F422717

General Info

Members Datasets Scaffolds Average Seq Length
362 228 724 138

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0490331|Ga0495629_0490331_96_599
Length 167
Sequence LVHQKSQFMVLSSAPVSKHNARISRSRVFMNIRSIVGAACAGIAFSIAMPATAHGTGETVGLNFQHSIPNIPGKSLTAVVVDYAPGGASPTHTHAKSAFIYAYVLSGDIESQVNDGPKVIYHPGDSFFEEPGAIHRISRNASRSKPAKLLAVFVADSDDKVLTTPIK

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
211 2739367700 Dyella sp. YR388 Isolate Unclassified
212 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
213 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
214 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
215 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
216 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
217 2928163908 Burkholderia sp. 567 Isolate Unclassified
218 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
219 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
220 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
221 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
222 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
223 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
224 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
225 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
226 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
227 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
228 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.2
Metatranscriptomes 0.28
Isolates 5.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.08
Nodule 3.31
Rhizoplane 4.7
Rhizosphere 75.69
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0490331 3300046459 Bacteria 829
2 JGI24741J21665_1038055 3300001915 Bacteria 711
3 JGI24740J21852_10087136 3300001979 Bacteria 810
4 JGI24739J22299_10015121 3300001989 Bacteria 2805
5 JGI24737J22298_10062038 3300001990 Bacteria 1123
6 JGI24735J21928_10000327 3300002067 Bacteria 16530
7 JGI24735J21928_10019014 3300002067 Bacteria 2115
8 JGI24735J21928_10043189 3300002067 Bacteria 1312
9 JGI24735J21928_10072008 3300002067 Bacteria 990
10 JGI25164J39214_1005363 3300002772 Bacteria 1397
11 JGI25165J46597_1001452 3300003214 Bacteria 12481
12 rootH2_10045496 3300003320 Bacteria 8616
13 rootL2_10011051 3300003322 Bacteria 5980
14 rootH1_10338433 3300003323 Bacteria 1049
15 JGI25160J50197_1085961 3300003354 Bacteria 577
16 Ga0055533_1000094 3300003756 Bacteria 115741
17 Ga0055532_1000003 3300003758 Bacteria 494004
18 Ga0055527_1000006 3300003760 Bacteria 494004
19 Ga0055535_1000003 3300003761 Bacteria 494004
20 Ga0055542_1000007 3300003762 Bacteria 494004
21 Ga0055529_1000003 3300003763 Bacteria 494004
22 Ga0070658_10007331 3300005327 Bacteria 8909
23 Ga0070658_10222265 3300005327 Bacteria 1597
24 Ga0070658_10340894 3300005327 Bacteria 1282
25 Ga0070658_10637956 3300005327 Bacteria 924
26 Ga0070683_100746463 3300005329 Bacteria 938
27 Ga0070660_100000049 3300005339 Bacteria 69269
28 Ga0070660_100011415 3300005339 Bacteria 6309
29 Ga0070660_100291620 3300005339 Bacteria 1336
30 Ga0070661_100122310 3300005344 Bacteria 1950
31 Ga0070659_100000085 3300005366 Bacteria 70518
32 Ga0070659_100007224 3300005366 Bacteria 8062
33 Ga0070713_100844894 3300005436 Bacteria 879
34 Ga0070711_101438982 3300005439 Bacteria 600
35 Ga0070684_100596319 3300005535 Bacteria 1027
36 Ga0068853_100312928 3300005539 Bacteria 1454
37 Ga0068853_101293409 3300005539 Bacteria 705
38 Ga0068855_100003969 3300005563 Bacteria 18068
39 Ga0068855_100014066 3300005563 Bacteria 9646
40 Ga0068855_100018687 3300005563 Bacteria 8336
41 Ga0068855_100054635 3300005563 Bacteria 4693
42 Ga0068855_100444687 3300005563 Bacteria 1415
43 Ga0070664_100047962 3300005564 Bacteria 3610
44 Ga0068856_100511191 3300005614 Bacteria 1222
45 Ga0068856_101354091 3300005614 Bacteria 727
46 Ga0068856_101534489 3300005614 Bacteria 680
47 Ga0068856_101692015 3300005614 Bacteria 645
48 Ga0081455_10009537 3300005937 Bacteria 9971
49 Ga0081538_10034821 3300005981 Bacteria 3321
50 Ga0081540_1006519 3300005983 Bacteria 8478
51 Ga0075432_10204540 3300006058 Bacteria 783
52 Ga0070716_100097286 3300006173 Bacteria 1796
53 Ga0075431_100385443 3300006847 Unclassified 1405
54 Ga0075434_101780948 3300006871 Bacteria 623
55 Ga0099794_10218894 3300007265 Bacteria 978
56 Ga0105251_10005911 3300009011 Bacteria 7911
57 Ga0105240_10004138 3300009093 Bacteria 22226
58 Ga0105240_10097039 3300009093 Bacteria 3591
59 Ga0105240_10146882 3300009093 Bacteria 2813
60 Ga0105240_10192535 3300009093 Bacteria 2397
61 Ga0111539_10000616 3300009094 Bacteria 46125
62 Ga0111539_10003185 3300009094 Bacteria 21714
63 Ga0105241_10026209 3300009174 Bacteria 4335
64 Ga0105241_10281636 3300009174 Bacteria 1420
65 Ga0105237_10005341 3300009545 Bacteria 14534
66 Ga0105237_10033917 3300009545 Bacteria 5171
67 Ga0105238_10093840 3300009551 Bacteria 2989
68 Ga0105239_10000892 3300010375 Bacteria 42342
69 Ga0105239_10324382 3300010375 Bacteria 1737
70 Ga0157373_10000726 3300013100 Bacteria 25755
71 Ga0157370_10003724 3300013104 Bacteria 17816
72 Ga0157370_10009772 3300013104 Bacteria 10176
73 Ga0157370_10041777 3300013104 Bacteria 4421
74 Ga0157370_10375663 3300013104 Bacteria 1309
75 Ga0157369_10001023 3300013105 Bacteria 35261
76 Ga0157369_10024117 3300013105 Bacteria 6770
77 Ga0157369_10131956 3300013105 Bacteria 2646
78 Ga0157369_10451354 3300013105 Bacteria 1331
79 Ga0157369_11981724 3300013105 Bacteria 591
80 Ga0157374_10580428 3300013296 Bacteria 1130
81 Ga0163162_11098676 3300013306 Bacteria 901
82 Ga0157372_10322975 3300013307 Bacteria 1797
83 Ga0157372_11739383 3300013307 Bacteria 717
84 Ga0157372_12845157 3300013307 Bacteria 555
85 Ga0182008_10300004 3300014497 Bacteria 840
86 Ga0182006_1021114 3300015261 Bacteria 2719
87 Ga0182005_1005237 3300015265 Bacteria 4069
88 Ga0213872_10060353 3300021361 Bacteria 1715
89 Ga0213874_10020186 3300021377 Bacteria 1824
90 Ga0213876_10062331 3300021384 Bacteria 1968
91 Ga0224712_10004257 3300022467 Bacteria 3839
92 Ga0209435_106096 3300025206 Bacteria 1346
93 Ga0209566_104847 3300025225 Bacteria 1769
94 Ga0209674_100025 3300025226 Bacteria 515942
95 Ga0209672_100002 3300025228 Bacteria 1733325
96 Ga0209672_100104 3300025228 Bacteria 103234
97 Ga0209147_100003 3300025229 Bacteria 1733325
98 Ga0209563_100987 3300025230 Bacteria 8335
99 Ga0207427_100527 3300025231 Bacteria 19899
100 Ga0209258_100005 3300025242 Bacteria 1087938
101 Ga0209148_1000006 3300025254 Bacteria 1733325
102 Ga0209759_1000014 3300025256 Bacteria 396291
103 Ga0209233_1000018 3300025261 Bacteria 886857
104 Ga0209455_1000003 3300025272 Bacteria 1471893
105 Ga0209564_1006901 3300025295 Bacteria 5979
106 Ga0207426_1002334 3300025302 Bacteria 12396
107 Ga0207713_1046175 3300025735 Bacteria 1773
108 Ga0207647_10000819 3300025904 Bacteria 24170
109 Ga0207647_10002399 3300025904 Bacteria 14220
110 Ga0207647_10003908 3300025904 Bacteria 11130
111 Ga0207647_10140744 3300025904 Bacteria 1414
112 Ga0207705_10001444 3300025909 Bacteria 18966
113 Ga0207705_10021815 3300025909 Bacteria 4569
114 Ga0207705_10837971 3300025909 Bacteria 713
115 Ga0207654_10225259 3300025911 Bacteria 1246
116 Ga0207695_10063301 3300025913 Bacteria 3814
117 Ga0207695_10069510 3300025913 Bacteria 3603
118 Ga0207695_10191663 3300025913 Bacteria 1962
119 Ga0207695_10228420 3300025913 Bacteria 1766
120 Ga0207695_11273692 3300025913 Bacteria 615
121 Ga0207671_10020603 3300025914 Bacteria 5016
122 Ga0207657_10000593 3300025919 Bacteria 38361
123 Ga0207657_10012713 3300025919 Bacteria 8292
124 Ga0207657_10140887 3300025919 Bacteria 1970
125 Ga0207694_10655930 3300025924 Bacteria 884
126 Ga0207700_10729684 3300025928 Bacteria 885
127 Ga0207690_10000097 3300025932 Bacteria 71940
128 Ga0207690_10046882 3300025932 Bacteria 2865
129 Ga0207665_10093696 3300025939 Bacteria 2085
130 Ga0207667_10003912 3300025949 Bacteria 18325
131 Ga0207667_10038057 3300025949 Bacteria 5139
132 Ga0207667_10081548 3300025949 Bacteria 3351
133 Ga0207667_10110938 3300025949 Bacteria 2829
134 Ga0207667_10380499 3300025949 Bacteria 1438
135 Ga0207639_10247380 3300026041 Bacteria 1553
136 Ga0207702_10179488 3300026078 Bacteria 1949
137 Ga0207702_10654963 3300026078 Bacteria 1033
138 Ga0207702_10829545 3300026078 Bacteria 915
139 Ga0207674_10488421 3300026116 Bacteria 1190
140 Ga0207698_10058809 3300026142 Bacteria 2981
141 Ga0209371_1000008 3300027312 Bacteria 1024606
142 Ga0209974_10415472 3300027876 Unclassified 530
143 Ga0207428_10000129 3300027907 Bacteria 104467
144 Ga0207428_10000390 3300027907 Bacteria 54925
145 Ga0268256_1000009 3300030500 Bacteria 1022625
146 Ga0307407_10394848 3300031903 Bacteria 991
147 Ga0373927_0007913 3300035695 Bacteria 7182
148 Ga0395899_0189553 3300037312 Bacteria 1439
149 Ga0395900_0045029 3300037418 Bacteria 4545
150 Ga0395900_0249873 3300037418 Bacteria 1775
151 Ga0395898_0000254 3300037466 Bacteria 131247
152 Ga0395898_0107033 3300037466 Bacteria 2681
153 Ga0395905_0117080 3300037471 Bacteria 2504
154 Ga0395905_0133085 3300037471 Bacteria 2339
155 Ga0395905_0627527 3300037471 Bacteria 977
156 Ga0395905_1464466 3300037471 Unclassified 587
157 Ga0395901_0000009 3300038443 Bacteria 479396
158 Ga0395901_0013930 3300038443 Bacteria 8183
159 Ga0395901_0319678 3300038443 Bacteria 1606
160 Ga0436365_1912119 3300039437 Bacteria 14725
161 Ga0436360_1200391 3300039438 Bacteria 1336
162 Ga0436361_0099439 3300039447 Bacteria 10606
163 Ga0439457_153489 3300042014 Unclassified 555
164 Ga0466969_0009042 3300044656 Bacteria 5278
165 Ga0466969_0025495 3300044656 Bacteria 3039
166 Ga0466969_0058244 3300044656 Bacteria 1881
167 Ga0466972_0005610 3300044658 Bacteria 6286
168 Ga0466972_0058118 3300044658 Bacteria 1857
169 Ga0466972_0274700 3300044658 Bacteria 787
170 Ga0466982_0049260 3300044672 Bacteria 2573
171 Ga0466982_0112481 3300044672 Bacteria 1682
172 Ga0466965_0002917 3300044683 Bacteria 7391
173 Ga0466965_0099032 3300044683 Bacteria 1489
174 Ga0466965_0335583 3300044683 Bacteria 825
175 Ga0466966_0000103 3300044684 Bacteria 51642
176 Ga0466966_0000143 3300044684 Bacteria 45651
177 Ga0466966_0012747 3300044684 Bacteria 5572
178 Ga0466961_0000370 3300044693 Bacteria 29075
179 Ga0466961_0013660 3300044693 Bacteria 5203
180 Ga0466961_0194136 3300044693 Unclassified 1257
181 Ga0466963_0010324 3300044694 Bacteria 5652
182 Ga0466963_0028759 3300044694 Bacteria 3572
183 Ga0466963_0100915 3300044694 Bacteria 1975
184 Ga0466964_0046185 3300044706 Bacteria 1774
185 Ga0466964_0060483 3300044706 Bacteria 1575
186 Ga0466971_0000699 3300044719 Bacteria 13423
187 Ga0466971_0011281 3300044719 Bacteria 3915
188 Ga0466968_0007933 3300044735 Bacteria 4054
189 Ga0466968_0041065 3300044735 Bacteria 1952
190 Ga0466970_0003006 3300044765 Bacteria 8177
191 Ga0466970_0059479 3300044765 Bacteria 2046
192 Ga0466970_0090570 3300044765 Bacteria 1660
193 Ga0466957_0002836 3300044842 Bacteria 9376
194 Ga0466957_0015976 3300044842 Bacteria 4386
195 Ga0466957_0017357 3300044842 Bacteria 4213
196 Ga0466957_0033636 3300044842 Bacteria 3076
197 Ga0466957_0039939 3300044842 Bacteria 2832
198 Ga0466957_0117288 3300044842 Bacteria 1694
199 Ga0466957_0882425 3300044842 Bacteria 638
200 Ga0466960_0029957 3300044901 Bacteria 2501
201 Ga0466960_0071553 3300044901 Bacteria 1727
202 Ga0466959_0005842 3300045049 Bacteria 8472
203 Ga0466959_0008526 3300045049 Bacteria 7254
204 Ga0466959_0014115 3300045049 Bacteria 5796
205 Ga0466959_0043076 3300045049 Bacteria 3329
206 Ga0466958_0000374 3300045836 Bacteria 18172
207 Ga0466958_0001449 3300045836 Bacteria 11259
208 Ga0466958_0005296 3300045836 Bacteria 6921
209 Ga0466958_0007738 3300045836 Bacteria 5928
210 Ga0466958_0023350 3300045836 Bacteria 3630
211 Ga0466958_0057109 3300045836 Bacteria 2372
212 Ga0466958_0106787 3300045836 Bacteria 1746
213 Ga0466967_0007347 3300045976 Bacteria 7935
214 Ga0466967_0643907 3300045976 Bacteria 1048
215 Ga0466967_1311268 3300045976 Bacteria 721
216 Ga0495592_0044294 3300046454 Bacteria 3325
217 Ga0495590_0022293 3300046457 Bacteria 2240
218 Ga0495629_0047874 3300046459 Bacteria 2998
219 Ga0495641_0071045 3300046461 Bacteria 1563
220 Ga0495651_0062368 3300046462 Bacteria 2852
221 Ga0495653_0011790 3300046463 Bacteria 7138
222 Ga0495580_0689694 3300046472 Unclassified 669
223 Ga0495582_0001320 3300046473 Bacteria 13902
224 Ga0495605_0109832 3300046474 Bacteria 1259
225 Ga0495664_0023994 3300046477 Bacteria 3541
226 Ga0495664_0405707 3300046477 Bacteria 818
227 Ga0495596_0088730 3300046500 Bacteria 1200
228 Ga0495596_0229693 3300046500 Bacteria 720
229 Ga0495606_0060968 3300046507 Bacteria 2414
230 Ga0495606_0615331 3300046507 Bacteria 531
231 Ga0495608_0007014 3300046511 Bacteria 7975
232 Ga0495618_0006913 3300046514 Bacteria 6879
233 Ga0495628_0157264 3300046516 Bacteria 1728
234 Ga0495630_0420011 3300046517 Bacteria 1024
235 Ga0495652_0058256 3300046529 Bacteria 3271
236 Ga0495665_0028828 3300046531 Bacteria 2974
237 Ga0495640_0004833 3300046533 Bacteria 10722
238 Ga0495586_0025200 3300046535 Bacteria 3181
239 Ga0495667_0034695 3300046559 Bacteria 3373
240 Ga0495634_0011266 3300046642 Bacteria 6514
241 Ga0495635_0023547 3300046663 Bacteria 4289
242 Ga0495657_0009339 3300046675 Bacteria 7441
243 Ga0495623_0019597 3300046679 Bacteria 4372
244 Ga0495646_0263774 3300046680 Bacteria 919
245 Ga0495658_0046348 3300046683 Bacteria 2443
246 Ga0495613_0132982 3300046689 Bacteria 1781
247 Ga0495624_0043600 3300046690 Bacteria 2861
248 Ga0495589_0096952 3300046794 Bacteria 1429
249 Ga0495589_0229797 3300046794 Bacteria 870
250 Ga0495600_0009353 3300046809 Bacteria 6053
251 Ga0495581_0012290 3300047315 Bacteria 4959
252 Ga0495604_0064552 3300047317 Bacteria 2789
253 Ga0495674_0027721 3300047319 Bacteria 5172
254 Ga0495674_0035145 3300047319 Bacteria 4524
255 Ga0495674_0267150 3300047319 Bacteria 1404
256 Ga0495672_0162593 3300047320 Bacteria 1146
257 Ga0495676_0437917 3300047321 Bacteria 863
258 Ga0495676_0767960 3300047321 Bacteria 621
259 Ga0495680_0025856 3300047322 Bacteria 4852
260 Ga0495683_0002226 3300047323 Bacteria 11867
261 Ga0495683_0031536 3300047323 Bacteria 2701
262 Ga0495687_002927 3300047443 Bacteria 12984
263 Ga0495687_015268 3300047443 Bacteria 3914
264 Ga0495675_0006000 3300047444 Bacteria 7428
265 Ga0495684_0548006 3300047471 Bacteria 788
266 Ga0495686_0274478 3300047472 Bacteria 939
267 Ga0495593_0017463 3300047673 Bacteria 4038
268 Ga0495614_0048286 3300048089 Bacteria 1824
269 Ga0496100_0034519 3300048903 Bacteria 3175
270 Ga0496100_1005041 3300048903 Bacteria 656
271 Ga0496101_0026741 3300048904 Bacteria 4012
272 Ga0496101_0048226 3300048904 Bacteria 3060
273 Ga0496102_0001560 3300048905 Bacteria 20225
274 Ga0496103_0006627 3300048906 Bacteria 6909
275 Ga0496103_0370927 3300048906 Bacteria 920
276 Ga0496104_0021477 3300048907 Bacteria 5926
277 Ga0496104_0085733 3300048907 Bacteria 3006
278 Ga0496104_0086734 3300048907 Bacteria 2988
279 Ga0496104_0658278 3300048907 Bacteria 956
280 Ga0496105_0355376 3300048908 Bacteria 1169
281 Ga0496110_0002240 3300048913 Bacteria 14461
282 Ga0496112_0013175 3300048915 Bacteria 7630
283 Ga0496112_0210574 3300048915 Bacteria 1901
284 Ga0496112_0546338 3300048915 Bacteria 1092
285 Ga0496115_0391463 3300048918 Bacteria 1129
286 Ga0496116_0017603 3300048919 Bacteria 5538
287 Ga0496116_0223449 3300048919 Bacteria 962
288 Ga0496117_0037909 3300048920 Bacteria 3584
289 Ga0496117_0062338 3300048920 Bacteria 2556
290 Ga0496117_0109827 3300048920 Bacteria 1720
291 Ga0496117_0423649 3300048920 Bacteria 665
292 Ga0496118_0013055 3300048921 Bacteria 7897
293 Ga0496118_0018719 3300048921 Bacteria 6224
294 Ga0496118_0087954 3300048921 Bacteria 2151
295 Ga0496118_0196421 3300048921 Bacteria 1200
296 Ga0496119_0032436 3300048922 Bacteria 3481
297 Ga0496119_0072397 3300048922 Bacteria 2014
298 Ga0496121_0000382 3300048924 Bacteria 90517
299 Ga0496121_0007399 3300048924 Bacteria 13268
300 Ga0496121_0070606 3300048924 Bacteria 2812
301 Ga0496123_0086640 3300048926 Bacteria 1877
302 Ga0496123_0093994 3300048926 Bacteria 1769
303 Ga0496124_0092650 3300048927 Bacteria 2461
304 Ga0496124_0159716 3300048927 Bacteria 1758
305 Ga0496125_0018397 3300048928 Bacteria 6637
306 Ga0496126_0798413 3300048929 Bacteria 724
307 Ga0466983_0405011 3300048986 Bacteria 984
308 Ga0501032_0006064 3300049569 Bacteria 8909
309 Ga0501033_0006826 3300049570 Bacteria 8909
310 Ga0501034_0036991 3300049571 Bacteria 4942
311 Ga0501036_0019325 3300049572 Bacteria 5717
312 Ga0501037_0043339 3300049573 Bacteria 3307
313 Ga0501038_0012581 3300049574 Bacteria 7733
314 Ga0501039_0001182 3300049575 Bacteria 19129
315 Ga0501043_0008182 3300049579 Bacteria 8245
316 Ga0501046_0001892 3300049580 Bacteria 19894
317 Ga0501046_1078402 3300049580 Bacteria 555
318 Ga0501047_0018553 3300049581 Bacteria 6670
319 Ga0501048_0082903 3300049582 Bacteria 2261
320 Ga0501067_0041995 3300049583 Bacteria 2539
321 Ga0501068_0340333 3300049584 Bacteria 963
322 Ga0501069_0000483 3300049585 Bacteria 18234
323 Ga0501070_0028136 3300049586 Bacteria 4713
324 Ga0501073_0002041 3300049589 Bacteria 15077
325 Ga0501074_0011323 3300049590 Bacteria 6484
326 Ga0501261_110768 3300049690 Unclassified 533
327 Ga0501079_0035209 3300049741 Bacteria 3854
328 Ga0501080_0010404 3300049742 Bacteria 8514
329 Ga0501080_0847020 3300049742 Bacteria 800
330 Ga0501083_0004635 3300049744 Bacteria 9707
331 Ga0501035_0045688 3300049822 Bacteria 3939
332 Ga0501035_1141071 3300049822 Bacteria 607
333 Ga0501044_0008588 3300049823 Bacteria 11188
334 nmdc:mga06r32_202998_c1 3300050510 Bacteria 1970
335 nmdc:mga08y16_188_c1 3300050511 Bacteria 55087
336 nmdc:mga08y16_51_c1 3300050511 Bacteria 105348
337 nmdc:mga0a205_444544_c1 3300050515 Bacteria 1157
338 Ga0501082_0050445 3300060353 Bacteria 3588
339 Ga0466962_0000190 3300061719 Bacteria 25645
340 Ga0466962_0005972 3300061719 Bacteria 5849
341 Ga0466962_0013170 3300061719 Bacteria 3978
342 Ga0466962_0353888 3300061719 Bacteria 731
343 2509128276 2508501125 Bacteria 7208311
344 2739731148 2739367700 Bacteria 4747630
345 2900582659 2900577576 Bacteria 5438534
346 2904486797 2904483920 Bacteria 7545285
347 2919528128 2919527303 Bacteria 7718827
348 2921652243 2921643360 Bacteria 11448031
349 2928162354 2928157003 Bacteria 7522202
350 2928166221 2928163908 Bacteria 7561269
351 2932836690 2932828146 Bacteria 9745859
352 2935846701 2935837841 Bacteria 9454360
353 2941547178 2941538514 Bacteria 9402094
354 2990703862 2990703756 Bacteria 7715990
355 642415844 641736154 Bacteria 7689995
356 642595327 642555112 Bacteria 8676562
357 642598638 642555112 Bacteria 8676562
358 8016512740 8016511872 Bacteria 9921665
359 8017067257 8017057580 Bacteria 10023680
360 8055273789 8055266321 Bacteria 7999742
361 8055304775 8055301274 Bacteria 8587385
362 8056688182 8056681323 Bacteria 8472857
363 Ga0495629_0490331
364 JGI24741J21665_1038055
365 JGI24740J21852_10087136
366 JGI24739J22299_10015121
367 JGI24737J22298_10062038
368 JGI24735J21928_10000327
369 JGI24735J21928_10019014
370 JGI24735J21928_10043189
371 JGI24735J21928_10072008
372 JGI25164J39214_1005363
373 JGI25165J46597_1001452
374 rootH2_10045496
375 rootL2_10011051
376 rootH1_10338433
377 JGI25160J50197_1085961
378 Ga0055533_1000094
379 Ga0055532_1000003
380 Ga0055527_1000006
381 Ga0055535_1000003
382 Ga0055542_1000007
383 Ga0055529_1000003
384 Ga0070658_10007331
385 Ga0070658_10222265
386 Ga0070658_10340894
387 Ga0070658_10637956
388 Ga0070683_100746463
389 Ga0070660_100000049
390 Ga0070660_100011415
391 Ga0070660_100291620
392 Ga0070661_100122310
393 Ga0070659_100000085
394 Ga0070659_100007224
395 Ga0070713_100844894
396 Ga0070711_101438982
397 Ga0070684_100596319
398 Ga0068853_100312928
399 Ga0068853_101293409
400 Ga0068855_100003969
401 Ga0068855_100014066
402 Ga0068855_100018687
403 Ga0068855_100054635
404 Ga0068855_100444687
405 Ga0070664_100047962
406 Ga0068856_100511191
407 Ga0068856_101354091
408 Ga0068856_101534489
409 Ga0068856_101692015
410 Ga0081455_10009537
411 Ga0081538_10034821
412 Ga0081540_1006519
413 Ga0075432_10204540
414 Ga0070716_100097286
415 Ga0075431_100385443
416 Ga0075434_101780948
417 Ga0099794_10218894
418 Ga0105251_10005911
419 Ga0105240_10004138
420 Ga0105240_10097039
421 Ga0105240_10146882
422 Ga0105240_10192535
423 Ga0111539_10000616
424 Ga0111539_10003185
425 Ga0105241_10026209
426 Ga0105241_10281636
427 Ga0105237_10005341
428 Ga0105237_10033917
429 Ga0105238_10093840
430 Ga0105239_10000892
431 Ga0105239_10324382
432 Ga0157373_10000726
433 Ga0157370_10003724
434 Ga0157370_10009772
435 Ga0157370_10041777
436 Ga0157370_10375663
437 Ga0157369_10001023
438 Ga0157369_10024117
439 Ga0157369_10131956
440 Ga0157369_10451354
441 Ga0157369_11981724
442 Ga0157374_10580428
443 Ga0163162_11098676
444 Ga0157372_10322975
445 Ga0157372_11739383
446 Ga0157372_12845157
447 Ga0182008_10300004
448 Ga0182006_1021114
449 Ga0182005_1005237
450 Ga0213872_10060353
451 Ga0213874_10020186
452 Ga0213876_10062331
453 Ga0224712_10004257
454 Ga0209435_106096
455 Ga0209566_104847
456 Ga0209674_100025
457 Ga0209672_100002
458 Ga0209672_100104
459 Ga0209147_100003
460 Ga0209563_100987
461 Ga0207427_100527
462 Ga0209258_100005
463 Ga0209148_1000006
464 Ga0209759_1000014
465 Ga0209233_1000018
466 Ga0209455_1000003
467 Ga0209564_1006901
468 Ga0207426_1002334
469 Ga0207713_1046175
470 Ga0207647_10000819
471 Ga0207647_10002399
472 Ga0207647_10003908
473 Ga0207647_10140744
474 Ga0207705_10001444
475 Ga0207705_10021815
476 Ga0207705_10837971
477 Ga0207654_10225259
478 Ga0207695_10063301
479 Ga0207695_10069510
480 Ga0207695_10191663
481 Ga0207695_10228420
482 Ga0207695_11273692
483 Ga0207671_10020603
484 Ga0207657_10000593
485 Ga0207657_10012713
486 Ga0207657_10140887
487 Ga0207694_10655930
488 Ga0207700_10729684
489 Ga0207690_10000097
490 Ga0207690_10046882
491 Ga0207665_10093696
492 Ga0207667_10003912
493 Ga0207667_10038057
494 Ga0207667_10081548
495 Ga0207667_10110938
496 Ga0207667_10380499
497 Ga0207639_10247380
498 Ga0207702_10179488
499 Ga0207702_10654963
500 Ga0207702_10829545
501 Ga0207674_10488421
502 Ga0207698_10058809
503 Ga0209371_1000008
504 Ga0209974_10415472
505 Ga0207428_10000129
506 Ga0207428_10000390
507 Ga0268256_1000009
508 Ga0307407_10394848
509 Ga0373927_0007913
510 Ga0395899_0189553
511 Ga0395900_0045029
512 Ga0395900_0249873
513 Ga0395898_0000254
514 Ga0395898_0107033
515 Ga0395905_0117080
516 Ga0395905_0133085
517 Ga0395905_0627527
518 Ga0395905_1464466
519 Ga0395901_0000009
520 Ga0395901_0013930
521 Ga0395901_0319678
522 Ga0436365_1912119
523 Ga0436360_1200391
524 Ga0436361_0099439
525 Ga0439457_153489
526 Ga0466969_0009042
527 Ga0466969_0025495
528 Ga0466969_0058244
529 Ga0466972_0005610
530 Ga0466972_0058118
531 Ga0466972_0274700
532 Ga0466982_0049260
533 Ga0466982_0112481
534 Ga0466965_0002917
535 Ga0466965_0099032
536 Ga0466965_0335583
537 Ga0466966_0000103
538 Ga0466966_0000143
539 Ga0466966_0012747
540 Ga0466961_0000370
541 Ga0466961_0013660
542 Ga0466961_0194136
543 Ga0466963_0010324
544 Ga0466963_0028759
545 Ga0466963_0100915
546 Ga0466964_0046185
547 Ga0466964_0060483
548 Ga0466971_0000699
549 Ga0466971_0011281
550 Ga0466968_0007933
551 Ga0466968_0041065
552 Ga0466970_0003006
553 Ga0466970_0059479
554 Ga0466970_0090570
555 Ga0466957_0002836
556 Ga0466957_0015976
557 Ga0466957_0017357
558 Ga0466957_0033636
559 Ga0466957_0039939
560 Ga0466957_0117288
561 Ga0466957_0882425
562 Ga0466960_0029957
563 Ga0466960_0071553
564 Ga0466959_0005842
565 Ga0466959_0008526
566 Ga0466959_0014115
567 Ga0466959_0043076
568 Ga0466958_0000374
569 Ga0466958_0001449
570 Ga0466958_0005296
571 Ga0466958_0007738
572 Ga0466958_0023350
573 Ga0466958_0057109
574 Ga0466958_0106787
575 Ga0466967_0007347
576 Ga0466967_0643907
577 Ga0466967_1311268
578 Ga0495592_0044294
579 Ga0495590_0022293
580 Ga0495629_0047874
581 Ga0495641_0071045
582 Ga0495651_0062368
583 Ga0495653_0011790
584 Ga0495580_0689694
585 Ga0495582_0001320
586 Ga0495605_0109832
587 Ga0495664_0023994
588 Ga0495664_0405707
589 Ga0495596_0088730
590 Ga0495596_0229693
591 Ga0495606_0060968
592 Ga0495606_0615331
593 Ga0495608_0007014
594 Ga0495618_0006913
595 Ga0495628_0157264
596 Ga0495630_0420011
597 Ga0495652_0058256
598 Ga0495665_0028828
599 Ga0495640_0004833
600 Ga0495586_0025200
601 Ga0495667_0034695
602 Ga0495634_0011266
603 Ga0495635_0023547
604 Ga0495657_0009339
605 Ga0495623_0019597
606 Ga0495646_0263774
607 Ga0495658_0046348
608 Ga0495613_0132982
609 Ga0495624_0043600
610 Ga0495589_0096952
611 Ga0495589_0229797
612 Ga0495600_0009353
613 Ga0495581_0012290
614 Ga0495604_0064552
615 Ga0495674_0027721
616 Ga0495674_0035145
617 Ga0495674_0267150
618 Ga0495672_0162593
619 Ga0495676_0437917
620 Ga0495676_0767960
621 Ga0495680_0025856
622 Ga0495683_0002226
623 Ga0495683_0031536
624 Ga0495687_002927
625 Ga0495687_015268
626 Ga0495675_0006000
627 Ga0495684_0548006
628 Ga0495686_0274478
629 Ga0495593_0017463
630 Ga0495614_0048286
631 Ga0496100_0034519
632 Ga0496100_1005041
633 Ga0496101_0026741
634 Ga0496101_0048226
635 Ga0496102_0001560
636 Ga0496103_0006627
637 Ga0496103_0370927
638 Ga0496104_0021477
639 Ga0496104_0085733
640 Ga0496104_0086734
641 Ga0496104_0658278
642 Ga0496105_0355376
643 Ga0496110_0002240
644 Ga0496112_0013175
645 Ga0496112_0210574
646 Ga0496112_0546338
647 Ga0496115_0391463
648 Ga0496116_0017603
649 Ga0496116_0223449
650 Ga0496117_0037909
651 Ga0496117_0062338
652 Ga0496117_0109827
653 Ga0496117_0423649
654 Ga0496118_0013055
655 Ga0496118_0018719
656 Ga0496118_0087954
657 Ga0496118_0196421
658 Ga0496119_0032436
659 Ga0496119_0072397
660 Ga0496121_0000382
661 Ga0496121_0007399
662 Ga0496121_0070606
663 Ga0496123_0086640
664 Ga0496123_0093994
665 Ga0496124_0092650
666 Ga0496124_0159716
667 Ga0496125_0018397
668 Ga0496126_0798413
669 Ga0466983_0405011
670 Ga0501032_0006064
671 Ga0501033_0006826
672 Ga0501034_0036991
673 Ga0501036_0019325
674 Ga0501037_0043339
675 Ga0501038_0012581
676 Ga0501039_0001182
677 Ga0501043_0008182
678 Ga0501046_0001892
679 Ga0501046_1078402
680 Ga0501047_0018553
681 Ga0501048_0082903
682 Ga0501067_0041995
683 Ga0501068_0340333
684 Ga0501069_0000483
685 Ga0501070_0028136
686 Ga0501073_0002041
687 Ga0501074_0011323
688 Ga0501261_110768
689 Ga0501079_0035209
690 Ga0501080_0010404
691 Ga0501080_0847020
692 Ga0501083_0004635
693 Ga0501035_0045688
694 Ga0501035_1141071
695 Ga0501044_0008588
696 nmdc:mga06r32_202998_c1
697 nmdc:mga08y16_188_c1
698 nmdc:mga08y16_51_c1
699 nmdc:mga0a205_444544_c1
700 Ga0501082_0050445
701 Ga0466962_0000190
702 Ga0466962_0005972
703 Ga0466962_0013170
704 Ga0466962_0353888
705 2509128276
706 2739731148
707 2900582659
708 2904486797
709 2919528128
710 2921652243
711 2928162354
712 2928166221
713 2932836690
714 2935846701
715 2941547178
716 2990703862
717 642415844
718 642595327
719 642598638
720 8016512740
721 8017067257
722 8055273789
723 8055304775
724 8056688182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

79

153

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9267 47 124
5j7m-assembly1.cif.gz_B crystal structure of cupin 2 conserved barrel domain protein from kribbella flavida dsm 17836 0.8918 39 124
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.8895 47 127
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8839 28 126
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8769 47 136
ID Description Score Start End Superfamily
5j7mB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9419 47 124 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9267 47 124 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.875 28 126 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8742 28 126 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8739 47 124 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A843ZTR8-F1-model_v4 deleted 1.003 54 138
AF-A0A7X6JDE2-F1-model_v4 Cupin domain-containing protein 0.9977 49 136
AF-A0A1H8NX39-F1-model_v4 deleted 0.9965 29 138
AF-A0A530RFZ5-F1-model_v4 Cupin domain-containing protein 0.9959 35 138
AF-A0A1I3T3R0-F1-model_v4 deleted 0.9929 29 138

Map