F422872

General Info

Members Datasets Scaffolds Average Seq Length
363 195 726 282

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100087427|Ga0070668_1000874272
Length 315
Sequence MSAAARRAQTRRSAAGSAVTDQRIEVRKTYKLYIGGAFPRSESGRTYEVSDTRGRFLANAAMGSRKDARDAVVAARGAFAKWAGATAYNRGQVLYRVAELMEGRRAQFAAEVAAAEGLTPARADRVVSQSIDRWVWYAGWSDKIGQVLGGANPVAGPYFNISAPEPTGVVAVLAPQRSSLLGLVSVLAPTVVTGNTAVVLTSEQRPLPAVTLSEVLATSDVPAGVINLITGRTAEVAPWLASHQDVNAIDLAGAADADSLDWADLERAAAGNLKRVLRPGGNGADAVEPDWSRTPDLTRVKAGLETKTVWHPKGL

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
90 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
180 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
181 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
182 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
183 2643221679 Angustibacter sp. Root456 Isolate Unclassified
184 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
185 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
186 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
187 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
188 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
189 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
190 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
191 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
192 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
193 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
194 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
195 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.49
Metatranscriptomes 1.1
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0
Rhizoplane 6.89
Rhizosphere 86.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100087427 3300005347 Bacteria 2452
2 JGI25406J46586_10016859 3300003203 Bacteria 3033
3 Ga0070683_100130245 3300005329 Bacteria 2381
4 Ga0070683_100142393 3300005329 Bacteria 2272
5 Ga0070666_10035169 3300005335 Bacteria 3322
6 Ga0070680_100565605 3300005336 Bacteria 975
7 Ga0070682_100424290 3300005337 Bacteria 1012
8 Ga0070668_100325412 3300005347 Bacteria 1295
9 Ga0070659_100144941 3300005366 Bacteria 1935
10 Ga0070713_100121529 3300005436 Bacteria 2291
11 Ga0070713_100165895 3300005436 Bacteria 1975
12 Ga0070710_10023592 3300005437 Bacteria 3235
13 Ga0070710_10127732 3300005437 Bacteria 1546
14 Ga0070705_100026563 3300005440 Bacteria 3152
15 Ga0070707_100070411 3300005468 Bacteria 3369
16 Ga0070679_100085567 3300005530 Bacteria 3140
17 Ga0070679_100224954 3300005530 Bacteria 1837
18 Ga0068854_100401003 3300005578 Bacteria 1135
19 Ga0068852_100174223 3300005616 Bacteria 2019
20 Ga0068852_100307205 3300005616 Bacteria 1537
21 Ga0081455_10003846 3300005937 Bacteria 17122
22 Ga0081455_10014736 3300005937 Bacteria 7631
23 Ga0081455_10017737 3300005937 Bacteria 6810
24 Ga0081540_1005671 3300005983 Bacteria 9276
25 Ga0081539_10013711 3300005985 Bacteria 6086
26 Ga0070717_10038969 3300006028 Bacteria 3865
27 Ga0075368_10019888 3300006042 Bacteria 2538
28 Ga0075364_10167189 3300006051 Bacteria 1486
29 Ga0075364_10285182 3300006051 Bacteria 1123
30 Ga0070715_10007568 3300006163 Bacteria 3744
31 Ga0070716_100024146 3300006173 Bacteria 3233
32 Ga0075367_10072432 3300006178 Bacteria 2074
33 Ga0068871_100352557 3300006358 Bacteria 1302
34 Ga0075428_100013174 3300006844 Bacteria 9197
35 Ga0075428_100014414 3300006844 Bacteria 8784
36 Ga0075428_100072883 3300006844 Bacteria 3750
37 Ga0075428_100087776 3300006844 Bacteria 3392
38 Ga0075428_100184328 3300006844 Bacteria 2259
39 Ga0075430_100012457 3300006846 Bacteria 7236
40 Ga0075430_100017170 3300006846 Bacteria 6162
41 Ga0075430_100128847 3300006846 Bacteria 2109
42 Ga0075431_100011698 3300006847 Bacteria 8852
43 Ga0075431_100448138 3300006847 Bacteria 1287
44 Ga0075433_10302978 3300006852 Bacteria 1415
45 Ga0075429_100000304 3300006880 Bacteria 34801
46 Ga0075429_100008003 3300006880 Bacteria 9181
47 Ga0075429_100027722 3300006880 Bacteria 4916
48 Ga0075429_100221707 3300006880 Bacteria 1656
49 Ga0105240_10258804 3300009093 Bacteria 2009
50 Ga0111539_10004924 3300009094 Bacteria 17378
51 Ga0105245_10005465 3300009098 Bacteria 11163
52 Ga0105245_10051951 3300009098 Bacteria 3675
53 Ga0105245_10223404 3300009098 Bacteria 1818
54 Ga0114129_10057239 3300009147 Bacteria 5457
55 Ga0114129_10132053 3300009147 Bacteria 3428
56 Ga0114129_10346607 3300009147 Bacteria 1969
57 Ga0114129_10551001 3300009147 Bacteria 1499
58 Ga0105243_10322494 3300009148 Bacteria 1408
59 Ga0105242_10215597 3300009176 Bacteria 1713
60 Ga0105238_10201698 3300009551 Bacteria 1965
61 Ga0105238_10239033 3300009551 Bacteria 1794
62 Ga0105238_10251264 3300009551 Bacteria 1747
63 Ga0105249_10226841 3300009553 Bacteria 1841
64 Ga0157371_10454189 3300013102 Bacteria 942
65 Ga0157370_10161670 3300013104 Bacteria 2083
66 Ga0157369_10021468 3300013105 Bacteria 7222
67 Ga0157369_10052711 3300013105 Bacteria 4400
68 Ga0157369_10070801 3300013105 Bacteria 3746
69 Ga0157369_10940596 3300013105 Bacteria 886
70 Ga0157378_10053591 3300013297 Bacteria 3591
71 Ga0157372_10231332 3300013307 Bacteria 2143
72 Ga0157372_10338299 3300013307 Bacteria 1753
73 Ga0157375_10039271 3300013308 Bacteria 4555
74 Ga0182008_10080239 3300014497 Bacteria 1605
75 Ga0157379_10082672 3300014968 Bacteria 2877
76 Ga0163161_10222216 3300017792 Bacteria 1463
77 Ga0163161_10395101 3300017792 Bacteria 1108
78 Ga0206354_10935288 3300020081 Bacteria 1419
79 Ga0206353_12004553 3300020082 Bacteria 2228
80 Ga0206353_12017924 3300020082 Bacteria 10723
81 Ga0207705_10169840 3300025909 Bacteria 1642
82 Ga0207707_10350613 3300025912 Bacteria 1272
83 Ga0207660_10121233 3300025917 Bacteria 1981
84 Ga0207660_10515643 3300025917 Bacteria 971
85 Ga0207652_10215376 3300025921 Bacteria 1730
86 Ga0207687_10422588 3300025927 Bacteria 1100
87 Ga0207706_10316335 3300025933 Bacteria 1359
88 Ga0207686_10005668 3300025934 Bacteria 6693
89 Ga0207686_10397117 3300025934 Bacteria 1049
90 Ga0207709_10032188 3300025935 Bacteria 3069
91 Ga0207661_10032076 3300025944 Bacteria 4067
92 Ga0207712_10153735 3300025961 Bacteria 1780
93 Ga0207640_10365747 3300025981 Bacteria 1164
94 Ga0207639_10302137 3300026041 Bacteria 1415
95 Ga0207683_10161527 3300026121 Bacteria 2025
96 Ga0209813_10050710 3300027866 Bacteria 1296
97 Ga0265337_1022109 3300028556 Bacteria 1975
98 Ga0265336_10003220 3300028666 Bacteria 6474
99 Ga0307515_10140726 3300028794 Bacteria 2590
100 Ga0307515_10165470 3300028794 Bacteria 2232
101 Ga0265320_10031415 3300031240 Bacteria 2727
102 Ga0265327_10045764 3300031251 Bacteria 2323
103 Ga0307513_10000149 3300031456 Bacteria 99930
104 Ga0307408_100154243 3300031548 Bacteria 1816
105 Ga0307408_100353317 3300031548 Bacteria 1248
106 Ga0307408_100493980 3300031548 Bacteria 1070
107 Ga0316575_10002840 3300031665 Bacteria 5879
108 Ga0316576_10002643 3300031727 Bacteria 10231
109 Ga0307413_10035065 3300031824 Bacteria 2875
110 Ga0307413_10313965 3300031824 Bacteria 1194
111 Ga0307410_10009674 3300031852 Bacteria 5421
112 Ga0307410_10103286 3300031852 Bacteria 2047
113 Ga0307410_10338278 3300031852 Bacteria 1199
114 Ga0307406_10070963 3300031901 Bacteria 2282
115 Ga0307406_10185165 3300031901 Bacteria 1519
116 Ga0307406_10232750 3300031901 Bacteria 1377
117 Ga0307407_10126694 3300031903 Bacteria 1627
118 Ga0307412_10101908 3300031911 Bacteria 2032
119 Ga0307409_100018521 3300031995 Bacteria 4685
120 Ga0307409_100040227 3300031995 Bacteria 3478
121 Ga0307409_100167832 3300031995 Bacteria 1928
122 Ga0307416_100084520 3300032002 Bacteria 2697
123 Ga0307411_10113342 3300032005 Bacteria 1946
124 Ga0307411_10115118 3300032005 Bacteria 1933
125 Ga0307411_10204784 3300032005 Bacteria 1518
126 Ga0307415_100267642 3300032126 Bacteria 1398
127 Ga0316583_10009979 3300032133 Bacteria 3419
128 Ga0316574_0050693 3300035398 Bacteria 2584
129 Ga0316574_0163622 3300035398 Bacteria 1433
130 Ga0373931_0047676 3300035691 Bacteria 2268
131 Ga0316582_0152917 3300036647 Bacteria 1560
132 Ga0395900_0023854 3300037418 Bacteria 6260
133 Ga0395900_0150110 3300037418 Bacteria 2381
134 Ga0395898_0023704 3300037466 Bacteria 6195
135 Ga0395898_0037755 3300037466 Bacteria 4790
136 Ga0395898_0048549 3300037466 Bacteria 4162
137 Ga0316581_0001718 3300037588 Bacteria 5037
138 Ga0395901_0002780 3300038443 Bacteria 17645
139 Ga0395901_0152474 3300038443 Bacteria 2428
140 Ga0395901_0271724 3300038443 Bacteria 1763
141 Ga0451797_0756638 3300041453 Bacteria 1444
142 Ga0451843_0423601 3300041509 Bacteria 2356
143 Ga0466969_0004612 3300044656 Bacteria 7339
144 Ga0466965_0138257 3300044683 Bacteria 1267
145 Ga0466966_0106267 3300044684 Bacteria 1732
146 Ga0466961_0006165 3300044693 Bacteria 7611
147 Ga0466968_0162952 3300044735 Bacteria 1030
148 Ga0466970_0036264 3300044765 Bacteria 2612
149 Ga0466957_0086152 3300044842 Bacteria 1963
150 Ga0466957_0092164 3300044842 Bacteria 1900
151 Ga0466960_0022937 3300044901 Bacteria 2796
152 Ga0466960_0085700 3300044901 Bacteria 1596
153 Ga0466960_0168456 3300044901 Bacteria 1181
154 Ga0466960_0185816 3300044901 Bacteria 1129
155 Ga0466960_0330792 3300044901 Bacteria 865
156 Ga0466959_0624868 3300045049 Bacteria 724
157 Ga0466967_0099942 3300045976 Bacteria 2650
158 Ga0466967_0184935 3300045976 Bacteria 1967
159 Ga0466967_0297449 3300045976 Bacteria 1552
160 Ga0466967_0526002 3300045976 Bacteria 1162
161 Ga0466967_0569240 3300045976 Bacteria 1116
162 Ga0495592_0020787 3300046454 Bacteria 4993
163 Ga0495603_0058058 3300046455 Bacteria 2289
164 Ga0495629_0004032 3300046459 Bacteria 11039
165 Ga0495638_0067058 3300046460 Bacteria 2204
166 Ga0495651_0192851 3300046462 Bacteria 1432
167 Ga0495582_0089629 3300046473 Bacteria 1714
168 Ga0495594_0086576 3300046499 Bacteria 1753
169 Ga0495628_0084647 3300046516 Bacteria 2460
170 Ga0495628_0219510 3300046516 Bacteria 1428
171 Ga0495587_0038167 3300046536 Bacteria 2881
172 Ga0495667_0076480 3300046559 Bacteria 2178
173 Ga0495667_0163549 3300046559 Bacteria 1431
174 Ga0495599_0055141 3300046678 Bacteria 2489
175 Ga0495613_0044354 3300046689 Bacteria 3290
176 Ga0495600_0214779 3300046809 Bacteria 1232
177 Ga0495676_0018032 3300047321 Bacteria 6228
178 Ga0495676_0368259 3300047321 Bacteria 958
179 Ga0495680_0117838 3300047322 Bacteria 1963
180 Ga0495675_0142605 3300047444 Bacteria 1484
181 Ga0495684_0123476 3300047471 Bacteria 1949
182 Ga0495614_0032124 3300048089 Bacteria 2260
183 Ga0496100_0108026 3300048903 Bacteria 1929
184 Ga0496101_0230042 3300048904 Bacteria 1441
185 Ga0496101_0400758 3300048904 Bacteria 1080
186 Ga0496102_0487199 3300048905 Bacteria 1155
187 Ga0496104_0004414 3300048907 Bacteria 12256
188 Ga0496104_0344336 3300048907 Bacteria 1403
189 Ga0496106_0111878 3300048909 Bacteria 2127
190 Ga0496106_0202984 3300048909 Bacteria 1578
191 Ga0496107_0308462 3300048910 Bacteria 1178
192 Ga0496108_0415665 3300048911 Bacteria 1175
193 Ga0496108_0527210 3300048911 Bacteria 1031
194 Ga0496109_0020126 3300048912 Bacteria 5895
195 Ga0496109_0440702 3300048912 Bacteria 1230
196 Ga0496109_0485280 3300048912 Bacteria 1166
197 Ga0496110_0051250 3300048913 Bacteria 3627
198 Ga0496110_0227354 3300048913 Bacteria 1697
199 Ga0496111_0036992 3300048914 Bacteria 3492
200 Ga0496111_0258224 3300048914 Bacteria 1293
201 Ga0496111_0433572 3300048914 Bacteria 970
202 Ga0496111_0528255 3300048914 Bacteria 867
203 Ga0496112_0010922 3300048915 Bacteria 8268
204 Ga0496112_0235291 3300048915 Bacteria 1785
205 Ga0496114_0034659 3300048917 Bacteria 4165
206 Ga0496114_0228762 3300048917 Bacteria 1633
207 Ga0496117_0254015 3300048920 Bacteria 957
208 Ga0496122_0218604 3300048925 Bacteria 1096
209 Ga0501323_000271 3300049539 Bacteria 3515
210 Ga0501031_0001393 3300049568 Bacteria 14943
211 Ga0501031_0142409 3300049568 Bacteria 1567
212 Ga0501032_0051579 3300049569 Bacteria 2774
213 Ga0501032_0220159 3300049569 Bacteria 1235
214 Ga0501033_0052204 3300049570 Bacteria 3030
215 Ga0501033_0063304 3300049570 Bacteria 2722
216 Ga0501033_0236809 3300049570 Bacteria 1295
217 Ga0501033_0286938 3300049570 Bacteria 1161
218 Ga0501034_0305605 3300049571 Bacteria 1526
219 Ga0501036_0007741 3300049572 Bacteria 8780
220 Ga0501036_0028045 3300049572 Bacteria 4759
221 Ga0501036_0569507 3300049572 Bacteria 941
222 Ga0501037_0019137 3300049573 Bacteria 5049
223 Ga0501038_0020239 3300049574 Bacteria 5986
224 Ga0501038_0037310 3300049574 Bacteria 4261
225 Ga0501038_0136581 3300049574 Bacteria 2008
226 Ga0501038_0187226 3300049574 Bacteria 1667
227 Ga0501038_0206435 3300049574 Bacteria 1574
228 Ga0501039_0001469 3300049575 Bacteria 17320
229 Ga0501039_0015986 3300049575 Bacteria 5746
230 Ga0501039_0019397 3300049575 Bacteria 5212
231 Ga0501039_0110927 3300049575 Bacteria 2144
232 Ga0501040_0001654 3300049576 Bacteria 14243
233 Ga0501040_0024994 3300049576 Bacteria 4013
234 Ga0501040_0164068 3300049576 Bacteria 1571
235 Ga0501040_0194572 3300049576 Bacteria 1439
236 Ga0501041_0000447 3300049577 Bacteria 20931
237 Ga0501041_0007063 3300049577 Bacteria 6587
238 Ga0501041_0123909 3300049577 Bacteria 1607
239 Ga0501041_0135200 3300049577 Bacteria 1536
240 Ga0501042_0001109 3300049578 Bacteria 15486
241 Ga0501042_0001751 3300049578 Bacteria 12972
242 Ga0501042_0004961 3300049578 Bacteria 8519
243 Ga0501042_0024322 3300049578 Bacteria 4248
244 Ga0501042_0106992 3300049578 Bacteria 2013
245 Ga0501042_0271979 3300049578 Bacteria 1223
246 Ga0501043_0017307 3300049579 Bacteria 5655
247 Ga0501046_0010782 3300049580 Bacteria 7837
248 Ga0501046_0057498 3300049580 Bacteria 3051
249 Ga0501046_0185280 3300049580 Bacteria 1555
250 Ga0501046_0343253 3300049580 Bacteria 1085
251 Ga0501048_0005750 3300049582 Bacteria 9422
252 Ga0501048_0005810 3300049582 Bacteria 9385
253 Ga0501048_0108773 3300049582 Bacteria 1957
254 Ga0501067_0004242 3300049583 Bacteria 7906
255 Ga0501067_0089076 3300049583 Bacteria 1713
256 Ga0501068_0017371 3300049584 Bacteria 4161
257 Ga0501068_0022824 3300049584 Bacteria 3663
258 Ga0501069_0030174 3300049585 Bacteria 2977
259 Ga0501070_0028659 3300049586 Bacteria 4669
260 Ga0501070_0050021 3300049586 Bacteria 3470
261 Ga0501070_0184539 3300049586 Bacteria 1716
262 Ga0501070_0347666 3300049586 Bacteria 1204
263 Ga0501071_0000684 3300049587 Bacteria 17733
264 Ga0501071_0015604 3300049587 Bacteria 5216
265 Ga0501071_0108939 3300049587 Bacteria 2046
266 Ga0501071_0111844 3300049587 Bacteria 2019
267 Ga0501072_0007824 3300049588 Bacteria 8117
268 Ga0501072_0011821 3300049588 Bacteria 6669
269 Ga0501072_0034189 3300049588 Bacteria 3984
270 Ga0501072_0062504 3300049588 Bacteria 2937
271 Ga0501073_0247215 3300049589 Bacteria 1231
272 Ga0501074_0135218 3300049590 Bacteria 1763
273 Ga0501074_0156551 3300049590 Bacteria 1627
274 Ga0501074_0217575 3300049590 Bacteria 1360
275 Ga0501074_0307639 3300049590 Bacteria 1126
276 Ga0501075_0001502 3300049591 Bacteria 15206
277 Ga0501075_0006052 3300049591 Bacteria 8298
278 Ga0501075_0029058 3300049591 Bacteria 4086
279 Ga0501076_0002623 3300049592 Bacteria 12391
280 Ga0501076_0028822 3300049592 Bacteria 4314
281 Ga0501076_0036605 3300049592 Bacteria 3845
282 Ga0501076_0051618 3300049592 Bacteria 3256
283 Ga0501076_0117822 3300049592 Bacteria 2149
284 Ga0501077_0015145 3300049593 Bacteria 4848
285 Ga0501077_0065731 3300049593 Bacteria 2300
286 Ga0501077_0073048 3300049593 Bacteria 2173
287 Ga0501077_0079059 3300049593 Bacteria 2083
288 Ga0501077_0203285 3300049593 Bacteria 1258
289 Ga0501079_0005589 3300049741 Bacteria 9383
290 Ga0501079_0009468 3300049741 Bacteria 7383
291 Ga0501079_0023559 3300049741 Bacteria 4724
292 Ga0501079_0040277 3300049741 Bacteria 3604
293 Ga0501079_0041691 3300049741 Bacteria 3544
294 Ga0501079_0049824 3300049741 Bacteria 3233
295 Ga0501079_0362791 3300049741 Bacteria 1135
296 Ga0501080_0004822 3300049742 Bacteria 12027
297 Ga0501080_0020100 3300049742 Bacteria 6179
298 Ga0501080_0106599 3300049742 Bacteria 2597
299 Ga0501080_0120075 3300049742 Bacteria 2436
300 Ga0501081_0006932 3300049743 Bacteria 7363
301 Ga0501081_0113906 3300049743 Bacteria 1921
302 Ga0501081_0216267 3300049743 Bacteria 1393
303 Ga0501083_0023209 3300049744 Bacteria 4303
304 Ga0501083_0049949 3300049744 Bacteria 2817
305 Ga0501035_0013057 3300049822 Bacteria 7664
306 Ga0501035_0027621 3300049822 Bacteria 5186
307 Ga0501035_0061656 3300049822 Bacteria 3338
308 Ga0501035_0106063 3300049822 Bacteria 2464
309 Ga0501044_0064622 3300049823 Bacteria 3735
310 Ga0501044_0174380 3300049823 Bacteria 2120
311 Ga0501045_0005358 3300049824 Bacteria 8888
312 Ga0501045_0029756 3300049824 Bacteria 3949
313 nmdc:mga03n38_33167_c1 3300050490 Bacteria 2194
314 nmdc:mga00v17_59985_c1 3300050491 Bacteria 2335
315 nmdc:mga0yw44_3327_c1 3300050492 Bacteria 7115
316 nmdc:mga0yw44_77636_c1 3300050492 Bacteria 2075
317 nmdc:mga04h51_31790_c1 3300050495 Bacteria 1670
318 nmdc:mga05p37_187806_c1 3300050507 Bacteria 2512
319 nmdc:mga05p37_71427_c1 3300050507 Bacteria 4270
320 nmdc:mga09592_16697_c1 3300050508 Bacteria 6008
321 nmdc:mga09592_174289_c1 3300050508 Bacteria 1860
322 nmdc:mga09592_217357_c1 3300050508 Bacteria 1656
323 nmdc:mga09592_68604_c1 3300050508 Bacteria 3008
324 nmdc:mga09592_91056_c1 3300050508 Bacteria 2606
325 nmdc:mga0qj67_18762_c1 3300050509 Bacteria 5274
326 nmdc:mga0qj67_19396_c1 3300050509 Bacteria 5195
327 nmdc:mga0qj67_53813_c1 3300050509 Bacteria 3187
328 nmdc:mga06r32_404788_c1 3300050510 Bacteria 1347
329 nmdc:mga06r32_59574_c1 3300050510 Bacteria 3673
330 nmdc:mga06r32_99187_c1 3300050510 Bacteria 1382
331 Ga0495619_0051061 3300053085 Bacteria 2732
332 Ga0500616_0004317 3300053153 Bacteria 10198
333 Ga0501084_0000878 3300054114 Bacteria 23233
334 Ga0501084_0015476 3300054114 Bacteria 6325
335 Ga0501084_0033134 3300054114 Bacteria 4321
336 Ga0501084_0057171 3300054114 Bacteria 3264
337 Ga0501084_0100817 3300054114 Bacteria 2424
338 Ga0501084_0227175 3300054114 Bacteria 1575
339 Ga0501082_0022236 3300060353 Bacteria 5464
340 Ga0501082_0039025 3300060353 Bacteria 4096
341 Ga0501082_0115447 3300060353 Bacteria 2325
342 Ga0466962_0023134 3300061719 Bacteria 2987
343 Ga0466962_0039263 3300061719 Bacteria 2267
344 Ga0530510_0003117 3300061734 Bacteria 11380
345 Ga0530510_0043674 3300061734 Bacteria 3238
346 Ga0530510_0104864 3300061734 Bacteria 2068
347 Ga0530510_0178880 3300061734 Bacteria 1572
348 2623502239 2622736605 Bacteria 4992138
349 2644014313 2643221601 Bacteria 7493239
350 2644175750 2643221631 Bacteria 8168043
351 2644444468 2643221679 Bacteria 3839507
352 2731908818 2731639228 Bacteria 4187555
353 2819728565 2818991469 Bacteria 4644110
354 2819742409 2818991472 Bacteria 10089953
355 2837269186 2837268691 Bacteria 7850704
356 2857733485 2857729791 Bacteria 4040535
357 2884695401 2884693830 Bacteria 11273186
358 2887447221 2887443736 Bacteria 4426037
359 2895445891 2895442618 Bacteria 11027144
360 2919447714 2919446982 Bacteria 3994487
361 2928124717 2928121344 Bacteria 3972376
362 8048133237 8048127548 Bacteria 11053136
363 8056063506 8056060235 Bacteria 7259403
364 Ga0070668_100087427
365 JGI25406J46586_10016859
366 Ga0070683_100130245
367 Ga0070683_100142393
368 Ga0070666_10035169
369 Ga0070680_100565605
370 Ga0070682_100424290
371 Ga0070668_100325412
372 Ga0070659_100144941
373 Ga0070713_100121529
374 Ga0070713_100165895
375 Ga0070710_10023592
376 Ga0070710_10127732
377 Ga0070705_100026563
378 Ga0070707_100070411
379 Ga0070679_100085567
380 Ga0070679_100224954
381 Ga0068854_100401003
382 Ga0068852_100174223
383 Ga0068852_100307205
384 Ga0081455_10003846
385 Ga0081455_10014736
386 Ga0081455_10017737
387 Ga0081540_1005671
388 Ga0081539_10013711
389 Ga0070717_10038969
390 Ga0075368_10019888
391 Ga0075364_10167189
392 Ga0075364_10285182
393 Ga0070715_10007568
394 Ga0070716_100024146
395 Ga0075367_10072432
396 Ga0068871_100352557
397 Ga0075428_100013174
398 Ga0075428_100014414
399 Ga0075428_100072883
400 Ga0075428_100087776
401 Ga0075428_100184328
402 Ga0075430_100012457
403 Ga0075430_100017170
404 Ga0075430_100128847
405 Ga0075431_100011698
406 Ga0075431_100448138
407 Ga0075433_10302978
408 Ga0075429_100000304
409 Ga0075429_100008003
410 Ga0075429_100027722
411 Ga0075429_100221707
412 Ga0105240_10258804
413 Ga0111539_10004924
414 Ga0105245_10005465
415 Ga0105245_10051951
416 Ga0105245_10223404
417 Ga0114129_10057239
418 Ga0114129_10132053
419 Ga0114129_10346607
420 Ga0114129_10551001
421 Ga0105243_10322494
422 Ga0105242_10215597
423 Ga0105238_10201698
424 Ga0105238_10239033
425 Ga0105238_10251264
426 Ga0105249_10226841
427 Ga0157371_10454189
428 Ga0157370_10161670
429 Ga0157369_10021468
430 Ga0157369_10052711
431 Ga0157369_10070801
432 Ga0157369_10940596
433 Ga0157378_10053591
434 Ga0157372_10231332
435 Ga0157372_10338299
436 Ga0157375_10039271
437 Ga0182008_10080239
438 Ga0157379_10082672
439 Ga0163161_10222216
440 Ga0163161_10395101
441 Ga0206354_10935288
442 Ga0206353_12004553
443 Ga0206353_12017924
444 Ga0207705_10169840
445 Ga0207707_10350613
446 Ga0207660_10121233
447 Ga0207660_10515643
448 Ga0207652_10215376
449 Ga0207687_10422588
450 Ga0207706_10316335
451 Ga0207686_10005668
452 Ga0207686_10397117
453 Ga0207709_10032188
454 Ga0207661_10032076
455 Ga0207712_10153735
456 Ga0207640_10365747
457 Ga0207639_10302137
458 Ga0207683_10161527
459 Ga0209813_10050710
460 Ga0265337_1022109
461 Ga0265336_10003220
462 Ga0307515_10140726
463 Ga0307515_10165470
464 Ga0265320_10031415
465 Ga0265327_10045764
466 Ga0307513_10000149
467 Ga0307408_100154243
468 Ga0307408_100353317
469 Ga0307408_100493980
470 Ga0316575_10002840
471 Ga0316576_10002643
472 Ga0307413_10035065
473 Ga0307413_10313965
474 Ga0307410_10009674
475 Ga0307410_10103286
476 Ga0307410_10338278
477 Ga0307406_10070963
478 Ga0307406_10185165
479 Ga0307406_10232750
480 Ga0307407_10126694
481 Ga0307412_10101908
482 Ga0307409_100018521
483 Ga0307409_100040227
484 Ga0307409_100167832
485 Ga0307416_100084520
486 Ga0307411_10113342
487 Ga0307411_10115118
488 Ga0307411_10204784
489 Ga0307415_100267642
490 Ga0316583_10009979
491 Ga0316574_0050693
492 Ga0316574_0163622
493 Ga0373931_0047676
494 Ga0316582_0152917
495 Ga0395900_0023854
496 Ga0395900_0150110
497 Ga0395898_0023704
498 Ga0395898_0037755
499 Ga0395898_0048549
500 Ga0316581_0001718
501 Ga0395901_0002780
502 Ga0395901_0152474
503 Ga0395901_0271724
504 Ga0451797_0756638
505 Ga0451843_0423601
506 Ga0466969_0004612
507 Ga0466965_0138257
508 Ga0466966_0106267
509 Ga0466961_0006165
510 Ga0466968_0162952
511 Ga0466970_0036264
512 Ga0466957_0086152
513 Ga0466957_0092164
514 Ga0466960_0022937
515 Ga0466960_0085700
516 Ga0466960_0168456
517 Ga0466960_0185816
518 Ga0466960_0330792
519 Ga0466959_0624868
520 Ga0466967_0099942
521 Ga0466967_0184935
522 Ga0466967_0297449
523 Ga0466967_0526002
524 Ga0466967_0569240
525 Ga0495592_0020787
526 Ga0495603_0058058
527 Ga0495629_0004032
528 Ga0495638_0067058
529 Ga0495651_0192851
530 Ga0495582_0089629
531 Ga0495594_0086576
532 Ga0495628_0084647
533 Ga0495628_0219510
534 Ga0495587_0038167
535 Ga0495667_0076480
536 Ga0495667_0163549
537 Ga0495599_0055141
538 Ga0495613_0044354
539 Ga0495600_0214779
540 Ga0495676_0018032
541 Ga0495676_0368259
542 Ga0495680_0117838
543 Ga0495675_0142605
544 Ga0495684_0123476
545 Ga0495614_0032124
546 Ga0496100_0108026
547 Ga0496101_0230042
548 Ga0496101_0400758
549 Ga0496102_0487199
550 Ga0496104_0004414
551 Ga0496104_0344336
552 Ga0496106_0111878
553 Ga0496106_0202984
554 Ga0496107_0308462
555 Ga0496108_0415665
556 Ga0496108_0527210
557 Ga0496109_0020126
558 Ga0496109_0440702
559 Ga0496109_0485280
560 Ga0496110_0051250
561 Ga0496110_0227354
562 Ga0496111_0036992
563 Ga0496111_0258224
564 Ga0496111_0433572
565 Ga0496111_0528255
566 Ga0496112_0010922
567 Ga0496112_0235291
568 Ga0496114_0034659
569 Ga0496114_0228762
570 Ga0496117_0254015
571 Ga0496122_0218604
572 Ga0501323_000271
573 Ga0501031_0001393
574 Ga0501031_0142409
575 Ga0501032_0051579
576 Ga0501032_0220159
577 Ga0501033_0052204
578 Ga0501033_0063304
579 Ga0501033_0236809
580 Ga0501033_0286938
581 Ga0501034_0305605
582 Ga0501036_0007741
583 Ga0501036_0028045
584 Ga0501036_0569507
585 Ga0501037_0019137
586 Ga0501038_0020239
587 Ga0501038_0037310
588 Ga0501038_0136581
589 Ga0501038_0187226
590 Ga0501038_0206435
591 Ga0501039_0001469
592 Ga0501039_0015986
593 Ga0501039_0019397
594 Ga0501039_0110927
595 Ga0501040_0001654
596 Ga0501040_0024994
597 Ga0501040_0164068
598 Ga0501040_0194572
599 Ga0501041_0000447
600 Ga0501041_0007063
601 Ga0501041_0123909
602 Ga0501041_0135200
603 Ga0501042_0001109
604 Ga0501042_0001751
605 Ga0501042_0004961
606 Ga0501042_0024322
607 Ga0501042_0106992
608 Ga0501042_0271979
609 Ga0501043_0017307
610 Ga0501046_0010782
611 Ga0501046_0057498
612 Ga0501046_0185280
613 Ga0501046_0343253
614 Ga0501048_0005750
615 Ga0501048_0005810
616 Ga0501048_0108773
617 Ga0501067_0004242
618 Ga0501067_0089076
619 Ga0501068_0017371
620 Ga0501068_0022824
621 Ga0501069_0030174
622 Ga0501070_0028659
623 Ga0501070_0050021
624 Ga0501070_0184539
625 Ga0501070_0347666
626 Ga0501071_0000684
627 Ga0501071_0015604
628 Ga0501071_0108939
629 Ga0501071_0111844
630 Ga0501072_0007824
631 Ga0501072_0011821
632 Ga0501072_0034189
633 Ga0501072_0062504
634 Ga0501073_0247215
635 Ga0501074_0135218
636 Ga0501074_0156551
637 Ga0501074_0217575
638 Ga0501074_0307639
639 Ga0501075_0001502
640 Ga0501075_0006052
641 Ga0501075_0029058
642 Ga0501076_0002623
643 Ga0501076_0028822
644 Ga0501076_0036605
645 Ga0501076_0051618
646 Ga0501076_0117822
647 Ga0501077_0015145
648 Ga0501077_0065731
649 Ga0501077_0073048
650 Ga0501077_0079059
651 Ga0501077_0203285
652 Ga0501079_0005589
653 Ga0501079_0009468
654 Ga0501079_0023559
655 Ga0501079_0040277
656 Ga0501079_0041691
657 Ga0501079_0049824
658 Ga0501079_0362791
659 Ga0501080_0004822
660 Ga0501080_0020100
661 Ga0501080_0106599
662 Ga0501080_0120075
663 Ga0501081_0006932
664 Ga0501081_0113906
665 Ga0501081_0216267
666 Ga0501083_0023209
667 Ga0501083_0049949
668 Ga0501035_0013057
669 Ga0501035_0027621
670 Ga0501035_0061656
671 Ga0501035_0106063
672 Ga0501044_0064622
673 Ga0501044_0174380
674 Ga0501045_0005358
675 Ga0501045_0029756
676 nmdc:mga03n38_33167_c1
677 nmdc:mga00v17_59985_c1
678 nmdc:mga0yw44_3327_c1
679 nmdc:mga0yw44_77636_c1
680 nmdc:mga04h51_31790_c1
681 nmdc:mga05p37_187806_c1
682 nmdc:mga05p37_71427_c1
683 nmdc:mga09592_16697_c1
684 nmdc:mga09592_174289_c1
685 nmdc:mga09592_217357_c1
686 nmdc:mga09592_68604_c1
687 nmdc:mga09592_91056_c1
688 nmdc:mga0qj67_18762_c1
689 nmdc:mga0qj67_19396_c1
690 nmdc:mga0qj67_53813_c1
691 nmdc:mga06r32_404788_c1
692 nmdc:mga06r32_59574_c1
693 nmdc:mga06r32_99187_c1
694 Ga0495619_0051061
695 Ga0500616_0004317
696 Ga0501084_0000878
697 Ga0501084_0015476
698 Ga0501084_0033134
699 Ga0501084_0057171
700 Ga0501084_0100817
701 Ga0501084_0227175
702 Ga0501082_0022236
703 Ga0501082_0039025
704 Ga0501082_0115447
705 Ga0466962_0023134
706 Ga0466962_0039263
707 Ga0530510_0003117
708 Ga0530510_0043674
709 Ga0530510_0104864
710 Ga0530510_0178880
711 2623502239
712 2644014313
713 2644175750
714 2644444468
715 2731908818
716 2819728565
717 2819742409
718 2837269186
719 2857733485
720 2884695401
721 2887447221
722 2895445891
723 2919447714
724 2928124717
725 8048133237
726 8056063506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

38

300

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4go4-assembly4.cif.gz_G crystal structure of pnpe in complex with nicotinamide adenine dinucleotide 0.9467 23 275
4go2-assembly1.cif.gz_C crystal structure of the c-terminal domain of 10'formyltetrahydrofolate dehydrogenase in complex with thio-nadp 0.9425 23 243
4go0-assembly1.cif.gz_B crystal structure of the c707s mutant of c-terminal domain of 10'formyltetrahydrofolate dehydrogenase in complex with nadph 0.9417 23 243
3rhj-assembly1.cif.gz_D crystal structure of the e673a mutant of the c-terminal domain of rat 10'formyltetrahydrofolate dehydrogenase in complex with co-purified nadp 0.9405 23 243
3rhr-assembly1.cif.gz_B crystal structure of the c707a mutant of the c-terminal domain of 10'formyltetrahydrofolate dehydrogenase in complex with nadph 0.9404 23 243
ID Description Score Start End Superfamily
af_A0A0R0ESV8_56_300_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9513 23 243 3.40.605.10
4lihA01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9464 23 243 3.40.605.10
af_Q9URW9_34_486_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9402 38 274 3.40.605.10
af_Q9URW9_21_270_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9332 24 279 3.40.605.10
af_F1QGP1_508_771_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9311 17 274 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A7Y9UQ32-F1-model_v4 Acyl-CoA reductase-like NAD-dependent aldehyde dehydrogenase 0.9688 15 319 GO:0016491
AF-A0A5M3X375-F1-model_v4 Aldehyde dehydrogenase 0.9654 42 319 GO:0016491
AF-A0A7Y9UQ32-F1-model_v4 Acyl-CoA reductase-like NAD-dependent aldehyde dehydrogenase 0.9622 15 319 GO:0016491
AF-A0A3C1Q195-F1-model_v4 Aldehyde dehydrogenase 0.9621 15 242 GO:0016491
AF-A0A5M3X375-F1-model_v4 Aldehyde dehydrogenase 0.9617 42 319 GO:0016491

Map