_11111779 3300025910 Unclassified 657
193 Ga0207654_10383352 3300025911 Unclassified 974
194 Ga0207654_10513664 3300025911 Unclassified 847
195 Ga0207707_10120794 3300025912 Bacteria 2291
196 Ga0207707_10643070 3300025912 Bacteria 894
197 Ga0207695_10297696 3300025913 Unclassified 1505
198 Ga0207671_10048120 3300025914 Bacteria 3156
199 Ga0207671_11025786 3300025914 Unclassified 649
200 Ga0207693_10007827 3300025915 Bacteria 8773
201 Ga0207693_10021597 3300025915 Bacteria 5115
202 Ga0207693_10034605 3300025915 Bacteria 3984
203 Ga0207693_10054845 3300025915 Bacteria 3126
204 Ga0207693_10114785 3300025915 Bacteria 2114
205 Ga0207693_10321691 3300025915 Bacteria 1211
206 Ga0207693_10376507 3300025915 Unclassified 1110
207 Ga0207663_10158460 3300025916 Unclassified 1595
208 Ga0207663_10593103 3300025916 Unclassified 870
209 Ga0207663_10622677 3300025916 Unclassified 850
210 Ga0207663_10689629 3300025916 Bacteria 808
211 Ga0207660_10767102 3300025917 Unclassified 787
212 Ga0207649_10104042 3300025920 Bacteria 1885
213 Ga0207652_11203397 3300025921 Bacteria 659
214 Ga0207652_11325065 3300025921 Unclassified 623
215 Ga0207646_10047658 3300025922 Bacteria 3843
216 Ga0207681_10032528 3300025923 Bacteria 3416
217 Ga0207694_10008164 3300025924 Bacteria 7911
218 Ga0207694_10196048 3300025924 Bacteria 1642
219 Ga0207694_10278130 3300025924 Unclassified 1374
220 Ga0207659_10495624 3300025926 Bacteria 1033
221 Ga0207687_10487779 3300025927 Unclassified 1027
222 Ga0207700_10307802 3300025928 Bacteria 1370
223 Ga0207700_10368854 3300025928 Unclassified 1253
224 Ga0207700_10419894 3300025928 Bacteria 1175
225 Ga0207700_10926749 3300025928 Unclassified 780
226 Ga0207700_10971728 3300025928 Unclassified 760
227 Ga0207700_11408672 3300025928 Unclassified 620
228 Ga0207664_10102195 3300025929 Bacteria 2370
229 Ga0207664_10116361 3300025929 Bacteria 2230
230 Ga0207664_10140532 3300025929 Unclassified 2042
231 Ga0207664_10201070 3300025929 Bacteria 1720
232 Ga0207664_10305426 3300025929 Bacteria 1401
233 Ga0207664_10498839 3300025929 Unclassified 1090
234 Ga0207664_10520731 3300025929 Unclassified 1066
235 Ga0207664_10563150 3300025929 Unclassified 1023
236 Ga0207664_10608857 3300025929 Unclassified 981
237 Ga0207664_10896106 3300025929 Unclassified 797
238 Ga0207665_10005332 3300025939 Bacteria 8592
239 Ga0207665_10017097 3300025939 Bacteria 4763
240 Ga0207665_10082597 3300025939 Bacteria 2214
241 Ga0207665_10431285 3300025939 Bacteria 1009
242 Ga0207691_11044878 3300025940 Bacteria 681
243 Ga0207661_10157374 3300025944 Unclassified 1969
244 Ga0207661_10383946 3300025944 Unclassified 1271
245 Ga0207661_11793050 3300025944 Unclassified 559
246 Ga0207667_10062895 3300025949 Bacteria 3879
247 Ga0207677_10130550 3300026023 Unclassified 1907
248 Ga0207677_10488710 3300026023 Unclassified 1062
249 Ga0207677_10630969 3300026023 Unclassified 943
250 Ga0207639_10207885 3300026041 Unclassified 1683
251 Ga0207702_10159954 3300026078 Unclassified 2056
252 Ga0207702_11477298 3300026078 Unclassified 673
253 Ga0207674_10166502 3300026116 Unclassified 2158
254 Ga0207675_100070571 3300026118 Unclassified 3265
255 Ga0207698_10571320 3300026142 Unclassified 1111
256 Ga0268266_10085798 3300028379 Bacteria 2751
257 Ga0265770_1007583 3300030878 Bacteria 1530
258 Ga0307409_101217241 3300031995 Unclassified 777
259 Ga0307414_10828970 3300032004 Unclassified 845
260 Ga0316212_1012459 3300033547 Bacteria 1211
261 Ga0373926_0444304 3300035083 Unclassified 514
262 Ga0373941_0225087 3300035115 Bacteria 723
263 Ga0373945_0000891 3300035116 Bacteria 8837
264 Ga0373943_0013677 3300035170 Unclassified 3668
265 Ga0373946_0134352 3300035171 Unclassified 1141
266 Ga0373955_0747445 3300035172 Bacteria 601
267 Ga0373924_0159394 3300035410 Bacteria 989
268 Ga0373935_0179787 3300035692 Unclassified 1452
269 Ga0373935_0374063 3300035692 Unclassified 1019
270 Ga0373935_0713968 3300035692 Unclassified 738
271 Ga0373927_0028879 3300035695 Unclassified 3616
272 Ga0373927_0969109 3300035695 Unclassified 561
273 Ga0373933_0109121 3300035724 Bacteria 1725
274 Ga0373947_0016955 3300035725 Unclassified 4186
275 Ga0373937_0396758 3300036401 Bacteria 1309
276 Ga0373925_0099164 3300037068 Unclassified 2237
277 Ga0373925_1013229 3300037068 Bacteria 684
278 Ga0436364_0543308 3300037853 Bacteria 5682
279 Ga0242420_062953 3300038996 Bacteria 743
280 Ga0436360_0463947 3300039438 Bacteria 3070
281 Ga0436360_1209848 3300039438 Unclassified 555
282 Ga0436361_0689274 3300039447 Bacteria 2344
283 Ga0451839_0651848 3300041496 Unclassified 714
284 Ga0453683_0172157 3300044673 Bacteria 1372
285 Ga0466961_0070787 3300044693 Bacteria 2214
286 Ga0466963_0068282 3300044694 Bacteria 2387
287 Ga0466963_0263126 3300044694 Unclassified 1211
288 Ga0466964_0115270 3300044706 Unclassified 1204
289 Ga0466971_0539890 3300044719 Unclassified 578
290 Ga0466957_0003462 3300044842 Bacteria 8663
291 Ga0466960_0215986 3300044901 Bacteria 1053
292 Ga0466959_0065890 3300045049 Bacteria 2628
293 Ga0451576_0316869 3300045051 Bacteria 1632
294 Ga0466958_0580626 3300045836 Unclassified 729
295 Ga0495651_0166103 3300046462 Bacteria 1576
296 Ga0495651_0340627 3300046462 Bacteria 994
297 Ga0495651_0901575 3300046462 Unclassified 541
298 Ga0495580_0080789 3300046472 Bacteria 2266
299 Ga0495582_0323511 3300046473 Bacteria 887
300 Ga0495628_0039014 3300046516 Bacteria 3800
301 Ga0495628_0684287 3300046516 Bacteria 726
302 Ga0495630_0065323 3300046517 Bacteria 2734
303 Ga0495630_0196794 3300046517 Bacteria 1538
304 Ga0495640_0222237 3300046533 Unclassified 1191
305 Ga0495586_0125916 3300046535 Bacteria 1433
306 Ga0495645_0011049 3300046543 Bacteria 6345
307 Ga0495657_0675184 3300046675 Unclassified 595
308 Ga0495599_0081785 3300046678 Bacteria 2017
309 Ga0495646_0163437 3300046680 Bacteria 1231
310 Ga0495669_0257043 3300046684 Unclassified 839
311 Ga0495613_0050316 3300046689 Unclassified 3073
312 Ga0495674_0085391 3300047319 Bacteria 2704
313 Ga0495675_0675136 3300047444 Bacteria 580
314 Ga0495675_0704876 3300047444 Bacteria 565
315 Ga0495684_0124141 3300047471 Bacteria 1943
316 Ga0495684_0871965 3300047471 Unclassified 582
317 Ga0496100_0030994 3300048903 Bacteria 3321
318 Ga0496100_0406135 3300048903 Bacteria 1038
319 Ga0496100_0418067 3300048903 Bacteria 1023
320 Ga0496101_0048420 3300048904 Unclassified 3055
321 Ga0496101_0234368 3300048904 Bacteria 1427
322 Ga0496102_0032984 3300048905 Bacteria 4653
323 Ga0496102_0538695 3300048905 Unclassified 1090
324 Ga0496102_1374369 3300048905 Unclassified 625
325 Ga0496102_1395591 3300048905 Bacteria 619
326 Ga0496103_0072726 3300048906 Bacteria 2154
327 Ga0496103_0469895 3300048906 Unclassified 806
328 Ga0496104_0007722 3300048907 Bacteria 9526
329 Ga0496104_0987403 3300048907 Bacteria 746
330 Ga0496105_0070240 3300048908 Unclassified 2895
331 Ga0496105_1132653 3300048908 Unclassified 579
332 Ga0496106_1115549 3300048909 Unclassified 618
333 Ga0496107_0484308 3300048910 Bacteria 918
334 Ga0496107_1073005 3300048910 Unclassified 583
335 Ga0496107_1209573 3300048910 Bacteria 543
336 Ga0496108_0010348 3300048911 Bacteria 7573
337 Ga0496108_0017135 3300048911 Bacteria 5925
338 Ga0496109_0003120 3300048912 Bacteria 13821
339 Ga0496109_0267590 3300048912 Bacteria 1610
340 Ga0496109_0974150 3300048912 Unclassified 786
341 Ga0496110_0169865 3300048913 Bacteria 1978
342 Ga0496112_0024961 3300048915 Bacteria 5734
343 Ga0496112_0105089 3300048915 Bacteria 2794
344 Ga0496112_0224133 3300048915 Unclassified 1836
345 Ga0496113_0293542 3300048916 Unclassified 1301
346 Ga0496113_0853849 3300048916 Bacteria 721
347 Ga0496114_0161668 3300048917 Bacteria 1948
348 Ga0496114_0517962 3300048917 Unclassified 1055
349 Ga0496115_1273005 3300048918 Unclassified 549
350 Ga0501067_0671851 3300049583 Unclassified 582
351 Ga0501073_0790431 3300049589 Unclassified 654
352 Ga0501209_136697 3300049656 Unclassified 733
353 nmdc:mga0n895_299768_c1 3300050512 Bacteria 1629
354 nmdc:mga0n895_374545_c1 3300050512 Bacteria 1441
355 nmdc:mga0rr50_382311_c1 3300050513 Bacteria 1187
356 nmdc:mga08x19_114489_c1 3300050514 Bacteria 1802
357 nmdc:mga08x19_170677_c1 3300050514 Bacteria 1481
358 nmdc:mga08x19_21962_c1 3300050514 Bacteria 3947
359 Ga0495601_0037668 3300053077 Bacteria 3023
360 Ga0495612_0272483 3300053078 Unclassified 755
361 Ga0587073_0200690 3300059492 Unclassified 598
362 Ga0501082_0173798 3300060353 Bacteria 1873
363 Ga0466962_0062423 3300061719 Bacteria 1779
364 Ga0070684_101483653
365 JGI25405J52794_10040148
366 Ga0065704_10015921
367 Ga0065704_10592406
368 Ga0065715_10007555
369 Ga0065715_10517772
370 Ga0065707_10122838
371 Ga0070683_100377546
372 Ga0070683_101717583
373 Ga0070666_11193839
374 Ga0070680_100709554
375 Ga0068868_100020889
376 Ga0070689_101493733
377 Ga0070671_100144512
378 Ga0070671_100175030
379 Ga0070674_100077447
380 Ga0070673_100124726
381 Ga0070673_101144241
382 Ga0070688_100448973
383 Ga0070688_100903561
384 Ga0070659_101835700
385 Ga0070709_10130724
386 Ga0070709_10710800
387 Ga0070709_10903567
388 Ga0070709_11158462
389 Ga0070714_100004620
390 Ga0070714_100094261
391 Ga0070714_100149318
392 Ga0070714_100272478
393 Ga0070714_100355482
394 Ga0070714_100472969
395 Ga0070714_100519678
396 Ga0070714_100701825
397 Ga0070714_101070985
398 Ga0070714_101225900
399 Ga0070714_101483221
400 Ga0070713_100047991
401 Ga0070713_100284732
402 Ga0070713_100456578
403 Ga0070713_100586929
404 Ga0070713_100866276
405 Ga0070713_102473928
406 Ga0070710_10100337
407 Ga0070710_10153561
408 Ga0070710_10215274
409 Ga0070710_10300594
410 Ga0070710_10427282
411 Ga0070711_100008748
412 Ga0070711_100209530
413 Ga0070711_100244940
414 Ga0070711_100301335
415 Ga0070711_100540143
416 Ga0070711_100798177
417 Ga0070705_100871356
418 Ga0070708_101244768
419 Ga0070678_100816716
420 Ga0070681_10043473
421 Ga0070681_10228790
422 Ga0070681_10256322
423 Ga0070681_10422172
424 Ga0070706_101337043
425 Ga0070699_100002981
426 Ga0070699_100241401
427 Ga0070699_101656077
428 Ga0070679_100327786
429 Ga0070679_101492369
430 Ga0070679_101701936
431 Ga0070684_100141067
432 Ga0070684_100492226
433 Ga0070684_100759249
434 Ga0070697_100384864
435 Ga0070697_100939886
436 Ga0068853_100031671
437 Ga0068853_100950100
438 Ga0068853_100959629
439 Ga0070686_101219223
440 Ga0070695_100018314
441 Ga0070695_100095331
442 Ga0070693_100258037
443 Ga0070665_100426756
444 Ga0070665_100460050
445 Ga0068855_100194965
446 Ga0068855_100977132
447 Ga0070664_100866618
448 Ga0068857_100150066
449 Ga0068854_100397879
450 Ga0068854_101921542
451 Ga0068856_100017172
452 Ga0068856_100050453
453 Ga0068856_100632743
454 Ga0070702_100524733
455 Ga0068852_100606318
456 Ga0068864_101235960
457 Ga0068866_10126120
458 Ga0068861_100045755
459 Ga0068851_10206323
460 Ga0068860_102152247
461 Ga0081455_10040778
462 Ga0070717_10005888
463 Ga0070717_10028753
464 Ga0070717_10063553
465 Ga0070717_10139838
466 Ga0070717_10158725
467 Ga0070717_10262041
468 Ga0070717_10279210
469 Ga0070717_10429817
470 Ga0070717_10430345
471 Ga0070717_11073900
472 Ga0070715_10160182
473 Ga0070715_10237841
474 Ga0070715_10305657
475 Ga0070715_10762957
476 Ga0070716_100082636
477 Ga0070716_101134316
478 Ga0070712_100054800
479 Ga0070712_100271518
480 Ga0070712_100365994
481 Ga0070712_100387225
482 Ga0070712_100495101
483 Ga0070712_100541885
484 Ga0097621_100489735
485 Ga0068871_100882576
486 Ga0075434_100522546
487 Ga0075434_100656292
488 Ga0075434_101371357
489 Ga0075436_100005986
490 Ga0075436_100137942
491 Ga0075435_100261340
492 Ga0099794_10033017
493 Ga0099794_10075547
494 Ga0099795_10021493
495 Ga0105240_10024210
496 Ga0105240_10341008
497 Ga0105245_10025237
498 Ga0105245_10624896
499 Ga0105247_10074887
500 Ga0105241_10302198
501 Ga0105241_10508325
502 Ga0105241_10867696
503 Ga0105242_12992619
504 Ga0105237_11200117
505 Ga0105237_11973655
506 Ga0105238_10059358
507 Ga0105238_10121679
508 Ga0105238_10893751
509 Ga0105238_11938299
510 Ga0105239_10445001
511 Ga0105239_11017614
512 Ga0157370_10891816
513 Ga0157369_10154975
514 Ga0157369_10284868
515 Ga0157369_10886003
516 Ga0157374_10178489
517 Ga0157374_10235768
518 Ga0157374_10371104
519 Ga0157378_10075055
520 Ga0157378_10713883
521 Ga0157378_12195796
522 Ga0163162_10063280
523 Ga0157372_10219733
524 Ga0157372_10222665
525 Ga0157372_10226328
526 Ga0157372_10561057
527 Ga0157372_11214129
528 Ga0157372_11272602
529 Ga0157372_11311015
530 Ga0157372_12618749
531 Ga0157372_13024616
532 Ga0163163_10077038
533 Ga0157376_10612323
534 Ga0157376_10782085
535 Ga0213875_10277373
536 Ga0213871_10010060
537 Ga0224712_10241676
538 Ga0207697_10019138
539 Ga0207697_10118960
540 Ga0207697_10220706
541 Ga0207692_10095884
542 Ga0207692_10283052
543 Ga0207692_10632543
544 Ga0207685_10015636
545 Ga0207685_10212608
546 Ga0207685_10607251
547 Ga0207699_10126174
548 Ga0207699_10277822
549 Ga0207699_10496911
550 Ga0207699_10729289
551 Ga0207699_10751286
552 Ga0207699_10837332
553 Ga0207699_11449295
554 Ga0207645_10010852
555 Ga0207684_11111779
556 Ga0207654_10383352
557 Ga0207654_10513664
558 Ga0207707_10120794
559 Ga0207707_10643070
560 Ga0207695_10297696
561 Ga0207671_10048120
562 Ga0207671_11025786
563 Ga0207693_10007827
564 Ga0207693_10021597
565 Ga0207693_10034605
566 Ga0207693_10054845
567 Ga0207693_10114785
568 Ga0207693_10321691
569 Ga0207693_10376507
570 Ga0207663_10158460
571 Ga0207663_10593103
572 Ga0207663_10622677
573 Ga0207663_10689629
574 Ga0207660_10767102
575 Ga0207649_10104042
576 Ga0207652_11203397
577 Ga0207652_11325065
578 Ga0207646_10047658
579 Ga0207681_10032528
580 Ga0207694_10008164
581 Ga0207694_10196048
582 Ga0207694_10278130
583 Ga0207659_10495624
584 Ga0207687_10487779
585 Ga0207700_10307802
586 Ga0207700_10368854
587 Ga0207700_10419894
588 Ga0207700_10926749
589 Ga0207700_10971728
590 Ga0207700_11408672
591 Ga0207664_10102195
592 Ga0207664_10116361
593 Ga0207664_10140532
594 Ga0207664_10201070
595 Ga0207664_10305426
596 Ga0207664_10498839
597 Ga0207664_10520731
598 Ga0207664_10563150
599 Ga0207664_10608857
600 Ga0207664_10896106
601 Ga0207665_10005332
602 Ga0207665_10017097
603 Ga0207665_10082597
604 Ga0207665_10431285
605 Ga0207691_11044878
606 Ga0207661_10157374
607 Ga0207661_10383946
608 Ga0207661_11793050
609 Ga0207667_10062895
610 Ga0207677_10130550
611 Ga0207677_10488710
612 Ga0207677_10630969
613 Ga0207639_10207885
614 Ga0207702_10159954
615 Ga0207702_11477298
616 Ga0207674_10166502
617 Ga0207675_100070571
618 Ga0207698_10571320
619 Ga0268266_10085798
620 Ga0265770_1007583
621 Ga0307409_101217241
622 Ga0307414_10828970
623 Ga0316212_1012459
624 Ga0373926_0444304
625 Ga0373941_0225087
626 Ga0373945_0000891
627 Ga0373943_0013677
628 Ga0373946_0134352
629 Ga0373955_0747445
630 Ga0373924_0159394
631 Ga0373935_0179787
632 Ga0373935_0374063
633 Ga0373935_0713968
634 Ga0373927_0028879
635 Ga0373927_0969109
636 Ga0373933_0109121
637 Ga0373947_0016955
638 Ga0373937_0396758
639 Ga0373925_0099164
640 Ga0373925_1013229
641 Ga0436364_0543308
642 Ga0242420_062953
643 Ga0436360_0463947
644 Ga0436360_1209848
645 Ga0436361_0689274
646 Ga0451839_0651848
647 Ga0453683_0172157
648 Ga0466961_0070787
649 Ga0466963_0068282
650 Ga0466963_0263126
651 Ga0466964_0115270
652 Ga0466971_0539890
653 Ga0466957_0003462
654 Ga0466960_0215986
655 Ga0466959_0065890
656 Ga0451576_0316869
657 Ga0466958_0580626
658 Ga0495651_0166103
659 Ga0495651_0340627
660 Ga0495651_0901575
661 Ga0495580_0080789
662 Ga0495582_0323511
663 Ga0495628_0039014
664 Ga0495628_0684287
665 Ga0495630_0065323
666 Ga0495630_0196794
667 Ga0495640_0222237
668 Ga0495586_0125916
669 Ga0495645_0011049
670 Ga0495657_0675184
671 Ga0495599_0081785
672 Ga0495646_0163437
673 Ga0495669_0257043
674 Ga0495613_0050316
675 Ga0495674_0085391
676 Ga0495675_0675136
677 Ga0495675_0704876
678 Ga0495684_0124141
679 Ga0495684_0871965
680 Ga0496100_0030994
681 Ga0496100_0406135
682 Ga0496100_0418067
683 Ga0496101_0048420
684 Ga0496101_0234368
685 Ga0496102_0032984
686 Ga0496102_0538695
687 Ga0496102_1374369
688 Ga0496102_1395591
689 Ga0496103_0072726
690 Ga0496103_0469895
691 Ga0496104_0007722
692 Ga0496104_0987403
693 Ga0496105_0070240
694 Ga0496105_1132653
695 Ga0496106_1115549
696 Ga0496107_0484308
697 Ga0496107_1073005
698 Ga0496107_1209573
699 Ga0496108_0010348
700 Ga0496108_0017135
701 Ga0496109_0003120
702 Ga0496109_0267590
703 Ga0496109_0974150
704 Ga0496110_0169865
705 Ga0496112_0024961
706 Ga0496112_0105089
707 Ga0496112_0224133
708 Ga0496113_0293542
709 Ga0496113_0853849
710 Ga0496114_0161668
711 Ga0496114_0517962
712 Ga0496115_1273005
713 Ga0501067_0671851
714 Ga0501073_0790431
715 Ga0501209_136697
716 nmdc:mga0n895_299768_c1
717 nmdc:mga0n895_374545_c1
718 nmdc:mga0rr50_382311_c1
719 nmdc:mga08x19_114489_c1
720 nmdc:mga08x19_170677_c1
721 nmdc:mga08x19_21962_c1
722 Ga0495601_0037668
723 Ga0495612_0272483
724 Ga0587073_0200690
725 Ga0501082_0173798
726 Ga0466962_0062423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

34

111

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r01-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h107a/h111a 0.5981 11 120
6ek9-assembly1.cif.gz_A cytosolic copper storage protein csp from streptomyces lividans: cu loaded form 0.5977 11 124
8esv-assembly1.cif.gz_B structure of human adam10-tspan15 complex bound to 11g2 vfab 0.5914 8 93
6ek9-assembly1.cif.gz_A cytosolic copper storage protein csp from streptomyces lividans: cu loaded form 0.5666 11 124
6r01-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h107a/h111a 0.5596 11 120
ID Description Score Start End Superfamily
af_P75685_2_182_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7664 5 121 1.20.120.550
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7511 9 122 1.20.120.550
af_A0A1D6HRG8_1_138_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7146 15 120 1.20.120.550
af_O05904_2_148_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.712 47 122 1.10.510.10
af_Q2FUR7_14_86_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7109 1 65 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A537M305-F1-model_v4 DoxX family protein 0.9836 6 128 GO:0005886
AF-A0A1Q6ZAM3-F1-model_v4 DoxX family protein 0.9831 3 128 GO:0005886
AF-A0A2V9T2I4-F1-model_v4 DoxX family protein 0.9798 7 128 GO:0005886
AF-A0A534VNY0-F1-model_v4 DoxX family membrane protein 0.9783 3 128 GO:0005886
AF-A0A321LWR8-F1-model_v4 DoxX family protein 0.9718 3 130 GO:0005886

Map