F422725

General Info

Members Datasets Scaffolds Average Seq Length
362 246 724 129

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0410177|Ga0495583_0410177_124_507
Length 127
Sequence MKRTWTIIGVADVPRSFKWYQSLLGLPETAPAHDYFGQIMDSDGTVLLCLHKWGAHEHPSLTSPSHAEPGNGLLLFFRVDDFDLPRARALVSRLEEEPHVNPSTGTAEFSLRDTDGYYVTISALDAA

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
245 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
246 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0.55
Rhizoplane 3.04
Rhizosphere 89.78
Stem 0
Stem Tuber 0
Unclassified 13.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0410177 3300046506 Bacteria 532
2 rootH1_10063421 3300003323 Bacteria 1013
3 JGI25405J52794_10010173 3300003911 Bacteria 1786
4 Ga0065707_10103073 3300005295 Unclassified 2769
5 Ga0070658_10014174 3300005327 Bacteria 6398
6 Ga0070683_100119742 3300005329 Bacteria 2486
7 Ga0070683_100866494 3300005329 Bacteria 866
8 Ga0070670_100000351 3300005331 Bacteria 38642
9 Ga0068869_100595186 3300005334 Unclassified 933
10 Ga0070680_100570997 3300005336 Bacteria 970
11 Ga0068868_101160493 3300005338 Unclassified 713
12 Ga0070660_100082548 3300005339 Bacteria 2524
13 Ga0070689_100006397 3300005340 Bacteria 8148
14 Ga0070689_100498530 3300005340 Bacteria 1043
15 Ga0070692_10142395 3300005345 Unclassified 1358
16 Ga0070668_100233369 3300005347 Bacteria 1522
17 Ga0070668_100915026 3300005347 Bacteria 785
18 Ga0070675_100003020 3300005354 Bacteria 12700
19 Ga0070675_100023566 3300005354 Bacteria 4924
20 Ga0070674_100295225 3300005356 Unclassified 1290
21 Ga0070674_100657457 3300005356 Bacteria 891
22 Ga0070673_101184333 3300005364 Unclassified 715
23 Ga0070667_100848625 3300005367 Bacteria 849
24 Ga0070714_100243690 3300005435 Bacteria 1660
25 Ga0070713_100046127 3300005436 Bacteria 3574
26 Ga0070713_100241092 3300005436 Bacteria 1646
27 Ga0070713_101481348 3300005436 Bacteria 658
28 Ga0070710_10240087 3300005437 Bacteria 1160
29 Ga0070711_100062506 3300005439 Bacteria 2595
30 Ga0070705_100900226 3300005440 Bacteria 711
31 Ga0070700_100394401 3300005441 Bacteria 1039
32 Ga0070700_100477072 3300005441 Bacteria 955
33 Ga0070700_100502549 3300005441 Unclassified 933
34 Ga0070694_100185935 3300005444 Bacteria 1539
35 Ga0070708_100028944 3300005445 Bacteria 4772
36 Ga0070708_101349592 3300005445 Bacteria 666
37 Ga0070678_100207540 3300005456 Bacteria 1621
38 Ga0070678_100635826 3300005456 Unclassified 956
39 Ga0070681_10388742 3300005458 Bacteria 1306
40 Ga0070706_100106254 3300005467 Bacteria 2612
41 Ga0070706_100225946 3300005467 Bacteria 1747
42 Ga0070707_100205724 3300005468 Bacteria 1918
43 Ga0070707_100760840 3300005468 Unclassified 932
44 Ga0070698_100187946 3300005471 Bacteria 2003
45 Ga0070698_100239554 3300005471 Bacteria 1747
46 Ga0070698_100333264 3300005471 Bacteria 1449
47 Ga0070699_100029276 3300005518 Bacteria 4748
48 Ga0070699_100094881 3300005518 Bacteria 2611
49 Ga0070679_100152327 3300005530 Bacteria 2289
50 Ga0070684_100003484 3300005535 Bacteria 11815
51 Ga0070684_100011354 3300005535 Bacteria 7093
52 Ga0070684_100210080 3300005535 Bacteria 1774
53 Ga0070684_100262225 3300005535 Bacteria 1581
54 Ga0070697_100021114 3300005536 Bacteria 5157
55 Ga0070697_100053943 3300005536 Bacteria 3267
56 Ga0070672_100477107 3300005543 Bacteria 1077
57 Ga0070672_100819713 3300005543 Unclassified 819
58 Ga0070695_100181363 3300005545 Bacteria 1492
59 Ga0070693_100076238 3300005547 Unclassified 1987
60 Ga0070665_100266009 3300005548 Bacteria 1716
61 Ga0068855_100047493 3300005563 Bacteria 5072
62 Ga0068855_100061537 3300005563 Bacteria 4386
63 Ga0068854_100003831 3300005578 Bacteria 9421
64 Ga0068854_100108865 3300005578 Bacteria 2087
65 Ga0068854_101990466 3300005578 Bacteria 535
66 Ga0068859_100887164 3300005617 Unclassified 977
67 Ga0068864_101143028 3300005618 Unclassified 776
68 Ga0068861_100016778 3300005719 Bacteria 5188
69 Ga0068863_100800017 3300005841 Unclassified 940
70 Ga0068863_100929899 3300005841 Unclassified 871
71 Ga0068858_100036682 3300005842 Bacteria 4545
72 Ga0068862_100033168 3300005844 Bacteria 4362
73 Ga0068862_101517263 3300005844 Bacteria 676
74 Ga0081455_10005056 3300005937 Bacteria 14568
75 Ga0081455_10014416 3300005937 Bacteria 7752
76 Ga0081455_10030577 3300005937 Bacteria 4890
77 Ga0081455_10037457 3300005937 Bacteria 4307
78 Ga0081455_10122909 3300005937 Bacteria 2042
79 Ga0081455_10746349 3300005937 Bacteria 619
80 Ga0081455_10768447 3300005937 Bacteria 607
81 Ga0081538_10132001 3300005981 Bacteria 1172
82 Ga0081538_10225855 3300005981 Bacteria 737
83 Ga0081540_1011602 3300005983 Bacteria 5882
84 Ga0081540_1044357 3300005983 Bacteria 2270
85 Ga0070717_10018908 3300006028 Bacteria 5391
86 Ga0070717_10200600 3300006028 Bacteria 1747
87 Ga0075365_10038173 3300006038 Bacteria 3120
88 Ga0075365_10400469 3300006038 Bacteria 969
89 Ga0070716_100057173 3300006173 Bacteria 2241
90 Ga0070716_100142985 3300006173 Bacteria 1528
91 Ga0070716_100224764 3300006173 Bacteria 1263
92 Ga0070712_100311436 3300006175 Bacteria 1277
93 Ga0070712_100572746 3300006175 Bacteria 953
94 Ga0075362_10047286 3300006177 Bacteria 1916
95 Ga0075362_10071974 3300006177 Bacteria 1581
96 Ga0075367_10124672 3300006178 Bacteria 1589
97 Ga0075367_10895457 3300006178 Bacteria 566
98 Ga0075369_10156177 3300006186 Bacteria 1044
99 Ga0075369_10482693 3300006186 Bacteria 588
100 Ga0075366_10044573 3300006195 Bacteria 2629
101 Ga0075370_10513142 3300006353 Unclassified 724
102 Ga0068871_100554426 3300006358 Unclassified 1041
103 Ga0075428_100187130 3300006844 Bacteria 2240
104 Ga0075428_100878176 3300006844 Bacteria 952
105 Ga0075430_100377121 3300006846 Bacteria 1171
106 Ga0075430_100492388 3300006846 Bacteria 1012
107 Ga0075431_100239410 3300006847 Bacteria 1847
108 Ga0075433_10081800 3300006852 Bacteria 2848
109 Ga0075433_10114817 3300006852 Bacteria 2389
110 Ga0075433_10972562 3300006852 Bacteria 740
111 Ga0075434_100265524 3300006871 Bacteria 1735
112 Ga0075429_100927954 3300006880 Bacteria 762
113 Ga0075436_100644987 3300006914 Unclassified 782
114 Ga0097620_100887200 3300006931 Unclassified 977
115 Ga0075435_100267538 3300007076 Bacteria 1457
116 Ga0099794_10038865 3300007265 Bacteria 2256
117 Ga0099794_10098365 3300007265 Bacteria 1459
118 Ga0099795_10571175 3300007788 Bacteria 535
119 Ga0105240_11315397 3300009093 Bacteria 762
120 Ga0111539_10088173 3300009094 Bacteria 3645
121 Ga0105247_10725840 3300009101 Bacteria 750
122 Ga0114129_10258006 3300009147 Bacteria 2338
123 Ga0114129_10400981 3300009147 Unclassified 1808
124 Ga0114129_11849315 3300009147 Bacteria 733
125 Ga0105243_10662720 3300009148 Bacteria 1013
126 Ga0105242_10691799 3300009176 Bacteria 996
127 Ga0105242_13109656 3300009176 Unclassified 514
128 Ga0105248_10157101 3300009177 Bacteria 2566
129 Ga0105248_10620070 3300009177 Unclassified 1220
130 Ga0105238_10234217 3300009551 Bacteria 1813
131 Ga0105238_10979268 3300009551 Bacteria 866
132 Ga0105249_10146521 3300009553 Bacteria 2269
133 Ga0099796_10410450 3300010159 Unclassified 595
134 Ga0105239_10536154 3300010375 Bacteria 1332
135 Ga0105239_11270837 3300010375 Bacteria 849
136 Ga0105239_11431055 3300010375 Bacteria 798
137 Ga0105246_10429979 3300011119 Bacteria 1104
138 Ga0105246_10457118 3300011119 Bacteria 1074
139 Ga0105246_10568920 3300011119 Unclassified 974
140 Ga0105246_11696560 3300011119 Bacteria 600
141 Ga0157370_10024450 3300013104 Bacteria 5983
142 Ga0157369_10133350 3300013105 Bacteria 2631
143 Ga0157369_11062364 3300013105 Bacteria 828
144 Ga0157374_10990104 3300013296 Bacteria 860
145 Ga0157378_10365217 3300013297 Bacteria 1414
146 Ga0157378_11592775 3300013297 Unclassified 699
147 Ga0163162_10775593 3300013306 Bacteria 1077
148 Ga0163162_11289707 3300013306 Bacteria 830
149 Ga0157372_10037981 3300013307 Bacteria 5314
150 Ga0157375_10355045 3300013308 Bacteria 1632
151 Ga0157375_12932139 3300013308 Unclassified 570
152 Ga0163163_10150483 3300014325 Bacteria 2371
153 Ga0163163_10235051 3300014325 Bacteria 1882
154 Ga0163163_11546767 3300014325 Unclassified 724
155 Ga0157380_10841307 3300014326 Unclassified 938
156 Ga0157377_10191309 3300014745 Unclassified 1293
157 Ga0157379_10706985 3300014968 Bacteria 946
158 Ga0209758_1050400 3300025297 Unclassified 1460
159 Ga0207682_10200176 3300025893 Bacteria 918
160 Ga0207692_10047028 3300025898 Bacteria 2165
161 Ga0207692_10338933 3300025898 Bacteria 924
162 Ga0207642_10149833 3300025899 Bacteria 1240
163 Ga0207688_10217579 3300025901 Bacteria 1150
164 Ga0207680_10444843 3300025903 Bacteria 919
165 Ga0207685_10084849 3300025905 Bacteria 1320
166 Ga0207705_10004447 3300025909 Bacteria 10594
167 Ga0207684_10029902 3300025910 Bacteria 4637
168 Ga0207684_10060650 3300025910 Bacteria 3213
169 Ga0207707_10063708 3300025912 Bacteria 3209
170 Ga0207707_10190397 3300025912 Bacteria 1790
171 Ga0207695_10249705 3300025913 Bacteria 1674
172 Ga0207695_10455859 3300025913 Bacteria 1162
173 Ga0207693_10160543 3300025915 Bacteria 1768
174 Ga0207663_10028297 3300025916 Bacteria 3279
175 Ga0207660_10514464 3300025917 Bacteria 972
176 Ga0207662_10830019 3300025918 Unclassified 652
177 Ga0207657_10243843 3300025919 Bacteria 1434
178 Ga0207652_10007243 3300025921 Bacteria 8937
179 Ga0207652_10082628 3300025921 Bacteria 2811
180 Ga0207681_10491642 3300025923 Bacteria 1003
181 Ga0207694_10182114 3300025924 Bacteria 1704
182 Ga0207650_10000071 3300025925 Bacteria 137924
183 Ga0207650_10179876 3300025925 Bacteria 1685
184 Ga0207650_10474628 3300025925 Bacteria 1043
185 Ga0207650_11113662 3300025925 Bacteria 672
186 Ga0207659_10000616 3300025926 Bacteria 21223
187 Ga0207659_10177499 3300025926 Unclassified 1685
188 Ga0207700_10013365 3300025928 Bacteria 5338
189 Ga0207700_10036708 3300025928 Bacteria 3542
190 Ga0207700_10320505 3300025928 Bacteria 1343
191 Ga0207664_11743655 3300025929 Bacteria 545
192 Ga0207670_10318525 3300025936 Bacteria 1223
193 Ga0207670_11193267 3300025936 Bacteria 644
194 Ga0207669_10258023 3300025937 Unclassified 1302
195 Ga0207669_10483554 3300025937 Bacteria 987
196 Ga0207665_10013746 3300025939 Bacteria 5323
197 Ga0207665_11287931 3300025939 Bacteria 583
198 Ga0207691_10493806 3300025940 Bacteria 1040
199 Ga0207711_10546760 3300025941 Bacteria 1080
200 Ga0207711_11409535 3300025941 Unclassified 639
201 Ga0207689_10008604 3300025942 Bacteria 8887
202 Ga0207689_10063321 3300025942 Bacteria 3042
203 Ga0207689_10596863 3300025942 Unclassified 929
204 Ga0207661_10000009 3300025944 Bacteria 421876
205 Ga0207661_10000769 3300025944 Bacteria 20820
206 Ga0207661_10565758 3300025944 Bacteria 1042
207 Ga0207661_11904574 3300025944 Bacteria 540
208 Ga0207667_10154270 3300025949 Bacteria 2363
209 Ga0207667_10857375 3300025949 Bacteria 902
210 Ga0207667_11605250 3300025949 Bacteria 619
211 Ga0207712_10793788 3300025961 Bacteria 832
212 Ga0207640_10001392 3300025981 Bacteria 13060
213 Ga0207677_11935440 3300026023 Bacteria 548
214 Ga0207708_10503372 3300026075 Bacteria 1015
215 Ga0207641_10731591 3300026088 Unclassified 976
216 Ga0207676_11689567 3300026095 Bacteria 631
217 Ga0207698_10011379 3300026142 Bacteria 5767
218 Ga0209179_1097486 3300027512 Bacteria 654
219 Ga0209588_1013827 3300027671 Bacteria 2466
220 Ga0209588_1118914 3300027671 Bacteria 846
221 Ga0207428_10041605 3300027907 Bacteria 3718
222 Ga0268266_10116219 3300028379 Bacteria 2376
223 Ga0268266_11702988 3300028379 Bacteria 606
224 Ga0268265_10042716 3300028380 Bacteria 3365
225 Ga0268265_11505507 3300028380 Bacteria 676
226 Ga0307515_10527125 3300028794 Bacteria 791
227 Ga0373944_0015587 3300035089 Bacteria 2135
228 Ga0373936_0450103 3300035113 Bacteria 595
229 Ga0373945_0233588 3300035116 Bacteria 772
230 Ga0373945_0363208 3300035116 Bacteria 629
231 Ga0373946_0094451 3300035171 Bacteria 1330
232 Ga0373946_0123605 3300035171 Bacteria 1184
233 Ga0373955_0111071 3300035172 Unclassified 1585
234 Ga0373962_0331722 3300035242 Bacteria 546
235 Ga0373931_0678345 3300035691 Unclassified 679
236 Ga0373935_1101317 3300035692 Bacteria 591
237 Ga0373927_0081322 3300035695 Bacteria 2099
238 Ga0373927_0462314 3300035695 Bacteria 838
239 Ga0373933_0330499 3300035724 Bacteria 989
240 Ga0373947_0179283 3300035725 Bacteria 1378
241 Ga0373947_1024424 3300035725 Bacteria 563
242 Ga0373925_0117527 3300037068 Bacteria 2061
243 Ga0395900_0564516 3300037418 Bacteria 1081
244 Ga0395905_0645223 3300037471 Bacteria 961
245 Ga0395905_0709460 3300037471 Unclassified 908
246 Ga0395901_1798707 3300038443 Bacteria 562
247 Ga0436360_1309847 3300039438 Bacteria 1049
248 Ga0451789_0793251 3300041443 Bacteria 567
249 Ga0451807_1343459 3300041486 Bacteria 632
250 Ga0466965_0334428 3300044683 Bacteria 827
251 Ga0466961_0138437 3300044693 Bacteria 1525
252 Ga0466971_0056902 3300044719 Bacteria 1764
253 Ga0466959_0050346 3300045049 Bacteria 3058
254 Ga0466958_0191368 3300045836 Bacteria 1300
255 Ga0495603_0066828 3300046455 Bacteria 2117
256 Ga0495590_0048148 3300046457 Bacteria 1487
257 Ga0495591_091739 3300046458 Bacteria 762
258 Ga0495638_0081273 3300046460 Bacteria 1968
259 Ga0495580_0682895 3300046472 Bacteria 673
260 Ga0495580_0883911 3300046472 Bacteria 575
261 Ga0495582_0020152 3300046473 Bacteria 3649
262 Ga0495582_0271653 3300046473 Bacteria 973
263 Ga0495605_0165704 3300046474 Bacteria 979
264 Ga0495639_0022718 3300046475 Bacteria 2753
265 Ga0495585_0016246 3300046492 Bacteria 4312
266 Ga0495585_0283766 3300046492 Bacteria 818
267 Ga0495585_0291129 3300046492 Bacteria 805
268 Ga0495594_0053383 3300046499 Bacteria 2226
269 Ga0495594_0228839 3300046499 Bacteria 1060
270 Ga0495596_0192232 3300046500 Bacteria 793
271 Ga0495607_0025979 3300046501 Bacteria 3637
272 Ga0495583_0130296 3300046506 Bacteria 1053
273 Ga0495618_0049032 3300046514 Bacteria 2667
274 Ga0495620_0390769 3300046515 Bacteria 527
275 Ga0495628_0123661 3300046516 Bacteria 1983
276 Ga0495630_0653240 3300046517 Bacteria 805
277 Ga0495637_0202571 3300046520 Unclassified 729
278 Ga0495643_0259729 3300046522 Bacteria 807
279 Ga0495644_0008961 3300046523 Bacteria 3848
280 Ga0495663_0348127 3300046525 Bacteria 539
281 Ga0495666_0233110 3300046526 Bacteria 841
282 Ga0495642_0492119 3300046528 Bacteria 543
283 Ga0495665_0123073 3300046531 Bacteria 1358
284 Ga0495598_0095760 3300046537 Bacteria 975
285 Ga0495622_0326680 3300046557 Bacteria 666
286 Ga0495633_0043448 3300046558 Bacteria 2132
287 Ga0495656_0024141 3300046615 Bacteria 2398
288 Ga0495668_0321963 3300046616 Bacteria 848
289 Ga0495668_0505679 3300046616 Bacteria 666
290 Ga0495634_0115537 3300046642 Bacteria 1722
291 Ga0495611_0054819 3300046648 Bacteria 1803
292 Ga0495625_0585060 3300046660 Bacteria 672
293 Ga0495659_0010992 3300046664 Bacteria 2916
294 Ga0495588_0306279 3300046674 Bacteria 836
295 Ga0495588_0389393 3300046674 Bacteria 732
296 Ga0495647_0107543 3300046681 Bacteria 1161
297 Ga0495647_0170952 3300046681 Bacteria 941
298 Ga0495624_0621813 3300046690 Bacteria 643
299 Ga0495670_0019013 3300046691 Bacteria 3385
300 Ga0495671_0054276 3300046692 Bacteria 1987
301 Ga0495671_0275645 3300046692 Bacteria 811
302 Ga0495649_0207848 3300046694 Bacteria 1015
303 Ga0495581_0419992 3300047315 Bacteria 780
304 Ga0495683_0289989 3300047323 Bacteria 706
305 Ga0495679_120351 3300047446 Bacteria 718
306 Ga0495681_0104410 3300047470 Bacteria 1235
307 Ga0495593_0216308 3300047673 Bacteria 962
308 Ga0495626_0069891 3300048091 Bacteria 1581
309 Ga0496102_0292549 3300048905 Bacteria 1535
310 Ga0496102_0301290 3300048905 Bacteria 1511
311 Ga0496103_0329605 3300048906 Bacteria 982
312 Ga0496108_1397529 3300048911 Bacteria 586
313 Ga0496110_0189980 3300048913 Bacteria 1865
314 Ga0496110_0332808 3300048913 Bacteria 1383
315 Ga0496111_1316679 3300048914 Bacteria 508
316 Ga0496113_0752688 3300048916 Unclassified 776
317 Ga0496114_0154351 3300048917 Bacteria 1993
318 Ga0496126_0134244 3300048929 Bacteria 2136
319 Ga0496126_1190117 3300048929 Unclassified 561
320 Ga0501032_0521004 3300049569 Bacteria 759
321 Ga0501038_0155379 3300049574 Bacteria 1863
322 Ga0501047_0009432 3300049581 Bacteria 9220
323 Ga0501067_0003604 3300049583 Bacteria 8528
324 Ga0501070_0009862 3300049586 Bacteria 8075
325 Ga0501073_0004433 3300049589 Bacteria 10545
326 Ga0501073_0014849 3300049589 Bacteria 5652
327 Ga0501074_0014146 3300049590 Bacteria 5802
328 Ga0501074_0214045 3300049590 Bacteria 1372
329 Ga0501076_0585822 3300049592 Unclassified 920
330 Ga0501077_0015074 3300049593 Unclassified 4860
331 Ga0501079_0226026 3300049741 Unclassified 1462
332 Ga0501080_0008278 3300049742 Bacteria 9420
333 Ga0501080_0022077 3300049742 Bacteria 5897
334 Ga0501044_0014594 3300049823 Bacteria 8473
335 nmdc:mga03683_25516_c2 3300050489 Bacteria 1748
336 nmdc:mga03683_389835_c1 3300050489 Bacteria 664
337 nmdc:mga00v17_767954_c1 3300050491 Bacteria 615
338 nmdc:mga0yw44_1650_c1 3300050492 Bacteria 6858
339 nmdc:mga0yw44_84259_c1 3300050492 Bacteria 1998
340 nmdc:mga06z11_434647_c1 3300050494 Bacteria 792
341 nmdc:mga05p37_241970_c1 3300050507 Bacteria 2169
342 nmdc:mga05p37_275780_c1 3300050507 Bacteria 2008
343 nmdc:mga05p37_575722_c1 3300050507 Unclassified 1276
344 nmdc:mga09592_1276449_c1 3300050508 Bacteria 604
345 nmdc:mga0qj67_1449795_c1 3300050509 Bacteria 529
346 nmdc:mga08y16_70295_c1 3300050511 Bacteria 3649
347 nmdc:mga0n895_14300_c1 3300050512 Bacteria 7202
348 nmdc:mga0n895_463813_c1 3300050512 Unclassified 1278
349 nmdc:mga0n895_86690_c1 3300050512 Bacteria 3128
350 nmdc:mga0rr50_27322_c1 3300050513 Bacteria 3993
351 nmdc:mga0a205_21614_c2 3300050515 Bacteria 3097
352 nmdc:mga0a205_271491_c1 3300050515 Bacteria 1573
353 Ga0495601_0446678 3300053077 Bacteria 836
354 Ga0495655_0015574 3300053083 Bacteria 1619
355 Ga0500595_181366 3300053119 Bacteria 584
356 Ga0500568_0076430 3300053139 Bacteria 1275
357 Ga0501084_0063892 3300054114 Unclassified 3082
358 Ga0501082_0005007 3300060353 Bacteria 11564
359 Ga0466962_0058764 3300061719 Bacteria 1835
360 2524464544 2524023210 Bacteria 9029266
361 2889042254 2889033259 Bacteria 9099371
362 2904699065 2904690495 Bacteria 9412302
363 Ga0495583_0410177
364 rootH1_10063421
365 JGI25405J52794_10010173
366 Ga0065707_10103073
367 Ga0070658_10014174
368 Ga0070683_100119742
369 Ga0070683_100866494
370 Ga0070670_100000351
371 Ga0068869_100595186
372 Ga0070680_100570997
373 Ga0068868_101160493
374 Ga0070660_100082548
375 Ga0070689_100006397
376 Ga0070689_100498530
377 Ga0070692_10142395
378 Ga0070668_100233369
379 Ga0070668_100915026
380 Ga0070675_100003020
381 Ga0070675_100023566
382 Ga0070674_100295225
383 Ga0070674_100657457
384 Ga0070673_101184333
385 Ga0070667_100848625
386 Ga0070714_100243690
387 Ga0070713_100046127
388 Ga0070713_100241092
389 Ga0070713_101481348
390 Ga0070710_10240087
391 Ga0070711_100062506
392 Ga0070705_100900226
393 Ga0070700_100394401
394 Ga0070700_100477072
395 Ga0070700_100502549
396 Ga0070694_100185935
397 Ga0070708_100028944
398 Ga0070708_101349592
399 Ga0070678_100207540
400 Ga0070678_100635826
401 Ga0070681_10388742
402 Ga0070706_100106254
403 Ga0070706_100225946
404 Ga0070707_100205724
405 Ga0070707_100760840
406 Ga0070698_100187946
407 Ga0070698_100239554
408 Ga0070698_100333264
409 Ga0070699_100029276
410 Ga0070699_100094881
411 Ga0070679_100152327
412 Ga0070684_100003484
413 Ga0070684_100011354
414 Ga0070684_100210080
415 Ga0070684_100262225
416 Ga0070697_100021114
417 Ga0070697_100053943
418 Ga0070672_100477107
419 Ga0070672_100819713
420 Ga0070695_100181363
421 Ga0070693_100076238
422 Ga0070665_100266009
423 Ga0068855_100047493
424 Ga0068855_100061537
425 Ga0068854_100003831
426 Ga0068854_100108865
427 Ga0068854_101990466
428 Ga0068859_100887164
429 Ga0068864_101143028
430 Ga0068861_100016778
431 Ga0068863_100800017
432 Ga0068863_100929899
433 Ga0068858_100036682
434 Ga0068862_100033168
435 Ga0068862_101517263
436 Ga0081455_10005056
437 Ga0081455_10014416
438 Ga0081455_10030577
439 Ga0081455_10037457
440 Ga0081455_10122909
441 Ga0081455_10746349
442 Ga0081455_10768447
443 Ga0081538_10132001
444 Ga0081538_10225855
445 Ga0081540_1011602
446 Ga0081540_1044357
447 Ga0070717_10018908
448 Ga0070717_10200600
449 Ga0075365_10038173
450 Ga0075365_10400469
451 Ga0070716_100057173
452 Ga0070716_100142985
453 Ga0070716_100224764
454 Ga0070712_100311436
455 Ga0070712_100572746
456 Ga0075362_10047286
457 Ga0075362_10071974
458 Ga0075367_10124672
459 Ga0075367_10895457
460 Ga0075369_10156177
461 Ga0075369_10482693
462 Ga0075366_10044573
463 Ga0075370_10513142
464 Ga0068871_100554426
465 Ga0075428_100187130
466 Ga0075428_100878176
467 Ga0075430_100377121
468 Ga0075430_100492388
469 Ga0075431_100239410
470 Ga0075433_10081800
471 Ga0075433_10114817
472 Ga0075433_10972562
473 Ga0075434_100265524
474 Ga0075429_100927954
475 Ga0075436_100644987
476 Ga0097620_100887200
477 Ga0075435_100267538
478 Ga0099794_10038865
479 Ga0099794_10098365
480 Ga0099795_10571175
481 Ga0105240_11315397
482 Ga0111539_10088173
483 Ga0105247_10725840
484 Ga0114129_10258006
485 Ga0114129_10400981
486 Ga0114129_11849315
487 Ga0105243_10662720
488 Ga0105242_10691799
489 Ga0105242_13109656
490 Ga0105248_10157101
491 Ga0105248_10620070
492 Ga0105238_10234217
493 Ga0105238_10979268
494 Ga0105249_10146521
495 Ga0099796_10410450
496 Ga0105239_10536154
497 Ga0105239_11270837
498 Ga0105239_11431055
499 Ga0105246_10429979
500 Ga0105246_10457118
501 Ga0105246_10568920
502 Ga0105246_11696560
503 Ga0157370_10024450
504 Ga0157369_10133350
505 Ga0157369_11062364
506 Ga0157374_10990104
507 Ga0157378_10365217
508 Ga0157378_11592775
509 Ga0163162_10775593
510 Ga0163162_11289707
511 Ga0157372_10037981
512 Ga0157375_10355045
513 Ga0157375_12932139
514 Ga0163163_10150483
515 Ga0163163_10235051
516 Ga0163163_11546767
517 Ga0157380_10841307
518 Ga0157377_10191309
519 Ga0157379_10706985
520 Ga0209758_1050400
521 Ga0207682_10200176
522 Ga0207692_10047028
523 Ga0207692_10338933
524 Ga0207642_10149833
525 Ga0207688_10217579
526 Ga0207680_10444843
527 Ga0207685_10084849
528 Ga0207705_10004447
529 Ga0207684_10029902
530 Ga0207684_10060650
531 Ga0207707_10063708
532 Ga0207707_10190397
533 Ga0207695_10249705
534 Ga0207695_10455859
535 Ga0207693_10160543
536 Ga0207663_10028297
537 Ga0207660_10514464
538 Ga0207662_10830019
539 Ga0207657_10243843
540 Ga0207652_10007243
541 Ga0207652_10082628
542 Ga0207681_10491642
543 Ga0207694_10182114
544 Ga0207650_10000071
545 Ga0207650_10179876
546 Ga0207650_10474628
547 Ga0207650_11113662
548 Ga0207659_10000616
549 Ga0207659_10177499
550 Ga0207700_10013365
551 Ga0207700_10036708
552 Ga0207700_10320505
553 Ga0207664_11743655
554 Ga0207670_10318525
555 Ga0207670_11193267
556 Ga0207669_10258023
557 Ga0207669_10483554
558 Ga0207665_10013746
559 Ga0207665_11287931
560 Ga0207691_10493806
561 Ga0207711_10546760
562 Ga0207711_11409535
563 Ga0207689_10008604
564 Ga0207689_10063321
565 Ga0207689_10596863
566 Ga0207661_10000009
567 Ga0207661_10000769
568 Ga0207661_10565758
569 Ga0207661_11904574
570 Ga0207667_10154270
571 Ga0207667_10857375
572 Ga0207667_11605250
573 Ga0207712_10793788
574 Ga0207640_10001392
575 Ga0207677_11935440
576 Ga0207708_10503372
577 Ga0207641_10731591
578 Ga0207676_11689567
579 Ga0207698_10011379
580 Ga0209179_1097486
581 Ga0209588_1013827
582 Ga0209588_1118914
583 Ga0207428_10041605
584 Ga0268266_10116219
585 Ga0268266_11702988
586 Ga0268265_10042716
587 Ga0268265_11505507
588 Ga0307515_10527125
589 Ga0373944_0015587
590 Ga0373936_0450103
591 Ga0373945_0233588
592 Ga0373945_0363208
593 Ga0373946_0094451
594 Ga0373946_0123605
595 Ga0373955_0111071
596 Ga0373962_0331722
597 Ga0373931_0678345
598 Ga0373935_1101317
599 Ga0373927_0081322
600 Ga0373927_0462314
601 Ga0373933_0330499
602 Ga0373947_0179283
603 Ga0373947_1024424
604 Ga0373925_0117527
605 Ga0395900_0564516
606 Ga0395905_0645223
607 Ga0395905_0709460
608 Ga0395901_1798707
609 Ga0436360_1309847
610 Ga0451789_0793251
611 Ga0451807_1343459
612 Ga0466965_0334428
613 Ga0466961_0138437
614 Ga0466971_0056902
615 Ga0466959_0050346
616 Ga0466958_0191368
617 Ga0495603_0066828
618 Ga0495590_0048148
619 Ga0495591_091739
620 Ga0495638_0081273
621 Ga0495580_0682895
622 Ga0495580_0883911
623 Ga0495582_0020152
624 Ga0495582_0271653
625 Ga0495605_0165704
626 Ga0495639_0022718
627 Ga0495585_0016246
628 Ga0495585_0283766
629 Ga0495585_0291129
630 Ga0495594_0053383
631 Ga0495594_0228839
632 Ga0495596_0192232
633 Ga0495607_0025979
634 Ga0495583_0130296
635 Ga0495618_0049032
636 Ga0495620_0390769
637 Ga0495628_0123661
638 Ga0495630_0653240
639 Ga0495637_0202571
640 Ga0495643_0259729
641 Ga0495644_0008961
642 Ga0495663_0348127
643 Ga0495666_0233110
644 Ga0495642_0492119
645 Ga0495665_0123073
646 Ga0495598_0095760
647 Ga0495622_0326680
648 Ga0495633_0043448
649 Ga0495656_0024141
650 Ga0495668_0321963
651 Ga0495668_0505679
652 Ga0495634_0115537
653 Ga0495611_0054819
654 Ga0495625_0585060
655 Ga0495659_0010992
656 Ga0495588_0306279
657 Ga0495588_0389393
658 Ga0495647_0107543
659 Ga0495647_0170952
660 Ga0495624_0621813
661 Ga0495670_0019013
662 Ga0495671_0054276
663 Ga0495671_0275645
664 Ga0495649_0207848
665 Ga0495581_0419992
666 Ga0495683_0289989
667 Ga0495679_120351
668 Ga0495681_0104410
669 Ga0495593_0216308
670 Ga0495626_0069891
671 Ga0496102_0292549
672 Ga0496102_0301290
673 Ga0496103_0329605
674 Ga0496108_1397529
675 Ga0496110_0189980
676 Ga0496110_0332808
677 Ga0496111_1316679
678 Ga0496113_0752688
679 Ga0496114_0154351
680 Ga0496126_0134244
681 Ga0496126_1190117
682 Ga0501032_0521004
683 Ga0501038_0155379
684 Ga0501047_0009432
685 Ga0501067_0003604
686 Ga0501070_0009862
687 Ga0501073_0004433
688 Ga0501073_0014849
689 Ga0501074_0014146
690 Ga0501074_0214045
691 Ga0501076_0585822
692 Ga0501077_0015074
693 Ga0501079_0226026
694 Ga0501080_0008278
695 Ga0501080_0022077
696 Ga0501044_0014594
697 nmdc:mga03683_25516_c2
698 nmdc:mga03683_389835_c1
699 nmdc:mga00v17_767954_c1
700 nmdc:mga0yw44_1650_c1
701 nmdc:mga0yw44_84259_c1
702 nmdc:mga06z11_434647_c1
703 nmdc:mga05p37_241970_c1
704 nmdc:mga05p37_275780_c1
705 nmdc:mga05p37_575722_c1
706 nmdc:mga09592_1276449_c1
707 nmdc:mga0qj67_1449795_c1
708 nmdc:mga08y16_70295_c1
709 nmdc:mga0n895_14300_c1
710 nmdc:mga0n895_463813_c1
711 nmdc:mga0n895_86690_c1
712 nmdc:mga0rr50_27322_c1
713 nmdc:mga0a205_21614_c2
714 nmdc:mga0a205_271491_c1
715 Ga0495601_0446678
716 Ga0495655_0015574
717 Ga0500595_181366
718 Ga0500568_0076430
719 Ga0501084_0063892
720 Ga0501082_0005007
721 Ga0466962_0058764
722 2524464544
723 2889042254
724 2904699065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

2

121

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.7672 2 125
2i7r-assembly1.cif.gz_B conserved domain protein 0.7603 1 126
4pav-assembly6.cif.gz_F structure of hypothetical protein sa1046 from s. aureus. 0.7548 1 126
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.7513 1 126
2i7r-assembly1.cif.gz_B conserved domain protein 0.749 1 126
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8742 74 125 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8643 74 124 3.30.720.110
af_Q8I3U0_1800_1867_1.20.5.2050 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8134 100 124 1.20.5.2050
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8088 72 123 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7913 74 125 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A352FWD4-F1-model_v4 VOC domain-containing protein 0.9896 75 126
AF-A0A7W8N0D1-F1-model_v4 deleted 0.9377 14 126
AF-A0A7W8PGL1-F1-model_v4 Transposase/catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9313 1 126 GO:0003677
GO:0004803
GO:0006313
GO:0016829
GO:0051213
AF-A0A7W8PGL1-F1-model_v4 Transposase/catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9242 1 126 GO:0003677
GO:0004803
GO:0006313
GO:0016829
GO:0051213
AF-A0A2V6KYF3-F1-model_v4 Glyoxalase 0.923 1 126

Map