F422736

General Info

Members Datasets Scaffolds Average Seq Length
362 203 724 84

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0005860|Ga0495621_0005860_568_789
Length 73
Sequence MARVANAKPEETDRYIRGVFEAQSKAWGSPLLNHLVYARRPSIFKGARSMWTGIDALRSLINRRVASLNGCVF

Samples

Sample ID Description Type Environment
1 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
156 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
161 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
162 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.21
Rhizosphere 97.24
Stem 0
Stem Tuber 0
Unclassified 17.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495621_0005860 3300046539 Bacteria 3559
2 SwRhRL2b_contig_2973307 2162886007 Bacteria 1629
3 Ga0065715_10146054 3300005293 Bacteria 1787
4 Ga0065707_10004493 3300005295 Bacteria 3559
5 Ga0070676_10001600 3300005328 Bacteria 11514
6 Ga0070670_100002405 3300005331 Bacteria 15429
7 Ga0070670_100152626 3300005331 Bacteria 1999
8 Ga0070670_101359882 3300005331 Unclassified 651
9 Ga0070680_100102371 3300005336 Bacteria 2378
10 Ga0070680_100163855 3300005336 Bacteria 1869
11 Ga0070682_100000140 3300005337 Bacteria 57399
12 Ga0068868_100211615 3300005338 Bacteria 1620
13 Ga0070660_100001436 3300005339 Bacteria 16251
14 Ga0070689_100088369 3300005340 Bacteria 2439
15 Ga0070689_100126333 3300005340 Bacteria 2047
16 Ga0070691_10000716 3300005341 Bacteria 12968
17 Ga0070687_100420192 3300005343 Bacteria 882
18 Ga0070687_101364530 3300005343 Unclassified 529
19 Ga0070661_100004561 3300005344 Bacteria 9526
20 Ga0070669_100000650 3300005353 Bacteria 25711
21 Ga0070669_100020448 3300005353 Bacteria 4727
22 Ga0070669_101713654 3300005353 Unclassified 548
23 Ga0070673_100528137 3300005364 Unclassified 1070
24 Ga0070673_101643515 3300005364 Unclassified 607
25 Ga0070688_100249135 3300005365 Bacteria 1264
26 Ga0070703_10002792 3300005406 Bacteria 5000
27 Ga0070703_10070162 3300005406 Bacteria 1169
28 Ga0070701_10029638 3300005438 Unclassified 2700
29 Ga0070701_10035179 3300005438 Bacteria 2515
30 Ga0070705_100001536 3300005440 Bacteria 12158
31 Ga0070705_100339656 3300005440 Unclassified 1091
32 Ga0070705_100907522 3300005440 Bacteria 709
33 Ga0070694_100002628 3300005444 Bacteria 10620
34 Ga0070694_101375229 3300005444 Unclassified 595
35 Ga0070708_100080766 3300005445 Bacteria 2943
36 Ga0070708_100464096 3300005445 Unclassified 1194
37 Ga0070708_100563278 3300005445 Bacteria 1074
38 Ga0070708_101827036 3300005445 Bacteria 564
39 Ga0070662_100006397 3300005457 Bacteria 7589
40 Ga0070662_100275579 3300005457 Unclassified 1360
41 Ga0070681_10003714 3300005458 Bacteria 14319
42 Ga0070681_10449236 3300005458 Bacteria 1201
43 Ga0068867_100003088 3300005459 Bacteria 11735
44 Ga0070706_100036694 3300005467 Bacteria 4528
45 Ga0070707_100005316 3300005468 Bacteria 12048
46 Ga0070707_100019490 3300005468 Bacteria 6391
47 Ga0070707_101129848 3300005468 Bacteria 749
48 Ga0070698_100039316 3300005471 Bacteria 4871
49 Ga0070698_100138649 3300005471 Bacteria 2385
50 Ga0070699_100008507 3300005518 Bacteria 8893
51 Ga0070699_101051964 3300005518 Bacteria 747
52 Ga0070699_101327498 3300005518 Bacteria 660
53 Ga0070699_101949328 3300005518 Bacteria 537
54 Ga0070679_100001975 3300005530 Bacteria 18402
55 Ga0070679_100426475 3300005530 Bacteria 1271
56 Ga0070684_100042221 3300005535 Bacteria 3936
57 Ga0070697_100000095 3300005536 Bacteria 74109
58 Ga0070697_100089731 3300005536 Bacteria 2540
59 Ga0070697_100541300 3300005536 Bacteria 1020
60 Ga0068853_100033686 3300005539 Bacteria 4346
61 Ga0070686_100008295 3300005544 Bacteria 5816
62 Ga0070695_100001850 3300005545 Bacteria 11944
63 Ga0070695_101141840 3300005545 Bacteria 639
64 Ga0070695_101180049 3300005545 Unclassified 629
65 Ga0070696_100018221 3300005546 Unclassified 4743
66 Ga0070696_100022153 3300005546 Bacteria 4315
67 Ga0070696_100248173 3300005546 Unclassified 1345
68 Ga0070696_100341776 3300005546 Bacteria 1157
69 Ga0070696_101204189 3300005546 Bacteria 640
70 Ga0070693_100000392 3300005547 Bacteria 19904
71 Ga0070665_102390366 3300005548 Unclassified 531
72 Ga0070704_100000654 3300005549 Bacteria 16708
73 Ga0070704_100169678 3300005549 Bacteria 1734
74 Ga0068855_100008374 3300005563 Bacteria 12505
75 Ga0068857_100008160 3300005577 Bacteria 9042
76 Ga0068857_100205520 3300005577 Unclassified 1796
77 Ga0068857_100343308 3300005577 Unclassified 1381
78 Ga0068857_100348548 3300005577 Bacteria 1371
79 Ga0068857_100565021 3300005577 Bacteria 1073
80 Ga0068856_100000361 3300005614 Bacteria 49820
81 Ga0070702_100001687 3300005615 Bacteria 9169
82 Ga0070702_100552379 3300005615 Unclassified 855
83 Ga0068859_100005682 3300005617 Bacteria 12696
84 Ga0068859_101491599 3300005617 Unclassified 746
85 Ga0068864_100006049 3300005618 Bacteria 9933
86 Ga0068861_100071275 3300005719 Bacteria 2693
87 Ga0068851_10206166 3300005834 Bacteria 1099
88 Ga0068870_10000988 3300005840 Bacteria 11215
89 Ga0068863_100062109 3300005841 Bacteria 3533
90 Ga0068860_100006174 3300005843 Bacteria 12051
91 Ga0068860_100986418 3300005843 Bacteria 860
92 Ga0068862_100024050 3300005844 Bacteria 5107
93 Ga0068862_101104648 3300005844 Unclassified 788
94 Ga0081455_10059114 3300005937 Bacteria 3239
95 Ga0081455_10210522 3300005937 Bacteria 1449
96 Ga0070716_101210369 3300006173 Bacteria 607
97 Ga0068871_100667547 3300006358 Bacteria 950
98 Ga0075428_100111464 3300006844 Bacteria 2981
99 Ga0075428_100993018 3300006844 Bacteria 889
100 Ga0075430_100057674 3300006846 Bacteria 3265
101 Ga0075430_100128788 3300006846 Bacteria 2110
102 Ga0075430_100255316 3300006846 Unclassified 1452
103 Ga0075430_101670581 3300006846 Bacteria 523
104 Ga0075431_100019658 3300006847 Bacteria 6891
105 Ga0075431_100239836 3300006847 Bacteria 1845
106 Ga0075431_100415953 3300006847 Bacteria 1344
107 Ga0075431_100477458 3300006847 Bacteria 1240
108 Ga0075431_100519765 3300006847 Bacteria 1180
109 Ga0075431_100699995 3300006847 Bacteria 991
110 Ga0075431_100850468 3300006847 Bacteria 884
111 Ga0075433_10002293 3300006852 Bacteria 14570
112 Ga0075433_10006598 3300006852 Bacteria 9186
113 Ga0075433_10080120 3300006852 Bacteria 2878
114 Ga0075433_10837956 3300006852 Bacteria 803
115 Ga0075434_100005361 3300006871 Bacteria 11667
116 Ga0075434_100178803 3300006871 Bacteria 2141
117 Ga0075434_100380694 3300006871 Bacteria 1432
118 Ga0075434_100898071 3300006871 Bacteria 901
119 Ga0075429_100003951 3300006880 Bacteria 12677
120 Ga0075429_100185092 3300006880 Unclassified 1825
121 Ga0075429_101195942 3300006880 Bacteria 663
122 Ga0075436_100322646 3300006914 Bacteria 1109
123 Ga0097620_100005682 3300006931 Bacteria 12696
124 Ga0097620_101492120 3300006931 Unclassified 746
125 Ga0075435_100013584 3300007076 Bacteria 6063
126 Ga0075435_100197437 3300007076 Bacteria 1704
127 Ga0075435_100200348 3300007076 Bacteria 1691
128 Ga0099794_10005763 3300007265 Bacteria 4991
129 Ga0105240_10520962 3300009093 Bacteria 1319
130 Ga0105240_11685131 3300009093 Unclassified 662
131 Ga0105245_12781504 3300009098 Unclassified 542
132 Ga0114129_10006928 3300009147 Bacteria 16121
133 Ga0114129_10009143 3300009147 Bacteria 14127
134 Ga0114129_10042884 3300009147 Bacteria 6367
135 Ga0114129_10172094 3300009147 Bacteria 2951
136 Ga0114129_10246357 3300009147 Bacteria 2401
137 Ga0114129_10258558 3300009147 Bacteria 2335
138 Ga0114129_10879248 3300009147 Bacteria 1137
139 Ga0105243_10034636 3300009148 Unclassified 3911
140 Ga0105243_10129284 3300009148 Bacteria 2141
141 Ga0105243_11870178 3300009148 Unclassified 633
142 Ga0105243_12010832 3300009148 Bacteria 612
143 Ga0105243_12432218 3300009148 Unclassified 562
144 Ga0105241_10001177 3300009174 Bacteria 19940
145 Ga0105241_11687662 3300009174 Unclassified 615
146 Ga0105242_12438682 3300009176 Unclassified 571
147 Ga0105248_10399398 3300009177 Unclassified 1548
148 Ga0105248_12696066 3300009177 Unclassified 567
149 Ga0105237_10224971 3300009545 Bacteria 1877
150 Ga0105249_11420346 3300009553 Bacteria 766
151 Ga0105239_10523756 3300010375 Bacteria 1349
152 Ga0105246_10422482 3300011119 Bacteria 1113
153 Ga0105246_10878851 3300011119 Bacteria 802
154 Ga0105246_11456231 3300011119 Unclassified 641
155 Ga0157373_10000258 3300013100 Bacteria 43100
156 Ga0157371_10064840 3300013102 Bacteria 2588
157 Ga0157369_10150674 3300013105 Bacteria 2458
158 Ga0157369_10497264 3300013105 Unclassified 1262
159 Ga0157372_10001173 3300013307 Bacteria 28325
160 Ga0157372_10086248 3300013307 Bacteria 3562
161 Ga0157375_10000303 3300013308 Bacteria 44672
162 Ga0157375_10426940 3300013308 Unclassified 1491
163 Ga0163163_10373909 3300014325 Bacteria 1482
164 Ga0163163_11291892 3300014325 Unclassified 792
165 Ga0157380_10312435 3300014326 Bacteria 1453
166 Ga0157380_10871501 3300014326 Bacteria 924
167 Ga0157380_12619026 3300014326 Unclassified 571
168 Ga0182007_10006387 3300015262 Bacteria 5059
169 Ga0206356_10570888 3300020070 Unclassified 815
170 Ga0206354_10301334 3300020081 Bacteria 697
171 Ga0206353_10264585 3300020082 Bacteria 2645
172 Ga0224712_10014469 3300022467 Bacteria 2542
173 Ga0207653_10008889 3300025885 Bacteria 3133
174 Ga0207688_10026175 3300025901 Bacteria 3205
175 Ga0207645_10000327 3300025907 Bacteria 39710
176 Ga0207643_10000279 3300025908 Bacteria 35431
177 Ga0207684_10024336 3300025910 Bacteria 5163
178 Ga0207684_10059109 3300025910 Bacteria 3254
179 Ga0207684_10139130 3300025910 Bacteria 2086
180 Ga0207654_10151276 3300025911 Bacteria 1490
181 Ga0207707_10000222 3300025912 Bacteria 61109
182 Ga0207695_10316844 3300025913 Bacteria 1449
183 Ga0207671_10124329 3300025914 Bacteria 1974
184 Ga0207660_10024381 3300025917 Bacteria 4096
185 Ga0207660_10443732 3300025917 Bacteria 1049
186 Ga0207660_11186105 3300025917 Unclassified 621
187 Ga0207662_10029924 3300025918 Bacteria 3157
188 Ga0207657_10005642 3300025919 Bacteria 13060
189 Ga0207649_10001335 3300025920 Bacteria 14670
190 Ga0207652_10017117 3300025921 Bacteria 5930
191 Ga0207652_10601690 3300025921 Bacteria 986
192 Ga0207646_10006306 3300025922 Bacteria 12296
193 Ga0207646_10008895 3300025922 Bacteria 10003
194 Ga0207646_10392264 3300025922 Unclassified 1254
195 Ga0207646_10449953 3300025922 Bacteria 1162
196 Ga0207681_10001446 3300025923 Bacteria 15275
197 Ga0207681_10034880 3300025923 Bacteria 3312
198 Ga0207650_10002749 3300025925 Bacteria 12134
199 Ga0207650_10010493 3300025925 Bacteria 6353
200 Ga0207659_11840225 3300025926 Bacteria 514
201 Ga0207690_10002299 3300025932 Bacteria 11648
202 Ga0207706_10003252 3300025933 Bacteria 15571
203 Ga0207709_10203722 3300025935 Bacteria 1415
204 Ga0207670_10057622 3300025936 Bacteria 2635
205 Ga0207670_10234830 3300025936 Bacteria 1410
206 Ga0207670_11707720 3300025936 Unclassified 535
207 Ga0207704_11389522 3300025938 Unclassified 601
208 Ga0207665_11067137 3300025939 Bacteria 643
209 Ga0207691_10010234 3300025940 Bacteria 8998
210 Ga0207691_10531378 3300025940 Unclassified 998
211 Ga0207711_10443781 3300025941 Bacteria 1208
212 Ga0207689_10002248 3300025942 Bacteria 18098
213 Ga0207661_11612571 3300025944 Bacteria 594
214 Ga0207679_10004014 3300025945 Bacteria 9139
215 Ga0207667_10002414 3300025949 Bacteria 23405
216 Ga0207651_10105408 3300025960 Bacteria 2103
217 Ga0207651_10341459 3300025960 Unclassified 1258
218 Ga0207677_11716389 3300026023 Bacteria 582
219 Ga0207639_10001809 3300026041 Bacteria 14377
220 Ga0207678_10129320 3300026067 Bacteria 2154
221 Ga0207702_10003374 3300026078 Bacteria 14634
222 Ga0207641_12373463 3300026088 Bacteria 529
223 Ga0207648_10000866 3300026089 Bacteria 34077
224 Ga0207676_12434055 3300026095 Unclassified 520
225 Ga0207674_10000734 3300026116 Bacteria 42840
226 Ga0207674_10011146 3300026116 Bacteria 10110
227 Ga0207674_10142337 3300026116 Unclassified 2358
228 Ga0207674_10238831 3300026116 Unclassified 1764
229 Ga0207674_10367117 3300026116 Bacteria 1391
230 Ga0207674_10387958 3300026116 Bacteria 1350
231 Ga0207675_100025128 3300026118 Bacteria 5543
232 Ga0207675_100216898 3300026118 Unclassified 1842
233 Ga0207675_101402713 3300026118 Unclassified 719
234 Ga0209983_1044582 3300027665 Bacteria 964
235 Ga0209983_1057730 3300027665 Unclassified 855
236 Ga0209971_1170127 3300027682 Bacteria 537
237 Ga0209998_10113585 3300027717 Bacteria 678
238 Ga0268265_10003128 3300028380 Bacteria 12063
239 Ga0268264_10006665 3300028381 Bacteria 9715
240 Ga0268264_10832016 3300028381 Bacteria 924
241 Ga0307515_10318712 3300028794 Bacteria 1223
242 Ga0307408_100066647 3300031548 Bacteria 2645
243 Ga0307408_100321113 3300031548 Bacteria 1304
244 Ga0307408_100738497 3300031548 Bacteria 888
245 Ga0307408_100978856 3300031548 Bacteria 778
246 Ga0307405_10444149 3300031731 Bacteria 1027
247 Ga0307405_11467380 3300031731 Unclassified 598
248 Ga0307413_10958476 3300031824 Bacteria 730
249 Ga0307410_10050076 3300031852 Bacteria 2807
250 Ga0307410_10088113 3300031852 Bacteria 2197
251 Ga0307410_11917059 3300031852 Bacteria 528
252 Ga0307406_10142695 3300031901 Bacteria 1698
253 Ga0307406_10555158 3300031901 Bacteria 940
254 Ga0307407_10169151 3300031903 Unclassified 1438
255 Ga0307412_11970449 3300031911 Unclassified 540
256 Ga0307409_100275053 3300031995 Bacteria 1553
257 Ga0307416_100148503 3300032002 Bacteria 2145
258 Ga0307416_100377914 3300032002 Bacteria 1446
259 Ga0307416_101248855 3300032002 Bacteria 849
260 Ga0307416_101650705 3300032002 Bacteria 746
261 Ga0307416_102303918 3300032002 Bacteria 639
262 Ga0307414_10058235 3300032004 Bacteria 2721
263 Ga0307414_11516609 3300032004 Bacteria 624
264 Ga0307411_10187756 3300032005 Bacteria 1575
265 Ga0307411_10346123 3300032005 Bacteria 1210
266 Ga0307415_100144371 3300032126 Bacteria 1822
267 Ga0373948_0023248 3300034817 Bacteria 1201
268 Ga0373940_0026692 3300035088 Bacteria 1513
269 Ga0373940_0035531 3300035088 Bacteria 1349
270 Ga0373949_0006204 3300035090 Bacteria 2640
271 Ga0373949_0126646 3300035090 Bacteria 721
272 Ga0373939_0442746 3300035114 Unclassified 545
273 Ga0373960_0282093 3300035121 Bacteria 612
274 Ga0373961_0005850 3300035241 Bacteria 2954
275 Ga0373962_0067978 3300035242 Bacteria 1059
276 Ga0373931_0092417 3300035691 Bacteria 1688
277 Ga0436364_0574615 3300037853 Unclassified 550
278 Ga0242420_005089 3300038996 Bacteria 2020
279 Ga0439437_008999 3300042000 Bacteria 1129
280 Ga0439448_0009554 3300042005 Bacteria 2861
281 Ga0439450_061306 3300042008 Bacteria 910
282 Ga0439455_0106580 3300042012 Bacteria 777
283 Ga0450914_027245 3300042118 Bacteria 671
284 Ga0450889_000694 3300042144 Bacteria 3667
285 Ga0439459_0001229 3300042438 Bacteria 3748
286 Ga0439459_0059160 3300042438 Bacteria 861
287 Ga0439464_0035680 3300042439 Bacteria 1405
288 Ga0451577_0008938 3300042876 Bacteria 9691
289 Ga0451577_0272497 3300042876 Bacteria 1533
290 Ga0439440_0059788 3300042993 Bacteria 971
291 Ga0453683_0656959 3300044673 Bacteria 686
292 Ga0453684_0093278 3300044712 Bacteria 3709
293 Ga0453684_2563420 3300044712 Bacteria 502
294 Ga0466960_0191638 3300044901 Bacteria 1113
295 Ga0451576_0019616 3300045051 Bacteria 7378
296 Ga0451576_0031728 3300045051 Bacteria 5631
297 Ga0451576_0056657 3300045051 Bacteria 4098
298 Ga0495580_0022931 3300046472 Bacteria 4589
299 Ga0496101_1325976 3300048904 Unclassified 562
300 Ga0496102_0155285 3300048905 Bacteria 2151
301 Ga0496103_0212612 3300048906 Bacteria 1244
302 Ga0496106_0716442 3300048909 Bacteria 797
303 Ga0496107_0199906 3300048910 Bacteria 1486
304 Ga0496108_0382307 3300048911 Bacteria 1229
305 Ga0496112_0553334 3300048915 Bacteria 1084
306 Ga0496113_0223188 3300048916 Bacteria 1502
307 Ga0501291_054040 3300049514 Unclassified 739
308 Ga0501033_0025285 3300049570 Bacteria 4473
309 Ga0501042_0063918 3300049578 Bacteria 2630
310 Ga0501042_0411679 3300049578 Bacteria 980
311 Ga0501048_0172201 3300049582 Bacteria 1534
312 Ga0501067_0330969 3300049583 Bacteria 848
313 Ga0501068_0410009 3300049584 Bacteria 874
314 Ga0501069_0173823 3300049585 Bacteria 1243
315 Ga0501069_0189736 3300049585 Bacteria 1189
316 Ga0501069_0372686 3300049585 Bacteria 843
317 Ga0501071_0389256 3300049587 Bacteria 1064
318 Ga0501072_0188793 3300049588 Bacteria 1644
319 Ga0501075_0035555 3300049591 Bacteria 3716
320 Ga0501075_0378441 3300049591 Bacteria 1079
321 Ga0501076_0609210 3300049592 Bacteria 901
322 Ga0501076_1103828 3300049592 Bacteria 653
323 Ga0501079_0008672 3300049741 Bacteria 7711
324 Ga0501079_1228389 3300049741 Bacteria 590
325 Ga0501081_0235190 3300049743 Bacteria 1335
326 Ga0501081_0468581 3300049743 Unclassified 937
327 Ga0501273_037779 3300049770 Bacteria 706
328 Ga0501045_0057762 3300049824 Bacteria 2840
329 nmdc:mga05p37_128985_c1 3300050507 Unclassified 3105
330 nmdc:mga05p37_134812_c1 3300050507 Bacteria 3029
331 nmdc:mga05p37_16714_c1 3300050507 Bacteria 8843
332 nmdc:mga05p37_210872_c1 3300050507 Bacteria 2348
333 nmdc:mga05p37_649111_c1 3300050507 Bacteria 1182
334 nmdc:mga05p37_657103_c1 3300050507 Bacteria 1173
335 nmdc:mga09592_104537_c1 3300050508 Bacteria 2427
336 nmdc:mga09592_2314_c1 3300050508 Bacteria 15363
337 nmdc:mga0qj67_145579_c1 3300050509 Bacteria 1921
338 nmdc:mga0qj67_207800_c1 3300050509 Bacteria 1590
339 nmdc:mga0qj67_669073_c1 3300050509 Bacteria 827
340 nmdc:mga06r32_1278628_c1 3300050510 Unclassified 678
341 nmdc:mga06r32_15572_c1 3300050510 Bacteria 6908
342 nmdc:mga06r32_188423_c1 3300050510 Bacteria 2050
343 nmdc:mga06r32_477552_c1 3300050510 Bacteria 1225
344 nmdc:mga0n895_170428_c1 3300050512 Bacteria 1558
345 nmdc:mga0n895_253950_c1 3300050512 Bacteria 1784
346 nmdc:mga0n895_6183_c1 3300050512 Bacteria 10123
347 nmdc:mga0n895_661651_c1 3300050512 Bacteria 1042
348 nmdc:mga0rr50_132704_c1 3300050513 Bacteria 1996
349 nmdc:mga0rr50_236215_c1 3300050513 Bacteria 1514
350 nmdc:mga0rr50_34788_c1 3300050513 Unclassified 3611
351 nmdc:mga08x19_188797_c1 3300050514 Bacteria 1409
352 nmdc:mga0a205_129606_c1 3300050515 Bacteria 2423
353 nmdc:mga0a205_1303_c1 3300050515 Bacteria 20950
354 nmdc:mga0a205_285166_c1 3300050515 Bacteria 1526
355 nmdc:mga0a205_532973_c1 3300050515 Unclassified 1030
356 nmdc:mga0a205_60387_c1 3300050515 Bacteria 3662
357 Ga0501082_0531042 3300060353 Bacteria 1029
358 Ga0501082_0602965 3300060353 Bacteria 961
359 Ga0530510_0003597 3300061734 Bacteria 10671
360 Ga0530510_0400487 3300061734 Bacteria 1034
361 Ga0530510_0475179 3300061734 Bacteria 946
362 Ga0530510_0842511 3300061734 Unclassified 700
363 Ga0495621_0005860
364 SwRhRL2b_contig_2973307
365 Ga0065715_10146054
366 Ga0065707_10004493
367 Ga0070676_10001600
368 Ga0070670_100002405
369 Ga0070670_100152626
370 Ga0070670_101359882
371 Ga0070680_100102371
372 Ga0070680_100163855
373 Ga0070682_100000140
374 Ga0068868_100211615
375 Ga0070660_100001436
376 Ga0070689_100088369
377 Ga0070689_100126333
378 Ga0070691_10000716
379 Ga0070687_100420192
380 Ga0070687_101364530
381 Ga0070661_100004561
382 Ga0070669_100000650
383 Ga0070669_100020448
384 Ga0070669_101713654
385 Ga0070673_100528137
386 Ga0070673_101643515
387 Ga0070688_100249135
388 Ga0070703_10002792
389 Ga0070703_10070162
390 Ga0070701_10029638
391 Ga0070701_10035179
392 Ga0070705_100001536
393 Ga0070705_100339656
394 Ga0070705_100907522
395 Ga0070694_100002628
396 Ga0070694_101375229
397 Ga0070708_100080766
398 Ga0070708_100464096
399 Ga0070708_100563278
400 Ga0070708_101827036
401 Ga0070662_100006397
402 Ga0070662_100275579
403 Ga0070681_10003714
404 Ga0070681_10449236
405 Ga0068867_100003088
406 Ga0070706_100036694
407 Ga0070707_100005316
408 Ga0070707_100019490
409 Ga0070707_101129848
410 Ga0070698_100039316
411 Ga0070698_100138649
412 Ga0070699_100008507
413 Ga0070699_101051964
414 Ga0070699_101327498
415 Ga0070699_101949328
416 Ga0070679_100001975
417 Ga0070679_100426475
418 Ga0070684_100042221
419 Ga0070697_100000095
420 Ga0070697_100089731
421 Ga0070697_100541300
422 Ga0068853_100033686
423 Ga0070686_100008295
424 Ga0070695_100001850
425 Ga0070695_101141840
426 Ga0070695_101180049
427 Ga0070696_100018221
428 Ga0070696_100022153
429 Ga0070696_100248173
430 Ga0070696_100341776
431 Ga0070696_101204189
432 Ga0070693_100000392
433 Ga0070665_102390366
434 Ga0070704_100000654
435 Ga0070704_100169678
436 Ga0068855_100008374
437 Ga0068857_100008160
438 Ga0068857_100205520
439 Ga0068857_100343308
440 Ga0068857_100348548
441 Ga0068857_100565021
442 Ga0068856_100000361
443 Ga0070702_100001687
444 Ga0070702_100552379
445 Ga0068859_100005682
446 Ga0068859_101491599
447 Ga0068864_100006049
448 Ga0068861_100071275
449 Ga0068851_10206166
450 Ga0068870_10000988
451 Ga0068863_100062109
452 Ga0068860_100006174
453 Ga0068860_100986418
454 Ga0068862_100024050
455 Ga0068862_101104648
456 Ga0081455_10059114
457 Ga0081455_10210522
458 Ga0070716_101210369
459 Ga0068871_100667547
460 Ga0075428_100111464
461 Ga0075428_100993018
462 Ga0075430_100057674
463 Ga0075430_100128788
464 Ga0075430_100255316
465 Ga0075430_101670581
466 Ga0075431_100019658
467 Ga0075431_100239836
468 Ga0075431_100415953
469 Ga0075431_100477458
470 Ga0075431_100519765
471 Ga0075431_100699995
472 Ga0075431_100850468
473 Ga0075433_10002293
474 Ga0075433_10006598
475 Ga0075433_10080120
476 Ga0075433_10837956
477 Ga0075434_100005361
478 Ga0075434_100178803
479 Ga0075434_100380694
480 Ga0075434_100898071
481 Ga0075429_100003951
482 Ga0075429_100185092
483 Ga0075429_101195942
484 Ga0075436_100322646
485 Ga0097620_100005682
486 Ga0097620_101492120
487 Ga0075435_100013584
488 Ga0075435_100197437
489 Ga0075435_100200348
490 Ga0099794_10005763
491 Ga0105240_10520962
492 Ga0105240_11685131
493 Ga0105245_12781504
494 Ga0114129_10006928
495 Ga0114129_10009143
496 Ga0114129_10042884
497 Ga0114129_10172094
498 Ga0114129_10246357
499 Ga0114129_10258558
500 Ga0114129_10879248
501 Ga0105243_10034636
502 Ga0105243_10129284
503 Ga0105243_11870178
504 Ga0105243_12010832
505 Ga0105243_12432218
506 Ga0105241_10001177
507 Ga0105241_11687662
508 Ga0105242_12438682
509 Ga0105248_10399398
510 Ga0105248_12696066
511 Ga0105237_10224971
512 Ga0105249_11420346
513 Ga0105239_10523756
514 Ga0105246_10422482
515 Ga0105246_10878851
516 Ga0105246_11456231
517 Ga0157373_10000258
518 Ga0157371_10064840
519 Ga0157369_10150674
520 Ga0157369_10497264
521 Ga0157372_10001173
522 Ga0157372_10086248
523 Ga0157375_10000303
524 Ga0157375_10426940
525 Ga0163163_10373909
526 Ga0163163_11291892
527 Ga0157380_10312435
528 Ga0157380_10871501
529 Ga0157380_12619026
530 Ga0182007_10006387
531 Ga0206356_10570888
532 Ga0206354_10301334
533 Ga0206353_10264585
534 Ga0224712_10014469
535 Ga0207653_10008889
536 Ga0207688_10026175
537 Ga0207645_10000327
538 Ga0207643_10000279
539 Ga0207684_10024336
540 Ga0207684_10059109
541 Ga0207684_10139130
542 Ga0207654_10151276
543 Ga0207707_10000222
544 Ga0207695_10316844
545 Ga0207671_10124329
546 Ga0207660_10024381
547 Ga0207660_10443732
548 Ga0207660_11186105
549 Ga0207662_10029924
550 Ga0207657_10005642
551 Ga0207649_10001335
552 Ga0207652_10017117
553 Ga0207652_10601690
554 Ga0207646_10006306
555 Ga0207646_10008895
556 Ga0207646_10392264
557 Ga0207646_10449953
558 Ga0207681_10001446
559 Ga0207681_10034880
560 Ga0207650_10002749
561 Ga0207650_10010493
562 Ga0207659_11840225
563 Ga0207690_10002299
564 Ga0207706_10003252
565 Ga0207709_10203722
566 Ga0207670_10057622
567 Ga0207670_10234830
568 Ga0207670_11707720
569 Ga0207704_11389522
570 Ga0207665_11067137
571 Ga0207691_10010234
572 Ga0207691_10531378
573 Ga0207711_10443781
574 Ga0207689_10002248
575 Ga0207661_11612571
576 Ga0207679_10004014
577 Ga0207667_10002414
578 Ga0207651_10105408
579 Ga0207651_10341459
580 Ga0207677_11716389
581 Ga0207639_10001809
582 Ga0207678_10129320
583 Ga0207702_10003374
584 Ga0207641_12373463
585 Ga0207648_10000866
586 Ga0207676_12434055
587 Ga0207674_10000734
588 Ga0207674_10011146
589 Ga0207674_10142337
590 Ga0207674_10238831
591 Ga0207674_10367117
592 Ga0207674_10387958
593 Ga0207675_100025128
594 Ga0207675_100216898
595 Ga0207675_101402713
596 Ga0209983_1044582
597 Ga0209983_1057730
598 Ga0209971_1170127
599 Ga0209998_10113585
600 Ga0268265_10003128
601 Ga0268264_10006665
602 Ga0268264_10832016
603 Ga0307515_10318712
604 Ga0307408_100066647
605 Ga0307408_100321113
606 Ga0307408_100738497
607 Ga0307408_100978856
608 Ga0307405_10444149
609 Ga0307405_11467380
610 Ga0307413_10958476
611 Ga0307410_10050076
612 Ga0307410_10088113
613 Ga0307410_11917059
614 Ga0307406_10142695
615 Ga0307406_10555158
616 Ga0307407_10169151
617 Ga0307412_11970449
618 Ga0307409_100275053
619 Ga0307416_100148503
620 Ga0307416_100377914
621 Ga0307416_101248855
622 Ga0307416_101650705
623 Ga0307416_102303918
624 Ga0307414_10058235
625 Ga0307414_11516609
626 Ga0307411_10187756
627 Ga0307411_10346123
628 Ga0307415_100144371
629 Ga0373948_0023248
630 Ga0373940_0026692
631 Ga0373940_0035531
632 Ga0373949_0006204
633 Ga0373949_0126646
634 Ga0373939_0442746
635 Ga0373960_0282093
636 Ga0373961_0005850
637 Ga0373962_0067978
638 Ga0373931_0092417
639 Ga0436364_0574615
640 Ga0242420_005089
641 Ga0439437_008999
642 Ga0439448_0009554
643 Ga0439450_061306
644 Ga0439455_0106580
645 Ga0450914_027245
646 Ga0450889_000694
647 Ga0439459_0001229
648 Ga0439459_0059160
649 Ga0439464_0035680
650 Ga0451577_0008938
651 Ga0451577_0272497
652 Ga0439440_0059788
653 Ga0453683_0656959
654 Ga0453684_0093278
655 Ga0453684_2563420
656 Ga0466960_0191638
657 Ga0451576_0019616
658 Ga0451576_0031728
659 Ga0451576_0056657
660 Ga0495580_0022931
661 Ga0496101_1325976
662 Ga0496102_0155285
663 Ga0496103_0212612
664 Ga0496106_0716442
665 Ga0496107_0199906
666 Ga0496108_0382307
667 Ga0496112_0553334
668 Ga0496113_0223188
669 Ga0501291_054040
670 Ga0501033_0025285
671 Ga0501042_0063918
672 Ga0501042_0411679
673 Ga0501048_0172201
674 Ga0501067_0330969
675 Ga0501068_0410009
676 Ga0501069_0173823
677 Ga0501069_0189736
678 Ga0501069_0372686
679 Ga0501071_0389256
680 Ga0501072_0188793
681 Ga0501075_0035555
682 Ga0501075_0378441
683 Ga0501076_0609210
684 Ga0501076_1103828
685 Ga0501079_0008672
686 Ga0501079_1228389
687 Ga0501081_0235190
688 Ga0501081_0468581
689 Ga0501273_037779
690 Ga0501045_0057762
691 nmdc:mga05p37_128985_c1
692 nmdc:mga05p37_134812_c1
693 nmdc:mga05p37_16714_c1
694 nmdc:mga05p37_210872_c1
695 nmdc:mga05p37_649111_c1
696 nmdc:mga05p37_657103_c1
697 nmdc:mga09592_104537_c1
698 nmdc:mga09592_2314_c1
699 nmdc:mga0qj67_145579_c1
700 nmdc:mga0qj67_207800_c1
701 nmdc:mga0qj67_669073_c1
702 nmdc:mga06r32_1278628_c1
703 nmdc:mga06r32_15572_c1
704 nmdc:mga06r32_188423_c1
705 nmdc:mga06r32_477552_c1
706 nmdc:mga0n895_170428_c1
707 nmdc:mga0n895_253950_c1
708 nmdc:mga0n895_6183_c1
709 nmdc:mga0n895_661651_c1
710 nmdc:mga0rr50_132704_c1
711 nmdc:mga0rr50_236215_c1
712 nmdc:mga0rr50_34788_c1
713 nmdc:mga08x19_188797_c1
714 nmdc:mga0a205_129606_c1
715 nmdc:mga0a205_1303_c1
716 nmdc:mga0a205_285166_c1
717 nmdc:mga0a205_532973_c1
718 nmdc:mga0a205_60387_c1
719 Ga0501082_0531042
720 Ga0501082_0602965
721 Ga0530510_0003597
722 Ga0530510_0400487
723 Ga0530510_0475179
724 Ga0530510_0842511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map