F422612
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 362 | 194 | 362 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10302712|Ga0213876_103027121 |
| Length | 204 |
| Sequence | MECVVQRVCKGRPREFDLDEALAAALRVFWTKGYDGASLTDLTDAMGITRPSLYAAFGNKEALFRKALDLYEREKLAYVGEALKAPTSRQVAERLLRGALQMQTSDCEQPRGCMRVISSVACGPEADSIRADLMQRRQSSQRALCDRMQRAKEDGDLPAGTDVDGLCAYLGAIMQGMAVQAGSGATKEQLEALVETSLVMWPGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 144 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 145 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 146 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 147 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 175 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 176 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 183 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 184 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 185 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 186 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 187 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 188 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 189 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 190 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 191 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 192 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 193 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 194 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.39 |
| Nodule | 0 |
| Rhizoplane | 4.14 |
| Rhizosphere | 83.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10038993 | 3300001979 | Bacteria | 1453 |
| 2 | JGI24739J22299_10003925 | 3300001989 | Bacteria | 5688 |
| 3 | JGI24739J22299_10023630 | 3300001989 | Bacteria | 2170 |
| 4 | JGI24737J22298_10003153 | 3300001990 | Bacteria | 5852 |
| 5 | JGI24737J22298_10038887 | 3300001990 | Bacteria | 1464 |
| 6 | JGI24738J21930_10004531 | 3300002075 | Bacteria | 3395 |
| 7 | JGI25151J46595_10024211 | 3300003187 | Bacteria | 2487 |
| 8 | JGI25153J46596_10000181 | 3300003215 | Bacteria | 62061 |
| 9 | Ga0055526_1012107 | 3300003771 | Bacteria | 3801 |
| 10 | Ga0055526_1051281 | 3300003771 | Bacteria | 939 |
| 11 | Ga0055537_1002131 | 3300003773 | Bacteria | 6919 |
| 12 | Ga0055540_1000755 | 3300003792 | Bacteria | 21947 |
| 13 | Ga0065165_1000705 | 3300005262 | Bacteria | 47513 |
| 14 | Ga0065707_10244621 | 3300005295 | Bacteria | 1144 |
| 15 | Ga0070658_10010469 | 3300005327 | Bacteria | 7440 |
| 16 | Ga0070676_10014219 | 3300005328 | Bacteria | 4373 |
| 17 | Ga0070690_100160816 | 3300005330 | Bacteria | 1539 |
| 18 | Ga0070670_100036739 | 3300005331 | Bacteria | 4214 |
| 19 | Ga0070670_100050075 | 3300005331 | Bacteria | 3590 |
| 20 | Ga0070670_100318867 | 3300005331 | Bacteria | 1361 |
| 21 | Ga0068869_100517528 | 3300005334 | Bacteria | 998 |
| 22 | Ga0070666_10014992 | 3300005335 | Bacteria | 4938 |
| 23 | Ga0068868_100017435 | 3300005338 | Bacteria | 5351 |
| 24 | Ga0068868_100025618 | 3300005338 | Bacteria | 4489 |
| 25 | Ga0070660_100059075 | 3300005339 | Bacteria | 2973 |
| 26 | Ga0070661_100098156 | 3300005344 | Bacteria | 2176 |
| 27 | Ga0070661_100155004 | 3300005344 | Bacteria | 1733 |
| 28 | Ga0070661_100170964 | 3300005344 | Bacteria | 1650 |
| 29 | Ga0070668_100029728 | 3300005347 | Bacteria | 4151 |
| 30 | Ga0070668_100050520 | 3300005347 | Bacteria | 3202 |
| 31 | Ga0070668_100138669 | 3300005347 | Bacteria | 1958 |
| 32 | Ga0070668_100406545 | 3300005347 | Bacteria | 1163 |
| 33 | Ga0070669_100002167 | 3300005353 | Bacteria | 14197 |
| 34 | Ga0070675_100067622 | 3300005354 | Bacteria | 2957 |
| 35 | Ga0070675_100259299 | 3300005354 | Unclassified | 1523 |
| 36 | Ga0070671_100022077 | 3300005355 | Bacteria | 5200 |
| 37 | Ga0070671_100036603 | 3300005355 | Bacteria | 4070 |
| 38 | Ga0070671_100295111 | 3300005355 | Bacteria | 1380 |
| 39 | Ga0070674_100134853 | 3300005356 | Bacteria | 1845 |
| 40 | Ga0070674_100163968 | 3300005356 | Bacteria | 1689 |
| 41 | Ga0070673_100003364 | 3300005364 | Bacteria | 9948 |
| 42 | Ga0070673_100048203 | 3300005364 | Bacteria | 3320 |
| 43 | Ga0070673_100097555 | 3300005364 | Bacteria | 2414 |
| 44 | Ga0070659_100008984 | 3300005366 | Bacteria | 7328 |
| 45 | Ga0070659_100030073 | 3300005366 | Bacteria | 4202 |
| 46 | Ga0070659_100030889 | 3300005366 | Bacteria | 4147 |
| 47 | Ga0070667_100055789 | 3300005367 | Bacteria | 3336 |
| 48 | Ga0070678_100007840 | 3300005456 | Bacteria | 6354 |
| 49 | Ga0070662_100018700 | 3300005457 | Bacteria | 4692 |
| 50 | Ga0068867_100018114 | 3300005459 | Bacteria | 5004 |
| 51 | Ga0068853_100001278 | 3300005539 | Bacteria | 18045 |
| 52 | Ga0068853_100006571 | 3300005539 | Bacteria | 9259 |
| 53 | Ga0070672_100008980 | 3300005543 | Bacteria | 6869 |
| 54 | Ga0070665_100007419 | 3300005548 | Bacteria | 11152 |
| 55 | Ga0070665_100046293 | 3300005548 | Bacteria | 4370 |
| 56 | Ga0070665_100345965 | 3300005548 | Bacteria | 1492 |
| 57 | Ga0068855_100457479 | 3300005563 | Bacteria | 1392 |
| 58 | Ga0070664_100011219 | 3300005564 | Bacteria | 7268 |
| 59 | Ga0070664_100073175 | 3300005564 | Bacteria | 2940 |
| 60 | Ga0070664_100141412 | 3300005564 | Bacteria | 2119 |
| 61 | Ga0068857_100005497 | 3300005577 | Bacteria | 10805 |
| 62 | Ga0068857_100005551 | 3300005577 | Bacteria | 10763 |
| 63 | Ga0068857_100105478 | 3300005577 | Bacteria | 2530 |
| 64 | Ga0068857_100227960 | 3300005577 | Bacteria | 1703 |
| 65 | Ga0068854_100010329 | 3300005578 | Bacteria | 6049 |
| 66 | Ga0068856_100094302 | 3300005614 | Bacteria | 2979 |
| 67 | Ga0068852_100001869 | 3300005616 | Bacteria | 14325 |
| 68 | Ga0068852_100045232 | 3300005616 | Bacteria | 3743 |
| 69 | Ga0068852_100047439 | 3300005616 | Bacteria | 3665 |
| 70 | Ga0068852_100254093 | 3300005616 | Bacteria | 1685 |
| 71 | Ga0068859_100237414 | 3300005617 | Unclassified | 1912 |
| 72 | Ga0068864_100014637 | 3300005618 | Bacteria | 6516 |
| 73 | Ga0068864_100074936 | 3300005618 | Bacteria | 2954 |
| 74 | Ga0068864_100408223 | 3300005618 | Bacteria | 1292 |
| 75 | Ga0068861_100055046 | 3300005719 | Bacteria | 3033 |
| 76 | Ga0068851_10020635 | 3300005834 | Bacteria | 3192 |
| 77 | Ga0068863_100007329 | 3300005841 | Bacteria | 10799 |
| 78 | Ga0068863_100046291 | 3300005841 | Bacteria | 4128 |
| 79 | Ga0068858_100004380 | 3300005842 | Bacteria | 13853 |
| 80 | Ga0068858_100024625 | 3300005842 | Bacteria | 5608 |
| 81 | Ga0068860_100077040 | 3300005843 | Bacteria | 3171 |
| 82 | Ga0068862_100602136 | 3300005844 | Bacteria | 1055 |
| 83 | Ga0097621_100097575 | 3300006237 | Bacteria | 2468 |
| 84 | Ga0097621_100131548 | 3300006237 | Bacteria | 2131 |
| 85 | Ga0097621_100309398 | 3300006237 | Bacteria | 1397 |
| 86 | Ga0068871_100019247 | 3300006358 | Bacteria | 5210 |
| 87 | Ga0068871_100601332 | 3300006358 | Bacteria | 1000 |
| 88 | Ga0068865_100023582 | 3300006881 | Bacteria | 4030 |
| 89 | Ga0097620_100237429 | 3300006931 | Unclassified | 1912 |
| 90 | Ga0105240_10181548 | 3300009093 | Bacteria | 2483 |
| 91 | Ga0105245_10023129 | 3300009098 | Bacteria | 5454 |
| 92 | Ga0105243_10170889 | 3300009148 | Bacteria | 1882 |
| 93 | Ga0105242_10462052 | 3300009176 | Bacteria | 1199 |
| 94 | Ga0105248_10002586 | 3300009177 | Bacteria | 20122 |
| 95 | Ga0105248_10077111 | 3300009177 | Bacteria | 3746 |
| 96 | Ga0105237_10057887 | 3300009545 | Bacteria | 3878 |
| 97 | Ga0105238_10117593 | 3300009551 | Bacteria | 2638 |
| 98 | Ga0105249_10073209 | 3300009553 | Bacteria | 3169 |
| 99 | Ga0105239_10236298 | 3300010375 | Bacteria | 2051 |
| 100 | Ga0157373_10106760 | 3300013100 | Bacteria | 1969 |
| 101 | Ga0157373_10115656 | 3300013100 | Bacteria | 1885 |
| 102 | Ga0157371_10003353 | 3300013102 | Bacteria | 14588 |
| 103 | Ga0157370_10195449 | 3300013104 | Bacteria | 1877 |
| 104 | Ga0157374_10004943 | 3300013296 | Bacteria | 11188 |
| 105 | Ga0163162_10022126 | 3300013306 | Bacteria | 6266 |
| 106 | Ga0157372_10104952 | 3300013307 | Bacteria | 3231 |
| 107 | Ga0157372_10284963 | 3300013307 | Bacteria | 1921 |
| 108 | Ga0157375_10001267 | 3300013308 | Bacteria | 21875 |
| 109 | Ga0157375_10037411 | 3300013308 | Bacteria | 4650 |
| 110 | Ga0163163_10030080 | 3300014325 | Bacteria | 5228 |
| 111 | Ga0163163_10103516 | 3300014325 | Bacteria | 2871 |
| 112 | Ga0157376_11529016 | 3300014969 | Bacteria | 701 |
| 113 | Ga0213876_10302712 | 3300021384 | Bacteria | 850 |
| 114 | Ga0207425_1000019 | 3300025245 | Bacteria | 399942 |
| 115 | Ga0209129_1000695 | 3300025258 | Bacteria | 22046 |
| 116 | Ga0209233_1044078 | 3300025261 | Bacteria | 947 |
| 117 | Ga0209565_1000186 | 3300025263 | Bacteria | 76097 |
| 118 | Ga0209673_1023291 | 3300025273 | Bacteria | 2113 |
| 119 | Ga0209025_1000472 | 3300025294 | Bacteria | 78081 |
| 120 | Ga0209564_1000678 | 3300025295 | Bacteria | 50329 |
| 121 | Ga0209564_1052760 | 3300025295 | Bacteria | 975 |
| 122 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 123 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 124 | Ga0209050_1000108 | 3300025298 | Bacteria | 222534 |
| 125 | Ga0209050_1013329 | 3300025298 | Bacteria | 3658 |
| 126 | Ga0209051_1000705 | 3300025303 | Bacteria | 36568 |
| 127 | Ga0209257_1015147 | 3300025304 | Bacteria | 3240 |
| 128 | Ga0209257_1035172 | 3300025304 | Bacteria | 1553 |
| 129 | Ga0207697_10099349 | 3300025315 | Bacteria | 1239 |
| 130 | Ga0207682_10262866 | 3300025893 | Bacteria | 805 |
| 131 | Ga0207688_10158724 | 3300025901 | Bacteria | 1339 |
| 132 | Ga0207680_10053120 | 3300025903 | Bacteria | 2431 |
| 133 | Ga0207647_10000107 | 3300025904 | Bacteria | 63716 |
| 134 | Ga0207647_10006139 | 3300025904 | Bacteria | 8752 |
| 135 | Ga0207647_10123308 | 3300025904 | Bacteria | 1527 |
| 136 | Ga0207645_10007591 | 3300025907 | Bacteria | 7641 |
| 137 | Ga0207645_10134584 | 3300025907 | Bacteria | 1609 |
| 138 | Ga0207643_10029938 | 3300025908 | Bacteria | 3028 |
| 139 | Ga0207705_10005743 | 3300025909 | Bacteria | 9260 |
| 140 | Ga0207705_10011254 | 3300025909 | Bacteria | 6485 |
| 141 | Ga0207695_10146609 | 3300025913 | Bacteria | 2304 |
| 142 | Ga0207671_10087972 | 3300025914 | Bacteria | 2336 |
| 143 | Ga0207657_10043922 | 3300025919 | Bacteria | 3933 |
| 144 | Ga0207649_10052909 | 3300025920 | Bacteria | 2521 |
| 145 | Ga0207649_10142703 | 3300025920 | Bacteria | 1641 |
| 146 | Ga0207681_10197518 | 3300025923 | Bacteria | 1543 |
| 147 | Ga0207681_10354285 | 3300025923 | Bacteria | 1175 |
| 148 | Ga0207650_10043115 | 3300025925 | Bacteria | 3311 |
| 149 | Ga0207650_10069156 | 3300025925 | Bacteria | 2653 |
| 150 | Ga0207650_10185472 | 3300025925 | Bacteria | 1660 |
| 151 | Ga0207659_10027444 | 3300025926 | Bacteria | 3855 |
| 152 | Ga0207659_10303691 | 3300025926 | Bacteria | 1312 |
| 153 | Ga0207659_10766607 | 3300025926 | Bacteria | 828 |
| 154 | Ga0207664_10177875 | 3300025929 | Bacteria | 1825 |
| 155 | Ga0207644_10006281 | 3300025931 | Bacteria | 7741 |
| 156 | Ga0207644_10175059 | 3300025931 | Bacteria | 1678 |
| 157 | Ga0207644_10381429 | 3300025931 | Bacteria | 1149 |
| 158 | Ga0207690_10010956 | 3300025932 | Bacteria | 5405 |
| 159 | Ga0207690_10013334 | 3300025932 | Bacteria | 4938 |
| 160 | Ga0207690_10079902 | 3300025932 | Bacteria | 2280 |
| 161 | Ga0207706_10000198 | 3300025933 | Bacteria | 66746 |
| 162 | Ga0207706_10002200 | 3300025933 | Bacteria | 19004 |
| 163 | Ga0207706_10011023 | 3300025933 | Bacteria | 8241 |
| 164 | Ga0207706_10232353 | 3300025933 | Bacteria | 1613 |
| 165 | Ga0207669_10035151 | 3300025937 | Bacteria | 2848 |
| 166 | Ga0207669_10059090 | 3300025937 | Bacteria | 2344 |
| 167 | Ga0207704_10249132 | 3300025938 | Bacteria | 1332 |
| 168 | Ga0207691_10010364 | 3300025940 | Bacteria | 8940 |
| 169 | Ga0207691_10015353 | 3300025940 | Bacteria | 7285 |
| 170 | Ga0207711_10006417 | 3300025941 | Bacteria | 9909 |
| 171 | Ga0207711_10119133 | 3300025941 | Bacteria | 2355 |
| 172 | Ga0207689_10002883 | 3300025942 | Bacteria | 15860 |
| 173 | Ga0207679_10102316 | 3300025945 | Bacteria | 2243 |
| 174 | Ga0207679_10220813 | 3300025945 | Bacteria | 1594 |
| 175 | Ga0207679_10244842 | 3300025945 | Bacteria | 1521 |
| 176 | Ga0207651_10009059 | 3300025960 | Bacteria | 5418 |
| 177 | Ga0207651_10209167 | 3300025960 | Bacteria | 1569 |
| 178 | Ga0207651_10319129 | 3300025960 | Bacteria | 1298 |
| 179 | Ga0207712_10043862 | 3300025961 | Bacteria | 3087 |
| 180 | Ga0207668_10023529 | 3300025972 | Bacteria | 3962 |
| 181 | Ga0207668_10254744 | 3300025972 | Bacteria | 1427 |
| 182 | Ga0207668_10490511 | 3300025972 | Bacteria | 1055 |
| 183 | Ga0207640_10012616 | 3300025981 | Bacteria | 4820 |
| 184 | Ga0207703_10016039 | 3300026035 | Bacteria | 5843 |
| 185 | Ga0207639_10010010 | 3300026041 | Bacteria | 6554 |
| 186 | Ga0207639_10025813 | 3300026041 | Bacteria | 4263 |
| 187 | Ga0207678_10158444 | 3300026067 | Bacteria | 1933 |
| 188 | Ga0207702_10080795 | 3300026078 | Bacteria | 2822 |
| 189 | Ga0207641_10011991 | 3300026088 | Bacteria | 7111 |
| 190 | Ga0207641_10012216 | 3300026088 | Bacteria | 7048 |
| 191 | Ga0207641_10068238 | 3300026088 | Bacteria | 3048 |
| 192 | Ga0207648_10002604 | 3300026089 | Bacteria | 19339 |
| 193 | Ga0207648_10170338 | 3300026089 | Bacteria | 1924 |
| 194 | Ga0207676_10014033 | 3300026095 | Bacteria | 5753 |
| 195 | Ga0207676_10029119 | 3300026095 | Bacteria | 4131 |
| 196 | Ga0207676_10210887 | 3300026095 | Bacteria | 1723 |
| 197 | Ga0207674_10000057 | 3300026116 | Bacteria | 113117 |
| 198 | Ga0207674_10026707 | 3300026116 | Bacteria | 6125 |
| 199 | Ga0207674_10051120 | 3300026116 | Bacteria | 4218 |
| 200 | Ga0207674_10094034 | 3300026116 | Bacteria | 2985 |
| 201 | Ga0207675_100351567 | 3300026118 | Bacteria | 1444 |
| 202 | Ga0207675_100572675 | 3300026118 | Bacteria | 1130 |
| 203 | Ga0207683_10004521 | 3300026121 | Bacteria | 11992 |
| 204 | Ga0207698_10056805 | 3300026142 | Bacteria | 3023 |
| 205 | Ga0207698_10386509 | 3300026142 | Bacteria | 1333 |
| 206 | Ga0268266_10000019 | 3300028379 | Bacteria | 556465 |
| 207 | Ga0268266_10023527 | 3300028379 | Bacteria | 5244 |
| 208 | Ga0268266_10334275 | 3300028379 | Unclassified | 1420 |
| 209 | Ga0307517_10008439 | 3300028786 | Bacteria | 14781 |
| 210 | Ga0307517_10052057 | 3300028786 | Bacteria | 4113 |
| 211 | Ga0307408_100347036 | 3300031548 | Bacteria | 1258 |
| 212 | Ga0307408_100478180 | 3300031548 | Bacteria | 1086 |
| 213 | Ga0307408_101105986 | 3300031548 | Bacteria | 735 |
| 214 | Ga0307405_10248178 | 3300031731 | Bacteria | 1323 |
| 215 | Ga0307413_10096783 | 3300031824 | Bacteria | 1939 |
| 216 | Ga0307413_10217840 | 3300031824 | Bacteria | 1392 |
| 217 | Ga0307413_10278649 | 3300031824 | Bacteria | 1256 |
| 218 | Ga0307413_10304991 | 3300031824 | Bacteria | 1209 |
| 219 | Ga0307413_10451254 | 3300031824 | Bacteria | 1021 |
| 220 | Ga0307410_10001826 | 3300031852 | Bacteria | 9892 |
| 221 | Ga0307410_10036830 | 3300031852 | Bacteria | 3189 |
| 222 | Ga0307410_10054106 | 3300031852 | Plasmid | 2719 |
| 223 | Ga0307410_10357940 | 3300031852 | Bacteria | 1168 |
| 224 | Ga0307406_10110268 | 3300031901 | Bacteria | 1893 |
| 225 | Ga0307406_10112528 | 3300031901 | Unclassified | 1877 |
| 226 | Ga0307406_10161666 | 3300031901 | Bacteria | 1610 |
| 227 | Ga0307407_10405735 | 3300031903 | Bacteria | 979 |
| 228 | Ga0307412_10011811 | 3300031911 | Bacteria | 5069 |
| 229 | Ga0307412_10054528 | 3300031911 | Bacteria | 2654 |
| 230 | Ga0307412_10152847 | 3300031911 | Bacteria | 1705 |
| 231 | Ga0307412_10201040 | 3300031911 | Bacteria | 1513 |
| 232 | Ga0307412_10202834 | 3300031911 | Unclassified | 1507 |
| 233 | Ga0307409_100003131 | 3300031995 | Bacteria | 8885 |
| 234 | Ga0307409_100261955 | 3300031995 | Bacteria | 1587 |
| 235 | Ga0307409_100404597 | 3300031995 | Bacteria | 1305 |
| 236 | Ga0307409_100411707 | 3300031995 | Bacteria | 1294 |
| 237 | Ga0307409_100498525 | 3300031995 | Bacteria | 1185 |
| 238 | Ga0307416_100029565 | 3300032002 | Bacteria | 4096 |
| 239 | Ga0307416_100114259 | 3300032002 | Bacteria | 2388 |
| 240 | Ga0307416_100589431 | 3300032002 | Bacteria | 1190 |
| 241 | Ga0307416_100621967 | 3300032002 | Bacteria | 1162 |
| 242 | Ga0307414_10009782 | 3300032004 | Bacteria | 5526 |
| 243 | Ga0307414_10060344 | 3300032004 | Bacteria | 2681 |
| 244 | Ga0307414_10422157 | 3300032004 | Bacteria | 1163 |
| 245 | Ga0307414_10458809 | 3300032004 | Bacteria | 1119 |
| 246 | Ga0307414_10512580 | 3300032004 | Bacteria | 1063 |
| 247 | Ga0307414_10515592 | 3300032004 | Bacteria | 1060 |
| 248 | Ga0307414_10638915 | 3300032004 | Bacteria | 958 |
| 249 | Ga0307414_10695351 | 3300032004 | Bacteria | 920 |
| 250 | Ga0307411_10003050 | 3300032005 | Bacteria | 7652 |
| 251 | Ga0307411_10073806 | 3300032005 | Bacteria | 2322 |
| 252 | Ga0307411_10272801 | 3300032005 | Bacteria | 1342 |
| 253 | Ga0307411_10299760 | 3300032005 | Bacteria | 1288 |
| 254 | Ga0307411_10564294 | 3300032005 | Bacteria | 973 |
| 255 | Ga0307411_10620273 | 3300032005 | Bacteria | 932 |
| 256 | Ga0307411_10832181 | 3300032005 | Bacteria | 815 |
| 257 | Ga0307415_100049736 | 3300032126 | Bacteria | 2836 |
| 258 | Ga0307415_100168433 | 3300032126 | Bacteria | 1706 |
| 259 | Ga0307415_100168560 | 3300032126 | Unclassified | 1705 |
| 260 | Ga0307415_100190404 | 3300032126 | Bacteria | 1618 |
| 261 | Ga0307415_100497197 | 3300032126 | Bacteria | 1065 |
| 262 | Ga0395899_0000582 | 3300037312 | Bacteria | 38446 |
| 263 | Ga0395899_0000738 | 3300037312 | Bacteria | 32643 |
| 264 | Ga0395899_0133532 | 3300037312 | Bacteria | 1771 |
| 265 | Ga0395899_0170742 | 3300037312 | Bacteria | 1531 |
| 266 | Ga0395899_0194553 | 3300037312 | Bacteria | 1417 |
| 267 | Ga0395899_0353276 | 3300037312 | Bacteria | 982 |
| 268 | Ga0395900_0001617 | 3300037418 | Bacteria | 26505 |
| 269 | Ga0395900_0002003 | 3300037418 | Bacteria | 22989 |
| 270 | Ga0395900_0143849 | 3300037418 | Bacteria | 2440 |
| 271 | Ga0395900_0238662 | 3300037418 | Bacteria | 1824 |
| 272 | Ga0395900_0281500 | 3300037418 | Archaea | 1655 |
| 273 | Ga0395900_0337020 | 3300037418 | Bacteria | 1484 |
| 274 | Ga0395900_0339359 | 3300037418 | Bacteria | 1478 |
| 275 | Ga0395900_0591750 | 3300037418 | Bacteria | 1050 |
| 276 | Ga0395900_0807124 | 3300037418 | Bacteria | 866 |
| 277 | Ga0395898_0001601 | 3300037466 | Bacteria | 30889 |
| 278 | Ga0395898_0077636 | 3300037466 | Bacteria | 3206 |
| 279 | Ga0395898_0194934 | 3300037466 | Bacteria | 1935 |
| 280 | Ga0395898_0435295 | 3300037466 | Bacteria | 1249 |
| 281 | Ga0395905_0002381 | 3300037471 | Bacteria | 20935 |
| 282 | Ga0395905_0003631 | 3300037471 | Bacteria | 16392 |
| 283 | Ga0395905_0004005 | 3300037471 | Bacteria | 15480 |
| 284 | Ga0395905_0022309 | 3300037471 | Bacteria | 5989 |
| 285 | Ga0395905_0045455 | 3300037471 | Bacteria | 4118 |
| 286 | Ga0395905_0051963 | 3300037471 | Plasmid | 3838 |
| 287 | Ga0395905_0148238 | 3300037471 | Bacteria | 2207 |
| 288 | Ga0395905_0156783 | 3300037471 | Bacteria | 2141 |
| 289 | Ga0395905_0177366 | 3300037471 | Bacteria | 2000 |
| 290 | Ga0395905_0221277 | 3300037471 | Bacteria | 1771 |
| 291 | Ga0395905_0265888 | 3300037471 | Bacteria | 1601 |
| 292 | Ga0395905_0840685 | 3300037471 | Bacteria | 821 |
| 293 | Ga0395905_1068986 | 3300037471 | Bacteria | 710 |
| 294 | Ga0395901_0000938 | 3300038443 | Bacteria | 31711 |
| 295 | Ga0395901_0001383 | 3300038443 | Bacteria | 25376 |
| 296 | Ga0395901_0002443 | 3300038443 | Bacteria | 18837 |
| 297 | Ga0395901_0006322 | 3300038443 | Bacteria | 11995 |
| 298 | Ga0395901_0219697 | 3300038443 | Bacteria | 1986 |
| 299 | Ga0395901_0261599 | 3300038443 | Bacteria | 1801 |
| 300 | Ga0436365_1716132 | 3300039437 | Bacteria | 1524 |
| 301 | Ga0436363_1288012 | 3300039450 | Bacteria | 1479 |
| 302 | Ga0436362_0517774 | 3300039453 | Bacteria | 777 |
| 303 | Ga0466965_0126427 | 3300044683 | Bacteria | 1323 |
| 304 | Ga0453684_0779654 | 3300044712 | Bacteria | 1033 |
| 305 | Ga0495650_0000096 | 3300046471 | Bacteria | 217464 |
| 306 | Ga0495639_0251212 | 3300046475 | Bacteria | 874 |
| 307 | Ga0495583_0000240 | 3300046506 | Bacteria | 90919 |
| 308 | Ga0495583_0021220 | 3300046506 | Bacteria | 3346 |
| 309 | Ga0495616_0096271 | 3300046513 | Bacteria | 1394 |
| 310 | Ga0495620_0149701 | 3300046515 | Bacteria | 910 |
| 311 | Ga0495643_0008560 | 3300046522 | Bacteria | 6462 |
| 312 | Ga0495648_0137028 | 3300046524 | Bacteria | 1293 |
| 313 | Ga0495587_0031901 | 3300046536 | Bacteria | 3188 |
| 314 | Ga0495622_0002630 | 3300046557 | Bacteria | 8645 |
| 315 | Ga0495622_0003975 | 3300046557 | Bacteria | 6902 |
| 316 | Ga0495668_0017842 | 3300046616 | Bacteria | 4112 |
| 317 | Ga0495668_0178781 | 3300046616 | Bacteria | 1162 |
| 318 | Ga0495611_0183952 | 3300046648 | Bacteria | 976 |
| 319 | Ga0495625_0008176 | 3300046660 | Bacteria | 8959 |
| 320 | Ga0495669_0060666 | 3300046684 | Bacteria | 1710 |
| 321 | Ga0495600_0002961 | 3300046809 | Bacteria | 9903 |
| 322 | Ga0495687_000171 | 3300047443 | Bacteria | 95996 |
| 323 | Ga0495677_0003206 | 3300047445 | Bacteria | 6376 |
| 324 | Ga0495686_0000262 | 3300047472 | Bacteria | 94462 |
| 325 | Ga0496100_0077261 | 3300048903 | Bacteria | 2238 |
| 326 | Ga0496101_0177527 | 3300048904 | Unclassified | 1639 |
| 327 | Ga0496102_0674560 | 3300048905 | Bacteria | 957 |
| 328 | Ga0496108_0006669 | 3300048911 | Bacteria | 9347 |
| 329 | Ga0496108_0063477 | 3300048911 | Bacteria | 3110 |
| 330 | Ga0496109_0042084 | 3300048912 | Bacteria | 4137 |
| 331 | Ga0496109_0135970 | 3300048912 | Bacteria | 2296 |
| 332 | Ga0496109_0308054 | 3300048912 | Bacteria | 1494 |
| 333 | Ga0496109_1407942 | 3300048912 | Bacteria | 633 |
| 334 | Ga0496110_0077665 | 3300048913 | Bacteria | 2954 |
| 335 | Ga0496111_0012051 | 3300048914 | Bacteria | 5845 |
| 336 | Ga0496111_0313875 | 3300048914 | Bacteria | 1161 |
| 337 | Ga0496112_0052793 | 3300048915 | Bacteria | 3990 |
| 338 | Ga0496114_0904534 | 3300048917 | Bacteria | 764 |
| 339 | Ga0496115_0005539 | 3300048918 | Bacteria | 9188 |
| 340 | Ga0496121_0000147 | 3300048924 | Bacteria | 154342 |
| 341 | Ga0496122_0004742 | 3300048925 | Bacteria | 16663 |
| 342 | Ga0496123_0000643 | 3300048926 | Bacteria | 58206 |
| 343 | Ga0496123_0000691 | 3300048926 | Bacteria | 55613 |
| 344 | Ga0496124_0033592 | 3300048927 | Bacteria | 4511 |
| 345 | Ga0501032_0503755 | 3300049569 | Bacteria | 774 |
| 346 | Ga0501034_0421488 | 3300049571 | Bacteria | 1256 |
| 347 | Ga0501067_0528188 | 3300049583 | Bacteria | 660 |
| 348 | Ga0501069_0282784 | 3300049585 | Bacteria | 971 |
| 349 | Ga0501241_006677 | 3300049758 | Bacteria | 2119 |
| 350 | Ga0501241_013940 | 3300049758 | Bacteria | 1460 |
| 351 | nmdc:mga07m45_70021_c1 | 3300050496 | Unclassified | 1995 |
| 352 | Ga0500643_000531 | 3300053087 | Bacteria | 26779 |
| 353 | Ga0500641_0048517 | 3300053096 | Bacteria | 1739 |
| 354 | Ga0500556_0000055 | 3300053104 | Bacteria | 115798 |
| 355 | Ga0500595_009088 | 3300053119 | Bacteria | 4030 |
| 356 | Ga0500626_133441 | 3300053128 | Bacteria | 1050 |
| 357 | Ga0500642_0000008 | 3300053130 | Bacteria | 293258 |
| 358 | Ga0500652_124947 | 3300053131 | Bacteria | 1075 |
| 359 | Ga0500559_0116192 | 3300053136 | Bacteria | 1242 |
| 360 | Ga0500577_0190588 | 3300053142 | Bacteria | 882 |
| 361 | Ga0500619_002471 | 3300053154 | Bacteria | 3568 |
| 362 | Ga0500645_001127 | 3300053730 | Bacteria | 14560 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049583 | Ga0501067_0528188 | Ga0501067_0528188_99_647 | 182 |
| 2 | 3300025907 | Ga0207645_10134584 | Ga0207645_101345842 | 195 |
| 3 | 3300014969 | Ga0157376_11529016 | Ga0157376_115290161 | 196 |
| 4 | 3300031911 | Ga0307412_10011811 | Ga0307412_100118114 | 196 |
| 5 | 3300032002 | Ga0307416_100029565 | Ga0307416_1000295652 | 196 |
| 6 | 3300032005 | Ga0307411_10272801 | Ga0307411_102728012 | 196 |
| 7 | 3300005344 | Ga0070661_100155004 | Ga0070661_1001550041 | 200 |
| 8 | 3300005577 | Ga0068857_100005551 | Ga0068857_1000055512 | 200 |
| 9 | 3300025261 | Ga0209233_1044078 | Ga0209233_10440781 | 200 |
| 10 | 3300026116 | Ga0207674_10051120 | Ga0207674_100511202 | 200 |
| 11 | 3300028786 | Ga0307517_10008439 | Ga0307517_100084393 | 200 |
| 12 | 3300028786 | Ga0307517_10052057 | Ga0307517_100520572 | 200 |
| 13 | 3300038443 | Ga0395901_0261599 | Ga0395901_0261599_1086_1688 | 200 |
| 14 | 3300046471 | Ga0495650_0000096 | Ga0495650_0000096_122668_123270 | 200 |
| 15 | 3300046475 | Ga0495639_0251212 | Ga0495639_0251212_174_776 | 200 |
| 16 | 3300046506 | Ga0495583_0000240 | Ga0495583_0000240_75654_76256 | 200 |
| 17 | 3300046506 | Ga0495583_0021220 | Ga0495583_0021220_778_1380 | 200 |
| 18 | 3300046513 | Ga0495616_0096271 | Ga0495616_0096271_94_696 | 200 |
| 19 | 3300046515 | Ga0495620_0149701 | Ga0495620_0149701_270_872 | 200 |
| 20 | 3300046522 | Ga0495643_0008560 | Ga0495643_0008560_5286_5888 | 200 |
| 21 | 3300046524 | Ga0495648_0137028 | Ga0495648_0137028_374_976 | 200 |
| 22 | 3300046536 | Ga0495587_0031901 | Ga0495587_0031901_2047_2649 | 200 |
| 23 | 3300046557 | Ga0495622_0002630 | Ga0495622_0002630_5709_6311 | 200 |
| 24 | 3300046557 | Ga0495622_0003975 | Ga0495622_0003975_3032_3634 | 200 |
| 25 | 3300046616 | Ga0495668_0178781 | Ga0495668_0178781_470_1072 | 200 |
| 26 | 3300046648 | Ga0495611_0183952 | Ga0495611_0183952_151_753 | 200 |
| 27 | 3300046660 | Ga0495625_0008176 | Ga0495625_0008176_3230_3832 | 200 |
| 28 | 3300046809 | Ga0495600_0002961 | Ga0495600_0002961_5269_5871 | 200 |
| 29 | 3300047443 | Ga0495687_000171 | Ga0495687_000171_73020_73622 | 200 |
| 30 | 3300047445 | Ga0495677_0003206 | Ga0495677_0003206_1409_2011 | 200 |
| 31 | 3300047472 | Ga0495686_0000262 | Ga0495686_0000262_30894_31496 | 200 |
| 32 | 3300048926 | Ga0496123_0000691 | Ga0496123_0000691_39827_40429 | 200 |
| 33 | 3300049758 | Ga0501241_013940 | Ga0501241_013940_18_620 | 200 |
| 34 | 3300050496 | nmdc:mga07m45_70021_c1 | nmdc:mga07m45_70021_c1_869_1471 | 200 |
| 35 | 3300053087 | Ga0500643_000531 | Ga0500643_000531_15516_16118 | 200 |
| 36 | 3300053104 | Ga0500556_0000055 | Ga0500556_0000055_17571_18173 | 200 |
| 37 | 3300053119 | Ga0500595_009088 | Ga0500595_009088_2419_3021 | 200 |
| 38 | 3300053130 | Ga0500642_0000008 | Ga0500642_0000008_193420_194022 | 200 |
| 39 | 3300053154 | Ga0500619_002471 | Ga0500619_002471_1058_1660 | 200 |
| 40 | 3300053730 | Ga0500645_001127 | Ga0500645_001127_11897_12499 | 200 |
| 41 | 3300005327 | Ga0070658_10010469 | Ga0070658_100104694 | 201 |
| 42 | 3300005344 | Ga0070661_100170964 | Ga0070661_1001709641 | 201 |
| 43 | 3300005355 | Ga0070671_100022077 | Ga0070671_1000220773 | 201 |
| 44 | 3300005364 | Ga0070673_100048203 | Ga0070673_1000482034 | 201 |
| 45 | 3300005614 | Ga0068856_100094302 | Ga0068856_1000943023 | 201 |
| 46 | 3300005616 | Ga0068852_100047439 | Ga0068852_1000474393 | 201 |
| 47 | 3300005834 | Ga0068851_10020635 | Ga0068851_100206351 | 201 |
| 48 | 3300006237 | Ga0097621_100309398 | Ga0097621_1003093981 | 201 |
| 49 | 3300006358 | Ga0068871_100601332 | Ga0068871_1006013321 | 201 |
| 50 | 3300009177 | Ga0105248_10077111 | Ga0105248_100771113 | 201 |
| 51 | 3300025909 | Ga0207705_10011254 | Ga0207705_100112543 | 201 |
| 52 | 3300025920 | Ga0207649_10142703 | Ga0207649_101427033 | 201 |
| 53 | 3300025931 | Ga0207644_10381429 | Ga0207644_103814292 | 201 |
| 54 | 3300025941 | Ga0207711_10119133 | Ga0207711_101191332 | 201 |
| 55 | 3300025960 | Ga0207651_10009059 | Ga0207651_100090592 | 201 |
| 56 | 3300026078 | Ga0207702_10080795 | Ga0207702_100807952 | 201 |
| 57 | 3300026142 | Ga0207698_10056805 | Ga0207698_100568052 | 201 |
| 58 | 3300037471 | Ga0395905_0003631 | Ga0395905_0003631_9876_10481 | 201 |
| 59 | 3300037471 | Ga0395905_0177366 | Ga0395905_0177366_792_1397 | 201 |
| 60 | 3300037471 | Ga0395905_1068986 | Ga0395905_1068986_29_634 | 201 |
| 61 | 3300048911 | Ga0496108_0063477 | Ga0496108_0063477_1513_2118 | 201 |
| 62 | 3300048912 | Ga0496109_0135970 | Ga0496109_0135970_1368_1973 | 201 |
| 63 | 3300048913 | Ga0496110_0077665 | Ga0496110_0077665_276_881 | 201 |
| 64 | 3300048914 | Ga0496111_0012051 | Ga0496111_0012051_754_1359 | 201 |
| 65 | 3300032004 | Ga0307414_10695351 | Ga0307414_106953511 | 202 |
| 66 | 3300053096 | Ga0500641_0048517 | Ga0500641_0048517_54_662 | 202 |
| 67 | 3300053142 | Ga0500577_0190588 | Ga0500577_0190588_111_719 | 202 |
| 68 | 3300001979 | JGI24740J21852_10038993 | JGI24740J21852_100389933 | 203 |
| 69 | 3300001989 | JGI24739J22299_10003925 | JGI24739J22299_100039254 | 203 |
| 70 | 3300001989 | JGI24739J22299_10023630 | JGI24739J22299_100236303 | 203 |
| 71 | 3300001990 | JGI24737J22298_10003153 | JGI24737J22298_100031535 | 203 |
| 72 | 3300001990 | JGI24737J22298_10038887 | JGI24737J22298_100388872 | 203 |
| 73 | 3300002075 | JGI24738J21930_10004531 | JGI24738J21930_100045314 | 203 |
| 74 | 3300003187 | JGI25151J46595_10024211 | JGI25151J46595_100242112 | 203 |
| 75 | 3300003215 | JGI25153J46596_10000181 | JGI25153J46596_1000018136 | 203 |
| 76 | 3300003771 | Ga0055526_1012107 | Ga0055526_10121071 | 203 |
| 77 | 3300003771 | Ga0055526_1051281 | Ga0055526_10512811 | 203 |
| 78 | 3300003773 | Ga0055537_1002131 | Ga0055537_10021312 | 203 |
| 79 | 3300003792 | Ga0055540_1000755 | Ga0055540_100075515 | 203 |
| 80 | 3300005262 | Ga0065165_1000705 | Ga0065165_100070529 | 203 |
| 81 | 3300005295 | Ga0065707_10244621 | Ga0065707_102446212 | 203 |
| 82 | 3300005328 | Ga0070676_10014219 | Ga0070676_100142192 | 203 |
| 83 | 3300005330 | Ga0070690_100160816 | Ga0070690_1001608162 | 203 |
| 84 | 3300005331 | Ga0070670_100036739 | Ga0070670_1000367392 | 203 |
| 85 | 3300005331 | Ga0070670_100050075 | Ga0070670_1000500754 | 203 |
| 86 | 3300005331 | Ga0070670_100318867 | Ga0070670_1003188671 | 203 |
| 87 | 3300005334 | Ga0068869_100517528 | Ga0068869_1005175281 | 203 |
| 88 | 3300005335 | Ga0070666_10014992 | Ga0070666_100149924 | 203 |
| 89 | 3300005338 | Ga0068868_100017435 | Ga0068868_1000174353 | 203 |
| 90 | 3300005338 | Ga0068868_100025618 | Ga0068868_1000256184 | 203 |
| 91 | 3300005339 | Ga0070660_100059075 | Ga0070660_1000590752 | 203 |
| 92 | 3300005344 | Ga0070661_100098156 | Ga0070661_1000981562 | 203 |
| 93 | 3300005347 | Ga0070668_100029728 | Ga0070668_1000297284 | 203 |
| 94 | 3300005347 | Ga0070668_100050520 | Ga0070668_1000505202 | 203 |
| 95 | 3300005347 | Ga0070668_100138669 | Ga0070668_1001386692 | 203 |
| 96 | 3300005347 | Ga0070668_100406545 | Ga0070668_1004065452 | 203 |
| 97 | 3300005353 | Ga0070669_100002167 | Ga0070669_1000021673 | 203 |
| 98 | 3300005354 | Ga0070675_100067622 | Ga0070675_1000676224 | 203 |
| 99 | 3300005354 | Ga0070675_100259299 | Ga0070675_1002592992 | 203 |
| 100 | 3300005355 | Ga0070671_100036603 | Ga0070671_1000366032 | 203 |
| 101 | 3300005355 | Ga0070671_100295111 | Ga0070671_1002951112 | 203 |
| 102 | 3300005356 | Ga0070674_100134853 | Ga0070674_1001348533 | 203 |
| 103 | 3300005356 | Ga0070674_100163968 | Ga0070674_1001639682 | 203 |
| 104 | 3300005364 | Ga0070673_100003364 | Ga0070673_1000033645 | 203 |
| 105 | 3300005364 | Ga0070673_100097555 | Ga0070673_1000975553 | 203 |
| 106 | 3300005366 | Ga0070659_100008984 | Ga0070659_1000089844 | 203 |
| 107 | 3300005366 | Ga0070659_100030073 | Ga0070659_1000300732 | 203 |
| 108 | 3300005366 | Ga0070659_100030889 | Ga0070659_1000308892 | 203 |
| 109 | 3300005367 | Ga0070667_100055789 | Ga0070667_1000557891 | 203 |
| 110 | 3300005456 | Ga0070678_100007840 | Ga0070678_1000078405 | 203 |
| 111 | 3300005457 | Ga0070662_100018700 | Ga0070662_1000187001 | 203 |
| 112 | 3300005459 | Ga0068867_100018114 | Ga0068867_1000181142 | 203 |
| 113 | 3300005539 | Ga0068853_100001278 | Ga0068853_1000012788 | 203 |
| 114 | 3300005539 | Ga0068853_100006571 | Ga0068853_1000065718 | 203 |
| 115 | 3300005543 | Ga0070672_100008980 | Ga0070672_1000089803 | 203 |
| 116 | 3300005548 | Ga0070665_100007419 | Ga0070665_1000074194 | 203 |
| 117 | 3300005548 | Ga0070665_100046293 | Ga0070665_1000462932 | 203 |
| 118 | 3300005548 | Ga0070665_100345965 | Ga0070665_1003459653 | 203 |
| 119 | 3300005563 | Ga0068855_100457479 | Ga0068855_1004574792 | 203 |
| 120 | 3300005564 | Ga0070664_100011219 | Ga0070664_1000112194 | 203 |
| 121 | 3300005564 | Ga0070664_100073175 | Ga0070664_1000731752 | 203 |
| 122 | 3300005564 | Ga0070664_100141412 | Ga0070664_1001414121 | 203 |
| 123 | 3300005577 | Ga0068857_100005497 | Ga0068857_10000549710 | 203 |
| 124 | 3300005577 | Ga0068857_100105478 | Ga0068857_1001054782 | 203 |
| 125 | 3300005577 | Ga0068857_100227960 | Ga0068857_1002279602 | 203 |
| 126 | 3300005578 | Ga0068854_100010329 | Ga0068854_1000103295 | 203 |
| 127 | 3300005616 | Ga0068852_100001869 | Ga0068852_1000018695 | 203 |
| 128 | 3300005616 | Ga0068852_100045232 | Ga0068852_1000452325 | 203 |
| 129 | 3300005616 | Ga0068852_100254093 | Ga0068852_1002540932 | 203 |
| 130 | 3300005617 | Ga0068859_100237414 | Ga0068859_1002374143 | 203 |
| 131 | 3300005618 | Ga0068864_100014637 | Ga0068864_1000146374 | 203 |
| 132 | 3300005618 | Ga0068864_100074936 | Ga0068864_1000749363 | 203 |
| 133 | 3300005618 | Ga0068864_100408223 | Ga0068864_1004082232 | 203 |
| 134 | 3300005719 | Ga0068861_100055046 | Ga0068861_1000550463 | 203 |
| 135 | 3300005841 | Ga0068863_100007329 | Ga0068863_1000073296 | 203 |
| 136 | 3300005841 | Ga0068863_100046291 | Ga0068863_1000462914 | 203 |
| 137 | 3300005842 | Ga0068858_100004380 | Ga0068858_1000043806 | 203 |
| 138 | 3300005842 | Ga0068858_100024625 | Ga0068858_1000246254 | 203 |
| 139 | 3300005843 | Ga0068860_100077040 | Ga0068860_1000770403 | 203 |
| 140 | 3300005844 | Ga0068862_100602136 | Ga0068862_1006021362 | 203 |
| 141 | 3300006237 | Ga0097621_100097575 | Ga0097621_1000975752 | 203 |
| 142 | 3300006237 | Ga0097621_100131548 | Ga0097621_1001315482 | 203 |
| 143 | 3300006358 | Ga0068871_100019247 | Ga0068871_1000192478 | 203 |
| 144 | 3300006881 | Ga0068865_100023582 | Ga0068865_1000235827 | 203 |
| 145 | 3300006931 | Ga0097620_100237429 | Ga0097620_1002374293 | 203 |
| 146 | 3300009093 | Ga0105240_10181548 | Ga0105240_101815483 | 203 |
| 147 | 3300009098 | Ga0105245_10023129 | Ga0105245_100231294 | 203 |
| 148 | 3300009148 | Ga0105243_10170889 | Ga0105243_101708891 | 203 |
| 149 | 3300009176 | Ga0105242_10462052 | Ga0105242_104620521 | 203 |
| 150 | 3300009177 | Ga0105248_10002586 | Ga0105248_100025864 | 203 |
| 151 | 3300009545 | Ga0105237_10057887 | Ga0105237_100578873 | 203 |
| 152 | 3300009551 | Ga0105238_10117593 | Ga0105238_101175933 | 203 |
| 153 | 3300009553 | Ga0105249_10073209 | Ga0105249_100732093 | 203 |
| 154 | 3300010375 | Ga0105239_10236298 | Ga0105239_102362983 | 203 |
| 155 | 3300013100 | Ga0157373_10106760 | Ga0157373_101067602 | 203 |
| 156 | 3300013100 | Ga0157373_10115656 | Ga0157373_101156563 | 203 |
| 157 | 3300013102 | Ga0157371_10003353 | Ga0157371_1000335312 | 203 |
| 158 | 3300013104 | Ga0157370_10195449 | Ga0157370_101954492 | 203 |
| 159 | 3300013296 | Ga0157374_10004943 | Ga0157374_100049436 | 203 |
| 160 | 3300013306 | Ga0163162_10022126 | Ga0163162_100221264 | 203 |
| 161 | 3300013307 | Ga0157372_10104952 | Ga0157372_101049523 | 203 |
| 162 | 3300013307 | Ga0157372_10284963 | Ga0157372_102849633 | 203 |
| 163 | 3300013308 | Ga0157375_10001267 | Ga0157375_1000126724 | 203 |
| 164 | 3300013308 | Ga0157375_10037411 | Ga0157375_100374113 | 203 |
| 165 | 3300014325 | Ga0163163_10030080 | Ga0163163_100300804 | 203 |
| 166 | 3300014325 | Ga0163163_10103516 | Ga0163163_101035162 | 203 |
| 167 | 3300021384 | Ga0213876_10302712 | Ga0213876_103027121 | 203 |
| 168 | 3300025245 | Ga0207425_1000019 | Ga0207425_100001912 | 203 |
| 169 | 3300025258 | Ga0209129_1000695 | Ga0209129_100069511 | 203 |
| 170 | 3300025263 | Ga0209565_1000186 | Ga0209565_100018653 | 203 |
| 171 | 3300025273 | Ga0209673_1023291 | Ga0209673_10232912 | 203 |
| 172 | 3300025294 | Ga0209025_1000472 | Ga0209025_100047220 | 203 |
| 173 | 3300025295 | Ga0209564_1000678 | Ga0209564_100067828 | 203 |
| 174 | 3300025295 | Ga0209564_1052760 | Ga0209564_10527601 | 203 |
| 175 | 3300025297 | Ga0209758_1000019 | Ga0209758_1000019575 | 203 |
| 176 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011783 | 203 |
| 177 | 3300025298 | Ga0209050_1000108 | Ga0209050_100010871 | 203 |
| 178 | 3300025298 | Ga0209050_1013329 | Ga0209050_10133292 | 203 |
| 179 | 3300025303 | Ga0209051_1000705 | Ga0209051_10007052 | 203 |
| 180 | 3300025304 | Ga0209257_1015147 | Ga0209257_10151474 | 203 |
| 181 | 3300025304 | Ga0209257_1035172 | Ga0209257_10351723 | 203 |
| 182 | 3300025315 | Ga0207697_10099349 | Ga0207697_100993492 | 203 |
| 183 | 3300025893 | Ga0207682_10262866 | Ga0207682_102628661 | 203 |
| 184 | 3300025901 | Ga0207688_10158724 | Ga0207688_101587242 | 203 |
| 185 | 3300025903 | Ga0207680_10053120 | Ga0207680_100531203 | 203 |
| 186 | 3300025904 | Ga0207647_10000107 | Ga0207647_1000010732 | 203 |
| 187 | 3300025904 | Ga0207647_10006139 | Ga0207647_100061394 | 203 |
| 188 | 3300025904 | Ga0207647_10123308 | Ga0207647_101233082 | 203 |
| 189 | 3300025907 | Ga0207645_10007591 | Ga0207645_100075913 | 203 |
| 190 | 3300025908 | Ga0207643_10029938 | Ga0207643_100299385 | 203 |
| 191 | 3300025909 | Ga0207705_10005743 | Ga0207705_100057434 | 203 |
| 192 | 3300025913 | Ga0207695_10146609 | Ga0207695_101466092 | 203 |
| 193 | 3300025914 | Ga0207671_10087972 | Ga0207671_100879722 | 203 |
| 194 | 3300025919 | Ga0207657_10043922 | Ga0207657_100439222 | 203 |
| 195 | 3300025920 | Ga0207649_10052909 | Ga0207649_100529092 | 203 |
| 196 | 3300025923 | Ga0207681_10197518 | Ga0207681_101975181 | 203 |
| 197 | 3300025923 | Ga0207681_10354285 | Ga0207681_103542851 | 203 |
| 198 | 3300025925 | Ga0207650_10043115 | Ga0207650_100431153 | 203 |
| 199 | 3300025925 | Ga0207650_10069156 | Ga0207650_100691563 | 203 |
| 200 | 3300025925 | Ga0207650_10185472 | Ga0207650_101854722 | 203 |
| 201 | 3300025926 | Ga0207659_10027444 | Ga0207659_100274442 | 203 |
| 202 | 3300025926 | Ga0207659_10303691 | Ga0207659_103036911 | 203 |
| 203 | 3300025926 | Ga0207659_10766607 | Ga0207659_107666071 | 203 |
| 204 | 3300025929 | Ga0207664_10177875 | Ga0207664_101778753 | 203 |
| 205 | 3300025931 | Ga0207644_10006281 | Ga0207644_100062814 | 203 |
| 206 | 3300025931 | Ga0207644_10175059 | Ga0207644_101750592 | 203 |
| 207 | 3300025932 | Ga0207690_10010956 | Ga0207690_100109562 | 203 |
| 208 | 3300025932 | Ga0207690_10013334 | Ga0207690_100133342 | 203 |
| 209 | 3300025932 | Ga0207690_10079902 | Ga0207690_100799021 | 203 |
| 210 | 3300025933 | Ga0207706_10000198 | Ga0207706_100001984 | 203 |
| 211 | 3300025933 | Ga0207706_10002200 | Ga0207706_100022004 | 203 |
| 212 | 3300025933 | Ga0207706_10011023 | Ga0207706_100110231 | 203 |
| 213 | 3300025933 | Ga0207706_10232353 | Ga0207706_102323532 | 203 |
| 214 | 3300025937 | Ga0207669_10035151 | Ga0207669_100351511 | 203 |
| 215 | 3300025937 | Ga0207669_10059090 | Ga0207669_100590903 | 203 |
| 216 | 3300025938 | Ga0207704_10249132 | Ga0207704_102491321 | 203 |
| 217 | 3300025940 | Ga0207691_10010364 | Ga0207691_100103645 | 203 |
| 218 | 3300025940 | Ga0207691_10015353 | Ga0207691_100153534 | 203 |
| 219 | 3300025941 | Ga0207711_10006417 | Ga0207711_100064174 | 203 |
| 220 | 3300025942 | Ga0207689_10002883 | Ga0207689_100028836 | 203 |
| 221 | 3300025945 | Ga0207679_10102316 | Ga0207679_101023162 | 203 |
| 222 | 3300025945 | Ga0207679_10220813 | Ga0207679_102208133 | 203 |
| 223 | 3300025945 | Ga0207679_10244842 | Ga0207679_102448423 | 203 |
| 224 | 3300025960 | Ga0207651_10209167 | Ga0207651_102091671 | 203 |
| 225 | 3300025960 | Ga0207651_10319129 | Ga0207651_103191292 | 203 |
| 226 | 3300025961 | Ga0207712_10043862 | Ga0207712_100438623 | 203 |
| 227 | 3300025972 | Ga0207668_10023529 | Ga0207668_100235293 | 203 |
| 228 | 3300025972 | Ga0207668_10254744 | Ga0207668_102547442 | 203 |
| 229 | 3300025972 | Ga0207668_10490511 | Ga0207668_104905111 | 203 |
| 230 | 3300025981 | Ga0207640_10012616 | Ga0207640_100126163 | 203 |
| 231 | 3300026035 | Ga0207703_10016039 | Ga0207703_100160396 | 203 |
| 232 | 3300026041 | Ga0207639_10010010 | Ga0207639_100100104 | 203 |
| 233 | 3300026041 | Ga0207639_10025813 | Ga0207639_100258133 | 203 |
| 234 | 3300026067 | Ga0207678_10158444 | Ga0207678_101584443 | 203 |
| 235 | 3300026088 | Ga0207641_10011991 | Ga0207641_100119917 | 203 |
| 236 | 3300026088 | Ga0207641_10012216 | Ga0207641_100122163 | 203 |
| 237 | 3300026088 | Ga0207641_10068238 | Ga0207641_100682385 | 203 |
| 238 | 3300026089 | Ga0207648_10002604 | Ga0207648_100026043 | 203 |
| 239 | 3300026089 | Ga0207648_10170338 | Ga0207648_101703382 | 203 |
| 240 | 3300026095 | Ga0207676_10014033 | Ga0207676_100140333 | 203 |
| 241 | 3300026095 | Ga0207676_10029119 | Ga0207676_100291193 | 203 |
| 242 | 3300026095 | Ga0207676_10210887 | Ga0207676_102108872 | 203 |
| 243 | 3300026116 | Ga0207674_10000057 | Ga0207674_1000005796 | 203 |
| 244 | 3300026116 | Ga0207674_10026707 | Ga0207674_100267074 | 203 |
| 245 | 3300026116 | Ga0207674_10094034 | Ga0207674_100940346 | 203 |
| 246 | 3300026118 | Ga0207675_100351567 | Ga0207675_1003515672 | 203 |
| 247 | 3300026118 | Ga0207675_100572675 | Ga0207675_1005726751 | 203 |
| 248 | 3300026121 | Ga0207683_10004521 | Ga0207683_100045215 | 203 |
| 249 | 3300026142 | Ga0207698_10386509 | Ga0207698_103865092 | 203 |
| 250 | 3300028379 | Ga0268266_10000019 | Ga0268266_10000019216 | 203 |
| 251 | 3300028379 | Ga0268266_10023527 | Ga0268266_100235274 | 203 |
| 252 | 3300028379 | Ga0268266_10334275 | Ga0268266_103342752 | 203 |
| 253 | 3300031548 | Ga0307408_100347036 | Ga0307408_1003470362 | 203 |
| 254 | 3300031548 | Ga0307408_100478180 | Ga0307408_1004781801 | 203 |
| 255 | 3300031548 | Ga0307408_101105986 | Ga0307408_1011059861 | 203 |
| 256 | 3300031731 | Ga0307405_10248178 | Ga0307405_102481782 | 203 |
| 257 | 3300031824 | Ga0307413_10096783 | Ga0307413_100967834 | 203 |
| 258 | 3300031824 | Ga0307413_10217840 | Ga0307413_102178401 | 203 |
| 259 | 3300031824 | Ga0307413_10278649 | Ga0307413_102786492 | 203 |
| 260 | 3300031824 | Ga0307413_10304991 | Ga0307413_103049912 | 203 |
| 261 | 3300031824 | Ga0307413_10451254 | Ga0307413_104512541 | 203 |
| 262 | 3300031852 | Ga0307410_10001826 | Ga0307410_100018262 | 203 |
| 263 | 3300031852 | Ga0307410_10036830 | Ga0307410_100368304 | 203 |
| 264 | 3300031852 | Ga0307410_10054106 | Ga0307410_100541061 | 203 |
| 265 | 3300031852 | Ga0307410_10357940 | Ga0307410_103579402 | 203 |
| 266 | 3300031901 | Ga0307406_10110268 | Ga0307406_101102682 | 203 |
| 267 | 3300031901 | Ga0307406_10112528 | Ga0307406_101125281 | 203 |
| 268 | 3300031901 | Ga0307406_10161666 | Ga0307406_101616662 | 203 |
| 269 | 3300031903 | Ga0307407_10405735 | Ga0307407_104057352 | 203 |
| 270 | 3300031911 | Ga0307412_10054528 | Ga0307412_100545282 | 203 |
| 271 | 3300031911 | Ga0307412_10152847 | Ga0307412_101528472 | 203 |
| 272 | 3300031911 | Ga0307412_10201040 | Ga0307412_102010402 | 203 |
| 273 | 3300031911 | Ga0307412_10202834 | Ga0307412_102028341 | 203 |
| 274 | 3300031995 | Ga0307409_100003131 | Ga0307409_1000031313 | 203 |
| 275 | 3300031995 | Ga0307409_100261955 | Ga0307409_1002619551 | 203 |
| 276 | 3300031995 | Ga0307409_100404597 | Ga0307409_1004045973 | 203 |
| 277 | 3300031995 | Ga0307409_100411707 | Ga0307409_1004117072 | 203 |
| 278 | 3300031995 | Ga0307409_100498525 | Ga0307409_1004985253 | 203 |
| 279 | 3300032002 | Ga0307416_100114259 | Ga0307416_1001142593 | 203 |
| 280 | 3300032002 | Ga0307416_100589431 | Ga0307416_1005894312 | 203 |
| 281 | 3300032002 | Ga0307416_100621967 | Ga0307416_1006219672 | 203 |
| 282 | 3300032004 | Ga0307414_10009782 | Ga0307414_100097822 | 203 |
| 283 | 3300032004 | Ga0307414_10060344 | Ga0307414_100603442 | 203 |
| 284 | 3300032004 | Ga0307414_10422157 | Ga0307414_104221572 | 203 |
| 285 | 3300032004 | Ga0307414_10458809 | Ga0307414_104588092 | 203 |
| 286 | 3300032004 | Ga0307414_10512580 | Ga0307414_105125801 | 203 |
| 287 | 3300032004 | Ga0307414_10515592 | Ga0307414_105155922 | 203 |
| 288 | 3300032004 | Ga0307414_10638915 | Ga0307414_106389151 | 203 |
| 289 | 3300032005 | Ga0307411_10003050 | Ga0307411_100030505 | 203 |
| 290 | 3300032005 | Ga0307411_10073806 | Ga0307411_100738063 | 203 |
| 291 | 3300032005 | Ga0307411_10299760 | Ga0307411_102997602 | 203 |
| 292 | 3300032005 | Ga0307411_10564294 | Ga0307411_105642942 | 203 |
| 293 | 3300032005 | Ga0307411_10620273 | Ga0307411_106202731 | 203 |
| 294 | 3300032005 | Ga0307411_10832181 | Ga0307411_108321812 | 203 |
| 295 | 3300032126 | Ga0307415_100049736 | Ga0307415_1000497361 | 203 |
| 296 | 3300032126 | Ga0307415_100168433 | Ga0307415_1001684332 | 203 |
| 297 | 3300032126 | Ga0307415_100168560 | Ga0307415_1001685603 | 203 |
| 298 | 3300032126 | Ga0307415_100190404 | Ga0307415_1001904041 | 203 |
| 299 | 3300032126 | Ga0307415_100497197 | Ga0307415_1004971971 | 203 |
| 300 | 3300037312 | Ga0395899_0000582 | Ga0395899_0000582_36696_37307 | 203 |
| 301 | 3300037312 | Ga0395899_0000738 | Ga0395899_0000738_305_916 | 203 |
| 302 | 3300037312 | Ga0395899_0133532 | Ga0395899_0133532_431_1042 | 203 |
| 303 | 3300037312 | Ga0395899_0170742 | Ga0395899_0170742_874_1485 | 203 |
| 304 | 3300037312 | Ga0395899_0194553 | Ga0395899_0194553_431_1042 | 203 |
| 305 | 3300037312 | Ga0395899_0353276 | Ga0395899_0353276_294_905 | 203 |
| 306 | 3300037418 | Ga0395900_0001617 | Ga0395900_0001617_5828_6439 | 203 |
| 307 | 3300037418 | Ga0395900_0002003 | Ga0395900_0002003_8060_8671 | 203 |
| 308 | 3300037418 | Ga0395900_0143849 | Ga0395900_0143849_289_900 | 203 |
| 309 | 3300037418 | Ga0395900_0238662 | Ga0395900_0238662_993_1604 | 203 |
| 310 | 3300037418 | Ga0395900_0281500 | Ga0395900_0281500_339_1022 | 203 |
| 311 | 3300037418 | Ga0395900_0337020 | Ga0395900_0337020_751_1362 | 203 |
| 312 | 3300037418 | Ga0395900_0339359 | Ga0395900_0339359_805_1416 | 203 |
| 313 | 3300037418 | Ga0395900_0591750 | Ga0395900_0591750_419_1030 | 203 |
| 314 | 3300037418 | Ga0395900_0807124 | Ga0395900_0807124_23_634 | 203 |
| 315 | 3300037466 | Ga0395898_0001601 | Ga0395898_0001601_10901_11512 | 203 |
| 316 | 3300037466 | Ga0395898_0077636 | Ga0395898_0077636_1175_1786 | 203 |
| 317 | 3300037466 | Ga0395898_0194934 | Ga0395898_0194934_990_1601 | 203 |
| 318 | 3300037466 | Ga0395898_0435295 | Ga0395898_0435295_193_804 | 203 |
| 319 | 3300037471 | Ga0395905_0002381 | Ga0395905_0002381_12937_13548 | 203 |
| 320 | 3300037471 | Ga0395905_0004005 | Ga0395905_0004005_8872_9483 | 203 |
| 321 | 3300037471 | Ga0395905_0022309 | Ga0395905_0022309_485_1096 | 203 |
| 322 | 3300037471 | Ga0395905_0045455 | Ga0395905_0045455_2513_3241 | 203 |
| 323 | 3300037471 | Ga0395905_0051963 | Ga0395905_0051963_2379_3062 | 203 |
| 324 | 3300037471 | Ga0395905_0148238 | Ga0395905_0148238_881_1492 | 203 |
| 325 | 3300037471 | Ga0395905_0156783 | Ga0395905_0156783_1206_1817 | 203 |
| 326 | 3300037471 | Ga0395905_0221277 | Ga0395905_0221277_168_779 | 203 |
| 327 | 3300037471 | Ga0395905_0265888 | Ga0395905_0265888_599_1210 | 203 |
| 328 | 3300037471 | Ga0395905_0840685 | Ga0395905_0840685_116_727 | 203 |
| 329 | 3300038443 | Ga0395901_0000938 | Ga0395901_0000938_15085_15696 | 203 |
| 330 | 3300038443 | Ga0395901_0001383 | Ga0395901_0001383_8444_9055 | 203 |
| 331 | 3300038443 | Ga0395901_0002443 | Ga0395901_0002443_10471_11082 | 203 |
| 332 | 3300038443 | Ga0395901_0006322 | Ga0395901_0006322_5312_5923 | 203 |
| 333 | 3300038443 | Ga0395901_0219697 | Ga0395901_0219697_879_1490 | 203 |
| 334 | 3300039437 | Ga0436365_1716132 | Ga0436365_1716132_143_763 | 203 |
| 335 | 3300039450 | Ga0436363_1288012 | Ga0436363_1288012_596_1216 | 203 |
| 336 | 3300039453 | Ga0436362_0517774 | Ga0436362_0517774_23_637 | 203 |
| 337 | 3300044683 | Ga0466965_0126427 | Ga0466965_0126427_503_1174 | 203 |
| 338 | 3300044712 | Ga0453684_0779654 | Ga0453684_0779654_345_971 | 203 |
| 339 | 3300046616 | Ga0495668_0017842 | Ga0495668_0017842_954_1568 | 203 |
| 340 | 3300046684 | Ga0495669_0060666 | Ga0495669_0060666_978_1589 | 203 |
| 341 | 3300048903 | Ga0496100_0077261 | Ga0496100_0077261_1263_1934 | 203 |
| 342 | 3300048904 | Ga0496101_0177527 | Ga0496101_0177527_173_784 | 203 |
| 343 | 3300048905 | Ga0496102_0674560 | Ga0496102_0674560_109_720 | 203 |
| 344 | 3300048911 | Ga0496108_0006669 | Ga0496108_0006669_7427_8038 | 203 |
| 345 | 3300048912 | Ga0496109_0042084 | Ga0496109_0042084_602_1213 | 203 |
| 346 | 3300048912 | Ga0496109_0308054 | Ga0496109_0308054_493_1107 | 203 |
| 347 | 3300048912 | Ga0496109_1407942 | Ga0496109_1407942_10_621 | 203 |
| 348 | 3300048914 | Ga0496111_0313875 | Ga0496111_0313875_292_903 | 203 |
| 349 | 3300048915 | Ga0496112_0052793 | Ga0496112_0052793_393_1004 | 203 |
| 350 | 3300048917 | Ga0496114_0904534 | Ga0496114_0904534_45_665 | 203 |
| 351 | 3300048918 | Ga0496115_0005539 | Ga0496115_0005539_6529_7179 | 203 |
| 352 | 3300048924 | Ga0496121_0000147 | Ga0496121_0000147_104660_105271 | 203 |
| 353 | 3300048925 | Ga0496122_0004742 | Ga0496122_0004742_2660_3274 | 203 |
| 354 | 3300048926 | Ga0496123_0000643 | Ga0496123_0000643_33131_33745 | 203 |
| 355 | 3300048927 | Ga0496124_0033592 | Ga0496124_0033592_2133_2747 | 203 |
| 356 | 3300049569 | Ga0501032_0503755 | Ga0501032_0503755_27_638 | 203 |
| 357 | 3300049571 | Ga0501034_0421488 | Ga0501034_0421488_188_799 | 203 |
| 358 | 3300049585 | Ga0501069_0282784 | Ga0501069_0282784_80_691 | 203 |
| 359 | 3300049758 | Ga0501241_006677 | Ga0501241_006677_814_1425 | 203 |
| 360 | 3300053128 | Ga0500626_133441 | Ga0500626_133441_67_678 | 203 |
| 361 | 3300053131 | Ga0500652_124947 | Ga0500652_124947_247_861 | 203 |
| 362 | 3300053136 | Ga0500559_0116192 | Ga0500559_0116192_218_925 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nsr-assembly1.cif.gz_B | tetr family transcriptional regulator cifr c99t-c181r cysteine mutant complexed with 26bp double-strand operator dna and apo-cifr c99t-c181r | 0.8931 | 12 | 201 |
| 6nsm-assembly1.cif.gz_B | tetr family transcriptional regulator cifr c99t-c107s-c181r cysteines mutant complexed with 26bp double-strand operator dna | 0.8924 | 11 | 201 |
| 6nsr-assembly1.cif.gz_B | tetr family transcriptional regulator cifr c99t-c181r cysteine mutant complexed with 26bp double-strand operator dna and apo-cifr c99t-c181r | 0.8849 | 12 | 201 |
| 6nsm-assembly1.cif.gz_B | tetr family transcriptional regulator cifr c99t-c107s-c181r cysteines mutant complexed with 26bp double-strand operator dna | 0.8833 | 11 | 201 |
| 7amt-assembly1.cif.gz_B | structure of luxr with dna (activation) | 0.8452 | 20 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2i10B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9638 | 21 | 69 | 1.10.10.60 |
| 4x1eB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.939 | 20 | 66 | 1.10.10.60 |
| 1pb6B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9365 | 20 | 66 | 1.10.10.60 |
| 4xk4B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9331 | 20 | 66 | 1.10.10.60 |
| 4xk4A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.93 | 20 | 66 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7U9N7-F1-model_v4 | deleted | 0.9343 | 10 | 198 |
|
| AF-A0A837CJD3-F1-model_v4 | Putative transcriptional regulatory protein | 0.9328 | 28 | 198 |
GO:0003677
GO:0006355 |
| AF-A0A5S4WZQ5-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9312 | 11 | 198 |
GO:0003677
GO:0006355 |
| AF-A0A5P6NZ80-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9256 | 10 | 198 |
GO:0003677
GO:0006355 |
| AF-A0A4Z0NV39-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.9235 | 11 | 198 |
GO:0003677
GO:0006355 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar