F422612

General Info

Members Datasets Scaffolds Average Seq Length
362 194 362 204

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10302712|Ga0213876_103027121
Length 204
Sequence MECVVQRVCKGRPREFDLDEALAAALRVFWTKGYDGASLTDLTDAMGITRPSLYAAFGNKEALFRKALDLYEREKLAYVGEALKAPTSRQVAERLLRGALQMQTSDCEQPRGCMRVISSVACGPEADSIRADLMQRRQSSQRALCDRMQRAKEDGDLPAGTDVDGLCAYLGAIMQGMAVQAGSGATKEQLEALVETSLVMWPGK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
189 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
190 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
193 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.39
Nodule 0
Rhizoplane 4.14
Rhizosphere 83.7
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10038993 3300001979 Bacteria 1453
2 JGI24739J22299_10003925 3300001989 Bacteria 5688
3 JGI24739J22299_10023630 3300001989 Bacteria 2170
4 JGI24737J22298_10003153 3300001990 Bacteria 5852
5 JGI24737J22298_10038887 3300001990 Bacteria 1464
6 JGI24738J21930_10004531 3300002075 Bacteria 3395
7 JGI25151J46595_10024211 3300003187 Bacteria 2487
8 JGI25153J46596_10000181 3300003215 Bacteria 62061
9 Ga0055526_1012107 3300003771 Bacteria 3801
10 Ga0055526_1051281 3300003771 Bacteria 939
11 Ga0055537_1002131 3300003773 Bacteria 6919
12 Ga0055540_1000755 3300003792 Bacteria 21947
13 Ga0065165_1000705 3300005262 Bacteria 47513
14 Ga0065707_10244621 3300005295 Bacteria 1144
15 Ga0070658_10010469 3300005327 Bacteria 7440
16 Ga0070676_10014219 3300005328 Bacteria 4373
17 Ga0070690_100160816 3300005330 Bacteria 1539
18 Ga0070670_100036739 3300005331 Bacteria 4214
19 Ga0070670_100050075 3300005331 Bacteria 3590
20 Ga0070670_100318867 3300005331 Bacteria 1361
21 Ga0068869_100517528 3300005334 Bacteria 998
22 Ga0070666_10014992 3300005335 Bacteria 4938
23 Ga0068868_100017435 3300005338 Bacteria 5351
24 Ga0068868_100025618 3300005338 Bacteria 4489
25 Ga0070660_100059075 3300005339 Bacteria 2973
26 Ga0070661_100098156 3300005344 Bacteria 2176
27 Ga0070661_100155004 3300005344 Bacteria 1733
28 Ga0070661_100170964 3300005344 Bacteria 1650
29 Ga0070668_100029728 3300005347 Bacteria 4151
30 Ga0070668_100050520 3300005347 Bacteria 3202
31 Ga0070668_100138669 3300005347 Bacteria 1958
32 Ga0070668_100406545 3300005347 Bacteria 1163
33 Ga0070669_100002167 3300005353 Bacteria 14197
34 Ga0070675_100067622 3300005354 Bacteria 2957
35 Ga0070675_100259299 3300005354 Unclassified 1523
36 Ga0070671_100022077 3300005355 Bacteria 5200
37 Ga0070671_100036603 3300005355 Bacteria 4070
38 Ga0070671_100295111 3300005355 Bacteria 1380
39 Ga0070674_100134853 3300005356 Bacteria 1845
40 Ga0070674_100163968 3300005356 Bacteria 1689
41 Ga0070673_100003364 3300005364 Bacteria 9948
42 Ga0070673_100048203 3300005364 Bacteria 3320
43 Ga0070673_100097555 3300005364 Bacteria 2414
44 Ga0070659_100008984 3300005366 Bacteria 7328
45 Ga0070659_100030073 3300005366 Bacteria 4202
46 Ga0070659_100030889 3300005366 Bacteria 4147
47 Ga0070667_100055789 3300005367 Bacteria 3336
48 Ga0070678_100007840 3300005456 Bacteria 6354
49 Ga0070662_100018700 3300005457 Bacteria 4692
50 Ga0068867_100018114 3300005459 Bacteria 5004
51 Ga0068853_100001278 3300005539 Bacteria 18045
52 Ga0068853_100006571 3300005539 Bacteria 9259
53 Ga0070672_100008980 3300005543 Bacteria 6869
54 Ga0070665_100007419 3300005548 Bacteria 11152
55 Ga0070665_100046293 3300005548 Bacteria 4370
56 Ga0070665_100345965 3300005548 Bacteria 1492
57 Ga0068855_100457479 3300005563 Bacteria 1392
58 Ga0070664_100011219 3300005564 Bacteria 7268
59 Ga0070664_100073175 3300005564 Bacteria 2940
60 Ga0070664_100141412 3300005564 Bacteria 2119
61 Ga0068857_100005497 3300005577 Bacteria 10805
62 Ga0068857_100005551 3300005577 Bacteria 10763
63 Ga0068857_100105478 3300005577 Bacteria 2530
64 Ga0068857_100227960 3300005577 Bacteria 1703
65 Ga0068854_100010329 3300005578 Bacteria 6049
66 Ga0068856_100094302 3300005614 Bacteria 2979
67 Ga0068852_100001869 3300005616 Bacteria 14325
68 Ga0068852_100045232 3300005616 Bacteria 3743
69 Ga0068852_100047439 3300005616 Bacteria 3665
70 Ga0068852_100254093 3300005616 Bacteria 1685
71 Ga0068859_100237414 3300005617 Unclassified 1912
72 Ga0068864_100014637 3300005618 Bacteria 6516
73 Ga0068864_100074936 3300005618 Bacteria 2954
74 Ga0068864_100408223 3300005618 Bacteria 1292
75 Ga0068861_100055046 3300005719 Bacteria 3033
76 Ga0068851_10020635 3300005834 Bacteria 3192
77 Ga0068863_100007329 3300005841 Bacteria 10799
78 Ga0068863_100046291 3300005841 Bacteria 4128
79 Ga0068858_100004380 3300005842 Bacteria 13853
80 Ga0068858_100024625 3300005842 Bacteria 5608
81 Ga0068860_100077040 3300005843 Bacteria 3171
82 Ga0068862_100602136 3300005844 Bacteria 1055
83 Ga0097621_100097575 3300006237 Bacteria 2468
84 Ga0097621_100131548 3300006237 Bacteria 2131
85 Ga0097621_100309398 3300006237 Bacteria 1397
86 Ga0068871_100019247 3300006358 Bacteria 5210
87 Ga0068871_100601332 3300006358 Bacteria 1000
88 Ga0068865_100023582 3300006881 Bacteria 4030
89 Ga0097620_100237429 3300006931 Unclassified 1912
90 Ga0105240_10181548 3300009093 Bacteria 2483
91 Ga0105245_10023129 3300009098 Bacteria 5454
92 Ga0105243_10170889 3300009148 Bacteria 1882
93 Ga0105242_10462052 3300009176 Bacteria 1199
94 Ga0105248_10002586 3300009177 Bacteria 20122
95 Ga0105248_10077111 3300009177 Bacteria 3746
96 Ga0105237_10057887 3300009545 Bacteria 3878
97 Ga0105238_10117593 3300009551 Bacteria 2638
98 Ga0105249_10073209 3300009553 Bacteria 3169
99 Ga0105239_10236298 3300010375 Bacteria 2051
100 Ga0157373_10106760 3300013100 Bacteria 1969
101 Ga0157373_10115656 3300013100 Bacteria 1885
102 Ga0157371_10003353 3300013102 Bacteria 14588
103 Ga0157370_10195449 3300013104 Bacteria 1877
104 Ga0157374_10004943 3300013296 Bacteria 11188
105 Ga0163162_10022126 3300013306 Bacteria 6266
106 Ga0157372_10104952 3300013307 Bacteria 3231
107 Ga0157372_10284963 3300013307 Bacteria 1921
108 Ga0157375_10001267 3300013308 Bacteria 21875
109 Ga0157375_10037411 3300013308 Bacteria 4650
110 Ga0163163_10030080 3300014325 Bacteria 5228
111 Ga0163163_10103516 3300014325 Bacteria 2871
112 Ga0157376_11529016 3300014969 Bacteria 701
113 Ga0213876_10302712 3300021384 Bacteria 850
114 Ga0207425_1000019 3300025245 Bacteria 399942
115 Ga0209129_1000695 3300025258 Bacteria 22046
116 Ga0209233_1044078 3300025261 Bacteria 947
117 Ga0209565_1000186 3300025263 Bacteria 76097
118 Ga0209673_1023291 3300025273 Bacteria 2113
119 Ga0209025_1000472 3300025294 Bacteria 78081
120 Ga0209564_1000678 3300025295 Bacteria 50329
121 Ga0209564_1052760 3300025295 Bacteria 975
122 Ga0209758_1000019 3300025297 Bacteria 743682
123 Ga0209050_1000001 3300025298 Bacteria 3563507
124 Ga0209050_1000108 3300025298 Bacteria 222534
125 Ga0209050_1013329 3300025298 Bacteria 3658
126 Ga0209051_1000705 3300025303 Bacteria 36568
127 Ga0209257_1015147 3300025304 Bacteria 3240
128 Ga0209257_1035172 3300025304 Bacteria 1553
129 Ga0207697_10099349 3300025315 Bacteria 1239
130 Ga0207682_10262866 3300025893 Bacteria 805
131 Ga0207688_10158724 3300025901 Bacteria 1339
132 Ga0207680_10053120 3300025903 Bacteria 2431
133 Ga0207647_10000107 3300025904 Bacteria 63716
134 Ga0207647_10006139 3300025904 Bacteria 8752
135 Ga0207647_10123308 3300025904 Bacteria 1527
136 Ga0207645_10007591 3300025907 Bacteria 7641
137 Ga0207645_10134584 3300025907 Bacteria 1609
138 Ga0207643_10029938 3300025908 Bacteria 3028
139 Ga0207705_10005743 3300025909 Bacteria 9260
140 Ga0207705_10011254 3300025909 Bacteria 6485
141 Ga0207695_10146609 3300025913 Bacteria 2304
142 Ga0207671_10087972 3300025914 Bacteria 2336
143 Ga0207657_10043922 3300025919 Bacteria 3933
144 Ga0207649_10052909 3300025920 Bacteria 2521
145 Ga0207649_10142703 3300025920 Bacteria 1641
146 Ga0207681_10197518 3300025923 Bacteria 1543
147 Ga0207681_10354285 3300025923 Bacteria 1175
148 Ga0207650_10043115 3300025925 Bacteria 3311
149 Ga0207650_10069156 3300025925 Bacteria 2653
150 Ga0207650_10185472 3300025925 Bacteria 1660
151 Ga0207659_10027444 3300025926 Bacteria 3855
152 Ga0207659_10303691 3300025926 Bacteria 1312
153 Ga0207659_10766607 3300025926 Bacteria 828
154 Ga0207664_10177875 3300025929 Bacteria 1825
155 Ga0207644_10006281 3300025931 Bacteria 7741
156 Ga0207644_10175059 3300025931 Bacteria 1678
157 Ga0207644_10381429 3300025931 Bacteria 1149
158 Ga0207690_10010956 3300025932 Bacteria 5405
159 Ga0207690_10013334 3300025932 Bacteria 4938
160 Ga0207690_10079902 3300025932 Bacteria 2280
161 Ga0207706_10000198 3300025933 Bacteria 66746
162 Ga0207706_10002200 3300025933 Bacteria 19004
163 Ga0207706_10011023 3300025933 Bacteria 8241
164 Ga0207706_10232353 3300025933 Bacteria 1613
165 Ga0207669_10035151 3300025937 Bacteria 2848
166 Ga0207669_10059090 3300025937 Bacteria 2344
167 Ga0207704_10249132 3300025938 Bacteria 1332
168 Ga0207691_10010364 3300025940 Bacteria 8940
169 Ga0207691_10015353 3300025940 Bacteria 7285
170 Ga0207711_10006417 3300025941 Bacteria 9909
171 Ga0207711_10119133 3300025941 Bacteria 2355
172 Ga0207689_10002883 3300025942 Bacteria 15860
173 Ga0207679_10102316 3300025945 Bacteria 2243
174 Ga0207679_10220813 3300025945 Bacteria 1594
175 Ga0207679_10244842 3300025945 Bacteria 1521
176 Ga0207651_10009059 3300025960 Bacteria 5418
177 Ga0207651_10209167 3300025960 Bacteria 1569
178 Ga0207651_10319129 3300025960 Bacteria 1298
179 Ga0207712_10043862 3300025961 Bacteria 3087
180 Ga0207668_10023529 3300025972 Bacteria 3962
181 Ga0207668_10254744 3300025972 Bacteria 1427
182 Ga0207668_10490511 3300025972 Bacteria 1055
183 Ga0207640_10012616 3300025981 Bacteria 4820
184 Ga0207703_10016039 3300026035 Bacteria 5843
185 Ga0207639_10010010 3300026041 Bacteria 6554
186 Ga0207639_10025813 3300026041 Bacteria 4263
187 Ga0207678_10158444 3300026067 Bacteria 1933
188 Ga0207702_10080795 3300026078 Bacteria 2822
189 Ga0207641_10011991 3300026088 Bacteria 7111
190 Ga0207641_10012216 3300026088 Bacteria 7048
191 Ga0207641_10068238 3300026088 Bacteria 3048
192 Ga0207648_10002604 3300026089 Bacteria 19339
193 Ga0207648_10170338 3300026089 Bacteria 1924
194 Ga0207676_10014033 3300026095 Bacteria 5753
195 Ga0207676_10029119 3300026095 Bacteria 4131
196 Ga0207676_10210887 3300026095 Bacteria 1723
197 Ga0207674_10000057 3300026116 Bacteria 113117
198 Ga0207674_10026707 3300026116 Bacteria 6125
199 Ga0207674_10051120 3300026116 Bacteria 4218
200 Ga0207674_10094034 3300026116 Bacteria 2985
201 Ga0207675_100351567 3300026118 Bacteria 1444
202 Ga0207675_100572675 3300026118 Bacteria 1130
203 Ga0207683_10004521 3300026121 Bacteria 11992
204 Ga0207698_10056805 3300026142 Bacteria 3023
205 Ga0207698_10386509 3300026142 Bacteria 1333
206 Ga0268266_10000019 3300028379 Bacteria 556465
207 Ga0268266_10023527 3300028379 Bacteria 5244
208 Ga0268266_10334275 3300028379 Unclassified 1420
209 Ga0307517_10008439 3300028786 Bacteria 14781
210 Ga0307517_10052057 3300028786 Bacteria 4113
211 Ga0307408_100347036 3300031548 Bacteria 1258
212 Ga0307408_100478180 3300031548 Bacteria 1086
213 Ga0307408_101105986 3300031548 Bacteria 735
214 Ga0307405_10248178 3300031731 Bacteria 1323
215 Ga0307413_10096783 3300031824 Bacteria 1939
216 Ga0307413_10217840 3300031824 Bacteria 1392
217 Ga0307413_10278649 3300031824 Bacteria 1256
218 Ga0307413_10304991 3300031824 Bacteria 1209
219 Ga0307413_10451254 3300031824 Bacteria 1021
220 Ga0307410_10001826 3300031852 Bacteria 9892
221 Ga0307410_10036830 3300031852 Bacteria 3189
222 Ga0307410_10054106 3300031852 Plasmid 2719
223 Ga0307410_10357940 3300031852 Bacteria 1168
224 Ga0307406_10110268 3300031901 Bacteria 1893
225 Ga0307406_10112528 3300031901 Unclassified 1877
226 Ga0307406_10161666 3300031901 Bacteria 1610
227 Ga0307407_10405735 3300031903 Bacteria 979
228 Ga0307412_10011811 3300031911 Bacteria 5069
229 Ga0307412_10054528 3300031911 Bacteria 2654
230 Ga0307412_10152847 3300031911 Bacteria 1705
231 Ga0307412_10201040 3300031911 Bacteria 1513
232 Ga0307412_10202834 3300031911 Unclassified 1507
233 Ga0307409_100003131 3300031995 Bacteria 8885
234 Ga0307409_100261955 3300031995 Bacteria 1587
235 Ga0307409_100404597 3300031995 Bacteria 1305
236 Ga0307409_100411707 3300031995 Bacteria 1294
237 Ga0307409_100498525 3300031995 Bacteria 1185
238 Ga0307416_100029565 3300032002 Bacteria 4096
239 Ga0307416_100114259 3300032002 Bacteria 2388
240 Ga0307416_100589431 3300032002 Bacteria 1190
241 Ga0307416_100621967 3300032002 Bacteria 1162
242 Ga0307414_10009782 3300032004 Bacteria 5526
243 Ga0307414_10060344 3300032004 Bacteria 2681
244 Ga0307414_10422157 3300032004 Bacteria 1163
245 Ga0307414_10458809 3300032004 Bacteria 1119
246 Ga0307414_10512580 3300032004 Bacteria 1063
247 Ga0307414_10515592 3300032004 Bacteria 1060
248 Ga0307414_10638915 3300032004 Bacteria 958
249 Ga0307414_10695351 3300032004 Bacteria 920
250 Ga0307411_10003050 3300032005 Bacteria 7652
251 Ga0307411_10073806 3300032005 Bacteria 2322
252 Ga0307411_10272801 3300032005 Bacteria 1342
253 Ga0307411_10299760 3300032005 Bacteria 1288
254 Ga0307411_10564294 3300032005 Bacteria 973
255 Ga0307411_10620273 3300032005 Bacteria 932
256 Ga0307411_10832181 3300032005 Bacteria 815
257 Ga0307415_100049736 3300032126 Bacteria 2836
258 Ga0307415_100168433 3300032126 Bacteria 1706
259 Ga0307415_100168560 3300032126 Unclassified 1705
260 Ga0307415_100190404 3300032126 Bacteria 1618
261 Ga0307415_100497197 3300032126 Bacteria 1065
262 Ga0395899_0000582 3300037312 Bacteria 38446
263 Ga0395899_0000738 3300037312 Bacteria 32643
264 Ga0395899_0133532 3300037312 Bacteria 1771
265 Ga0395899_0170742 3300037312 Bacteria 1531
266 Ga0395899_0194553 3300037312 Bacteria 1417
267 Ga0395899_0353276 3300037312 Bacteria 982
268 Ga0395900_0001617 3300037418 Bacteria 26505
269 Ga0395900_0002003 3300037418 Bacteria 22989
270 Ga0395900_0143849 3300037418 Bacteria 2440
271 Ga0395900_0238662 3300037418 Bacteria 1824
272 Ga0395900_0281500 3300037418 Archaea 1655
273 Ga0395900_0337020 3300037418 Bacteria 1484
274 Ga0395900_0339359 3300037418 Bacteria 1478
275 Ga0395900_0591750 3300037418 Bacteria 1050
276 Ga0395900_0807124 3300037418 Bacteria 866
277 Ga0395898_0001601 3300037466 Bacteria 30889
278 Ga0395898_0077636 3300037466 Bacteria 3206
279 Ga0395898_0194934 3300037466 Bacteria 1935
280 Ga0395898_0435295 3300037466 Bacteria 1249
281 Ga0395905_0002381 3300037471 Bacteria 20935
282 Ga0395905_0003631 3300037471 Bacteria 16392
283 Ga0395905_0004005 3300037471 Bacteria 15480
284 Ga0395905_0022309 3300037471 Bacteria 5989
285 Ga0395905_0045455 3300037471 Bacteria 4118
286 Ga0395905_0051963 3300037471 Plasmid 3838
287 Ga0395905_0148238 3300037471 Bacteria 2207
288 Ga0395905_0156783 3300037471 Bacteria 2141
289 Ga0395905_0177366 3300037471 Bacteria 2000
290 Ga0395905_0221277 3300037471 Bacteria 1771
291 Ga0395905_0265888 3300037471 Bacteria 1601
292 Ga0395905_0840685 3300037471 Bacteria 821
293 Ga0395905_1068986 3300037471 Bacteria 710
294 Ga0395901_0000938 3300038443 Bacteria 31711
295 Ga0395901_0001383 3300038443 Bacteria 25376
296 Ga0395901_0002443 3300038443 Bacteria 18837
297 Ga0395901_0006322 3300038443 Bacteria 11995
298 Ga0395901_0219697 3300038443 Bacteria 1986
299 Ga0395901_0261599 3300038443 Bacteria 1801
300 Ga0436365_1716132 3300039437 Bacteria 1524
301 Ga0436363_1288012 3300039450 Bacteria 1479
302 Ga0436362_0517774 3300039453 Bacteria 777
303 Ga0466965_0126427 3300044683 Bacteria 1323
304 Ga0453684_0779654 3300044712 Bacteria 1033
305 Ga0495650_0000096 3300046471 Bacteria 217464
306 Ga0495639_0251212 3300046475 Bacteria 874
307 Ga0495583_0000240 3300046506 Bacteria 90919
308 Ga0495583_0021220 3300046506 Bacteria 3346
309 Ga0495616_0096271 3300046513 Bacteria 1394
310 Ga0495620_0149701 3300046515 Bacteria 910
311 Ga0495643_0008560 3300046522 Bacteria 6462
312 Ga0495648_0137028 3300046524 Bacteria 1293
313 Ga0495587_0031901 3300046536 Bacteria 3188
314 Ga0495622_0002630 3300046557 Bacteria 8645
315 Ga0495622_0003975 3300046557 Bacteria 6902
316 Ga0495668_0017842 3300046616 Bacteria 4112
317 Ga0495668_0178781 3300046616 Bacteria 1162
318 Ga0495611_0183952 3300046648 Bacteria 976
319 Ga0495625_0008176 3300046660 Bacteria 8959
320 Ga0495669_0060666 3300046684 Bacteria 1710
321 Ga0495600_0002961 3300046809 Bacteria 9903
322 Ga0495687_000171 3300047443 Bacteria 95996
323 Ga0495677_0003206 3300047445 Bacteria 6376
324 Ga0495686_0000262 3300047472 Bacteria 94462
325 Ga0496100_0077261 3300048903 Bacteria 2238
326 Ga0496101_0177527 3300048904 Unclassified 1639
327 Ga0496102_0674560 3300048905 Bacteria 957
328 Ga0496108_0006669 3300048911 Bacteria 9347
329 Ga0496108_0063477 3300048911 Bacteria 3110
330 Ga0496109_0042084 3300048912 Bacteria 4137
331 Ga0496109_0135970 3300048912 Bacteria 2296
332 Ga0496109_0308054 3300048912 Bacteria 1494
333 Ga0496109_1407942 3300048912 Bacteria 633
334 Ga0496110_0077665 3300048913 Bacteria 2954
335 Ga0496111_0012051 3300048914 Bacteria 5845
336 Ga0496111_0313875 3300048914 Bacteria 1161
337 Ga0496112_0052793 3300048915 Bacteria 3990
338 Ga0496114_0904534 3300048917 Bacteria 764
339 Ga0496115_0005539 3300048918 Bacteria 9188
340 Ga0496121_0000147 3300048924 Bacteria 154342
341 Ga0496122_0004742 3300048925 Bacteria 16663
342 Ga0496123_0000643 3300048926 Bacteria 58206
343 Ga0496123_0000691 3300048926 Bacteria 55613
344 Ga0496124_0033592 3300048927 Bacteria 4511
345 Ga0501032_0503755 3300049569 Bacteria 774
346 Ga0501034_0421488 3300049571 Bacteria 1256
347 Ga0501067_0528188 3300049583 Bacteria 660
348 Ga0501069_0282784 3300049585 Bacteria 971
349 Ga0501241_006677 3300049758 Bacteria 2119
350 Ga0501241_013940 3300049758 Bacteria 1460
351 nmdc:mga07m45_70021_c1 3300050496 Unclassified 1995
352 Ga0500643_000531 3300053087 Bacteria 26779
353 Ga0500641_0048517 3300053096 Bacteria 1739
354 Ga0500556_0000055 3300053104 Bacteria 115798
355 Ga0500595_009088 3300053119 Bacteria 4030
356 Ga0500626_133441 3300053128 Bacteria 1050
357 Ga0500642_0000008 3300053130 Bacteria 293258
358 Ga0500652_124947 3300053131 Bacteria 1075
359 Ga0500559_0116192 3300053136 Bacteria 1242
360 Ga0500577_0190588 3300053142 Bacteria 882
361 Ga0500619_002471 3300053154 Bacteria 3568
362 Ga0500645_001127 3300053730 Bacteria 14560

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0528188 Ga0501067_0528188_99_647 182
2 3300025907 Ga0207645_10134584 Ga0207645_101345842 195
3 3300014969 Ga0157376_11529016 Ga0157376_115290161 196
4 3300031911 Ga0307412_10011811 Ga0307412_100118114 196
5 3300032002 Ga0307416_100029565 Ga0307416_1000295652 196
6 3300032005 Ga0307411_10272801 Ga0307411_102728012 196
7 3300005344 Ga0070661_100155004 Ga0070661_1001550041 200
8 3300005577 Ga0068857_100005551 Ga0068857_1000055512 200
9 3300025261 Ga0209233_1044078 Ga0209233_10440781 200
10 3300026116 Ga0207674_10051120 Ga0207674_100511202 200
11 3300028786 Ga0307517_10008439 Ga0307517_100084393 200
12 3300028786 Ga0307517_10052057 Ga0307517_100520572 200
13 3300038443 Ga0395901_0261599 Ga0395901_0261599_1086_1688 200
14 3300046471 Ga0495650_0000096 Ga0495650_0000096_122668_123270 200
15 3300046475 Ga0495639_0251212 Ga0495639_0251212_174_776 200
16 3300046506 Ga0495583_0000240 Ga0495583_0000240_75654_76256 200
17 3300046506 Ga0495583_0021220 Ga0495583_0021220_778_1380 200
18 3300046513 Ga0495616_0096271 Ga0495616_0096271_94_696 200
19 3300046515 Ga0495620_0149701 Ga0495620_0149701_270_872 200
20 3300046522 Ga0495643_0008560 Ga0495643_0008560_5286_5888 200
21 3300046524 Ga0495648_0137028 Ga0495648_0137028_374_976 200
22 3300046536 Ga0495587_0031901 Ga0495587_0031901_2047_2649 200
23 3300046557 Ga0495622_0002630 Ga0495622_0002630_5709_6311 200
24 3300046557 Ga0495622_0003975 Ga0495622_0003975_3032_3634 200
25 3300046616 Ga0495668_0178781 Ga0495668_0178781_470_1072 200
26 3300046648 Ga0495611_0183952 Ga0495611_0183952_151_753 200
27 3300046660 Ga0495625_0008176 Ga0495625_0008176_3230_3832 200
28 3300046809 Ga0495600_0002961 Ga0495600_0002961_5269_5871 200
29 3300047443 Ga0495687_000171 Ga0495687_000171_73020_73622 200
30 3300047445 Ga0495677_0003206 Ga0495677_0003206_1409_2011 200
31 3300047472 Ga0495686_0000262 Ga0495686_0000262_30894_31496 200
32 3300048926 Ga0496123_0000691 Ga0496123_0000691_39827_40429 200
33 3300049758 Ga0501241_013940 Ga0501241_013940_18_620 200
34 3300050496 nmdc:mga07m45_70021_c1 nmdc:mga07m45_70021_c1_869_1471 200
35 3300053087 Ga0500643_000531 Ga0500643_000531_15516_16118 200
36 3300053104 Ga0500556_0000055 Ga0500556_0000055_17571_18173 200
37 3300053119 Ga0500595_009088 Ga0500595_009088_2419_3021 200
38 3300053130 Ga0500642_0000008 Ga0500642_0000008_193420_194022 200
39 3300053154 Ga0500619_002471 Ga0500619_002471_1058_1660 200
40 3300053730 Ga0500645_001127 Ga0500645_001127_11897_12499 200
41 3300005327 Ga0070658_10010469 Ga0070658_100104694 201
42 3300005344 Ga0070661_100170964 Ga0070661_1001709641 201
43 3300005355 Ga0070671_100022077 Ga0070671_1000220773 201
44 3300005364 Ga0070673_100048203 Ga0070673_1000482034 201
45 3300005614 Ga0068856_100094302 Ga0068856_1000943023 201
46 3300005616 Ga0068852_100047439 Ga0068852_1000474393 201
47 3300005834 Ga0068851_10020635 Ga0068851_100206351 201
48 3300006237 Ga0097621_100309398 Ga0097621_1003093981 201
49 3300006358 Ga0068871_100601332 Ga0068871_1006013321 201
50 3300009177 Ga0105248_10077111 Ga0105248_100771113 201
51 3300025909 Ga0207705_10011254 Ga0207705_100112543 201
52 3300025920 Ga0207649_10142703 Ga0207649_101427033 201
53 3300025931 Ga0207644_10381429 Ga0207644_103814292 201
54 3300025941 Ga0207711_10119133 Ga0207711_101191332 201
55 3300025960 Ga0207651_10009059 Ga0207651_100090592 201
56 3300026078 Ga0207702_10080795 Ga0207702_100807952 201
57 3300026142 Ga0207698_10056805 Ga0207698_100568052 201
58 3300037471 Ga0395905_0003631 Ga0395905_0003631_9876_10481 201
59 3300037471 Ga0395905_0177366 Ga0395905_0177366_792_1397 201
60 3300037471 Ga0395905_1068986 Ga0395905_1068986_29_634 201
61 3300048911 Ga0496108_0063477 Ga0496108_0063477_1513_2118 201
62 3300048912 Ga0496109_0135970 Ga0496109_0135970_1368_1973 201
63 3300048913 Ga0496110_0077665 Ga0496110_0077665_276_881 201
64 3300048914 Ga0496111_0012051 Ga0496111_0012051_754_1359 201
65 3300032004 Ga0307414_10695351 Ga0307414_106953511 202
66 3300053096 Ga0500641_0048517 Ga0500641_0048517_54_662 202
67 3300053142 Ga0500577_0190588 Ga0500577_0190588_111_719 202
68 3300001979 JGI24740J21852_10038993 JGI24740J21852_100389933 203
69 3300001989 JGI24739J22299_10003925 JGI24739J22299_100039254 203
70 3300001989 JGI24739J22299_10023630 JGI24739J22299_100236303 203
71 3300001990 JGI24737J22298_10003153 JGI24737J22298_100031535 203
72 3300001990 JGI24737J22298_10038887 JGI24737J22298_100388872 203
73 3300002075 JGI24738J21930_10004531 JGI24738J21930_100045314 203
74 3300003187 JGI25151J46595_10024211 JGI25151J46595_100242112 203
75 3300003215 JGI25153J46596_10000181 JGI25153J46596_1000018136 203
76 3300003771 Ga0055526_1012107 Ga0055526_10121071 203
77 3300003771 Ga0055526_1051281 Ga0055526_10512811 203
78 3300003773 Ga0055537_1002131 Ga0055537_10021312 203
79 3300003792 Ga0055540_1000755 Ga0055540_100075515 203
80 3300005262 Ga0065165_1000705 Ga0065165_100070529 203
81 3300005295 Ga0065707_10244621 Ga0065707_102446212 203
82 3300005328 Ga0070676_10014219 Ga0070676_100142192 203
83 3300005330 Ga0070690_100160816 Ga0070690_1001608162 203
84 3300005331 Ga0070670_100036739 Ga0070670_1000367392 203
85 3300005331 Ga0070670_100050075 Ga0070670_1000500754 203
86 3300005331 Ga0070670_100318867 Ga0070670_1003188671 203
87 3300005334 Ga0068869_100517528 Ga0068869_1005175281 203
88 3300005335 Ga0070666_10014992 Ga0070666_100149924 203
89 3300005338 Ga0068868_100017435 Ga0068868_1000174353 203
90 3300005338 Ga0068868_100025618 Ga0068868_1000256184 203
91 3300005339 Ga0070660_100059075 Ga0070660_1000590752 203
92 3300005344 Ga0070661_100098156 Ga0070661_1000981562 203
93 3300005347 Ga0070668_100029728 Ga0070668_1000297284 203
94 3300005347 Ga0070668_100050520 Ga0070668_1000505202 203
95 3300005347 Ga0070668_100138669 Ga0070668_1001386692 203
96 3300005347 Ga0070668_100406545 Ga0070668_1004065452 203
97 3300005353 Ga0070669_100002167 Ga0070669_1000021673 203
98 3300005354 Ga0070675_100067622 Ga0070675_1000676224 203
99 3300005354 Ga0070675_100259299 Ga0070675_1002592992 203
100 3300005355 Ga0070671_100036603 Ga0070671_1000366032 203
101 3300005355 Ga0070671_100295111 Ga0070671_1002951112 203
102 3300005356 Ga0070674_100134853 Ga0070674_1001348533 203
103 3300005356 Ga0070674_100163968 Ga0070674_1001639682 203
104 3300005364 Ga0070673_100003364 Ga0070673_1000033645 203
105 3300005364 Ga0070673_100097555 Ga0070673_1000975553 203
106 3300005366 Ga0070659_100008984 Ga0070659_1000089844 203
107 3300005366 Ga0070659_100030073 Ga0070659_1000300732 203
108 3300005366 Ga0070659_100030889 Ga0070659_1000308892 203
109 3300005367 Ga0070667_100055789 Ga0070667_1000557891 203
110 3300005456 Ga0070678_100007840 Ga0070678_1000078405 203
111 3300005457 Ga0070662_100018700 Ga0070662_1000187001 203
112 3300005459 Ga0068867_100018114 Ga0068867_1000181142 203
113 3300005539 Ga0068853_100001278 Ga0068853_1000012788 203
114 3300005539 Ga0068853_100006571 Ga0068853_1000065718 203
115 3300005543 Ga0070672_100008980 Ga0070672_1000089803 203
116 3300005548 Ga0070665_100007419 Ga0070665_1000074194 203
117 3300005548 Ga0070665_100046293 Ga0070665_1000462932 203
118 3300005548 Ga0070665_100345965 Ga0070665_1003459653 203
119 3300005563 Ga0068855_100457479 Ga0068855_1004574792 203
120 3300005564 Ga0070664_100011219 Ga0070664_1000112194 203
121 3300005564 Ga0070664_100073175 Ga0070664_1000731752 203
122 3300005564 Ga0070664_100141412 Ga0070664_1001414121 203
123 3300005577 Ga0068857_100005497 Ga0068857_10000549710 203
124 3300005577 Ga0068857_100105478 Ga0068857_1001054782 203
125 3300005577 Ga0068857_100227960 Ga0068857_1002279602 203
126 3300005578 Ga0068854_100010329 Ga0068854_1000103295 203
127 3300005616 Ga0068852_100001869 Ga0068852_1000018695 203
128 3300005616 Ga0068852_100045232 Ga0068852_1000452325 203
129 3300005616 Ga0068852_100254093 Ga0068852_1002540932 203
130 3300005617 Ga0068859_100237414 Ga0068859_1002374143 203
131 3300005618 Ga0068864_100014637 Ga0068864_1000146374 203
132 3300005618 Ga0068864_100074936 Ga0068864_1000749363 203
133 3300005618 Ga0068864_100408223 Ga0068864_1004082232 203
134 3300005719 Ga0068861_100055046 Ga0068861_1000550463 203
135 3300005841 Ga0068863_100007329 Ga0068863_1000073296 203
136 3300005841 Ga0068863_100046291 Ga0068863_1000462914 203
137 3300005842 Ga0068858_100004380 Ga0068858_1000043806 203
138 3300005842 Ga0068858_100024625 Ga0068858_1000246254 203
139 3300005843 Ga0068860_100077040 Ga0068860_1000770403 203
140 3300005844 Ga0068862_100602136 Ga0068862_1006021362 203
141 3300006237 Ga0097621_100097575 Ga0097621_1000975752 203
142 3300006237 Ga0097621_100131548 Ga0097621_1001315482 203
143 3300006358 Ga0068871_100019247 Ga0068871_1000192478 203
144 3300006881 Ga0068865_100023582 Ga0068865_1000235827 203
145 3300006931 Ga0097620_100237429 Ga0097620_1002374293 203
146 3300009093 Ga0105240_10181548 Ga0105240_101815483 203
147 3300009098 Ga0105245_10023129 Ga0105245_100231294 203
148 3300009148 Ga0105243_10170889 Ga0105243_101708891 203
149 3300009176 Ga0105242_10462052 Ga0105242_104620521 203
150 3300009177 Ga0105248_10002586 Ga0105248_100025864 203
151 3300009545 Ga0105237_10057887 Ga0105237_100578873 203
152 3300009551 Ga0105238_10117593 Ga0105238_101175933 203
153 3300009553 Ga0105249_10073209 Ga0105249_100732093 203
154 3300010375 Ga0105239_10236298 Ga0105239_102362983 203
155 3300013100 Ga0157373_10106760 Ga0157373_101067602 203
156 3300013100 Ga0157373_10115656 Ga0157373_101156563 203
157 3300013102 Ga0157371_10003353 Ga0157371_1000335312 203
158 3300013104 Ga0157370_10195449 Ga0157370_101954492 203
159 3300013296 Ga0157374_10004943 Ga0157374_100049436 203
160 3300013306 Ga0163162_10022126 Ga0163162_100221264 203
161 3300013307 Ga0157372_10104952 Ga0157372_101049523 203
162 3300013307 Ga0157372_10284963 Ga0157372_102849633 203
163 3300013308 Ga0157375_10001267 Ga0157375_1000126724 203
164 3300013308 Ga0157375_10037411 Ga0157375_100374113 203
165 3300014325 Ga0163163_10030080 Ga0163163_100300804 203
166 3300014325 Ga0163163_10103516 Ga0163163_101035162 203
167 3300021384 Ga0213876_10302712 Ga0213876_103027121 203
168 3300025245 Ga0207425_1000019 Ga0207425_100001912 203
169 3300025258 Ga0209129_1000695 Ga0209129_100069511 203
170 3300025263 Ga0209565_1000186 Ga0209565_100018653 203
171 3300025273 Ga0209673_1023291 Ga0209673_10232912 203
172 3300025294 Ga0209025_1000472 Ga0209025_100047220 203
173 3300025295 Ga0209564_1000678 Ga0209564_100067828 203
174 3300025295 Ga0209564_1052760 Ga0209564_10527601 203
175 3300025297 Ga0209758_1000019 Ga0209758_1000019575 203
176 3300025298 Ga0209050_1000001 Ga0209050_10000011783 203
177 3300025298 Ga0209050_1000108 Ga0209050_100010871 203
178 3300025298 Ga0209050_1013329 Ga0209050_10133292 203
179 3300025303 Ga0209051_1000705 Ga0209051_10007052 203
180 3300025304 Ga0209257_1015147 Ga0209257_10151474 203
181 3300025304 Ga0209257_1035172 Ga0209257_10351723 203
182 3300025315 Ga0207697_10099349 Ga0207697_100993492 203
183 3300025893 Ga0207682_10262866 Ga0207682_102628661 203
184 3300025901 Ga0207688_10158724 Ga0207688_101587242 203
185 3300025903 Ga0207680_10053120 Ga0207680_100531203 203
186 3300025904 Ga0207647_10000107 Ga0207647_1000010732 203
187 3300025904 Ga0207647_10006139 Ga0207647_100061394 203
188 3300025904 Ga0207647_10123308 Ga0207647_101233082 203
189 3300025907 Ga0207645_10007591 Ga0207645_100075913 203
190 3300025908 Ga0207643_10029938 Ga0207643_100299385 203
191 3300025909 Ga0207705_10005743 Ga0207705_100057434 203
192 3300025913 Ga0207695_10146609 Ga0207695_101466092 203
193 3300025914 Ga0207671_10087972 Ga0207671_100879722 203
194 3300025919 Ga0207657_10043922 Ga0207657_100439222 203
195 3300025920 Ga0207649_10052909 Ga0207649_100529092 203
196 3300025923 Ga0207681_10197518 Ga0207681_101975181 203
197 3300025923 Ga0207681_10354285 Ga0207681_103542851 203
198 3300025925 Ga0207650_10043115 Ga0207650_100431153 203
199 3300025925 Ga0207650_10069156 Ga0207650_100691563 203
200 3300025925 Ga0207650_10185472 Ga0207650_101854722 203
201 3300025926 Ga0207659_10027444 Ga0207659_100274442 203
202 3300025926 Ga0207659_10303691 Ga0207659_103036911 203
203 3300025926 Ga0207659_10766607 Ga0207659_107666071 203
204 3300025929 Ga0207664_10177875 Ga0207664_101778753 203
205 3300025931 Ga0207644_10006281 Ga0207644_100062814 203
206 3300025931 Ga0207644_10175059 Ga0207644_101750592 203
207 3300025932 Ga0207690_10010956 Ga0207690_100109562 203
208 3300025932 Ga0207690_10013334 Ga0207690_100133342 203
209 3300025932 Ga0207690_10079902 Ga0207690_100799021 203
210 3300025933 Ga0207706_10000198 Ga0207706_100001984 203
211 3300025933 Ga0207706_10002200 Ga0207706_100022004 203
212 3300025933 Ga0207706_10011023 Ga0207706_100110231 203
213 3300025933 Ga0207706_10232353 Ga0207706_102323532 203
214 3300025937 Ga0207669_10035151 Ga0207669_100351511 203
215 3300025937 Ga0207669_10059090 Ga0207669_100590903 203
216 3300025938 Ga0207704_10249132 Ga0207704_102491321 203
217 3300025940 Ga0207691_10010364 Ga0207691_100103645 203
218 3300025940 Ga0207691_10015353 Ga0207691_100153534 203
219 3300025941 Ga0207711_10006417 Ga0207711_100064174 203
220 3300025942 Ga0207689_10002883 Ga0207689_100028836 203
221 3300025945 Ga0207679_10102316 Ga0207679_101023162 203
222 3300025945 Ga0207679_10220813 Ga0207679_102208133 203
223 3300025945 Ga0207679_10244842 Ga0207679_102448423 203
224 3300025960 Ga0207651_10209167 Ga0207651_102091671 203
225 3300025960 Ga0207651_10319129 Ga0207651_103191292 203
226 3300025961 Ga0207712_10043862 Ga0207712_100438623 203
227 3300025972 Ga0207668_10023529 Ga0207668_100235293 203
228 3300025972 Ga0207668_10254744 Ga0207668_102547442 203
229 3300025972 Ga0207668_10490511 Ga0207668_104905111 203
230 3300025981 Ga0207640_10012616 Ga0207640_100126163 203
231 3300026035 Ga0207703_10016039 Ga0207703_100160396 203
232 3300026041 Ga0207639_10010010 Ga0207639_100100104 203
233 3300026041 Ga0207639_10025813 Ga0207639_100258133 203
234 3300026067 Ga0207678_10158444 Ga0207678_101584443 203
235 3300026088 Ga0207641_10011991 Ga0207641_100119917 203
236 3300026088 Ga0207641_10012216 Ga0207641_100122163 203
237 3300026088 Ga0207641_10068238 Ga0207641_100682385 203
238 3300026089 Ga0207648_10002604 Ga0207648_100026043 203
239 3300026089 Ga0207648_10170338 Ga0207648_101703382 203
240 3300026095 Ga0207676_10014033 Ga0207676_100140333 203
241 3300026095 Ga0207676_10029119 Ga0207676_100291193 203
242 3300026095 Ga0207676_10210887 Ga0207676_102108872 203
243 3300026116 Ga0207674_10000057 Ga0207674_1000005796 203
244 3300026116 Ga0207674_10026707 Ga0207674_100267074 203
245 3300026116 Ga0207674_10094034 Ga0207674_100940346 203
246 3300026118 Ga0207675_100351567 Ga0207675_1003515672 203
247 3300026118 Ga0207675_100572675 Ga0207675_1005726751 203
248 3300026121 Ga0207683_10004521 Ga0207683_100045215 203
249 3300026142 Ga0207698_10386509 Ga0207698_103865092 203
250 3300028379 Ga0268266_10000019 Ga0268266_10000019216 203
251 3300028379 Ga0268266_10023527 Ga0268266_100235274 203
252 3300028379 Ga0268266_10334275 Ga0268266_103342752 203
253 3300031548 Ga0307408_100347036 Ga0307408_1003470362 203
254 3300031548 Ga0307408_100478180 Ga0307408_1004781801 203
255 3300031548 Ga0307408_101105986 Ga0307408_1011059861 203
256 3300031731 Ga0307405_10248178 Ga0307405_102481782 203
257 3300031824 Ga0307413_10096783 Ga0307413_100967834 203
258 3300031824 Ga0307413_10217840 Ga0307413_102178401 203
259 3300031824 Ga0307413_10278649 Ga0307413_102786492 203
260 3300031824 Ga0307413_10304991 Ga0307413_103049912 203
261 3300031824 Ga0307413_10451254 Ga0307413_104512541 203
262 3300031852 Ga0307410_10001826 Ga0307410_100018262 203
263 3300031852 Ga0307410_10036830 Ga0307410_100368304 203
264 3300031852 Ga0307410_10054106 Ga0307410_100541061 203
265 3300031852 Ga0307410_10357940 Ga0307410_103579402 203
266 3300031901 Ga0307406_10110268 Ga0307406_101102682 203
267 3300031901 Ga0307406_10112528 Ga0307406_101125281 203
268 3300031901 Ga0307406_10161666 Ga0307406_101616662 203
269 3300031903 Ga0307407_10405735 Ga0307407_104057352 203
270 3300031911 Ga0307412_10054528 Ga0307412_100545282 203
271 3300031911 Ga0307412_10152847 Ga0307412_101528472 203
272 3300031911 Ga0307412_10201040 Ga0307412_102010402 203
273 3300031911 Ga0307412_10202834 Ga0307412_102028341 203
274 3300031995 Ga0307409_100003131 Ga0307409_1000031313 203
275 3300031995 Ga0307409_100261955 Ga0307409_1002619551 203
276 3300031995 Ga0307409_100404597 Ga0307409_1004045973 203
277 3300031995 Ga0307409_100411707 Ga0307409_1004117072 203
278 3300031995 Ga0307409_100498525 Ga0307409_1004985253 203
279 3300032002 Ga0307416_100114259 Ga0307416_1001142593 203
280 3300032002 Ga0307416_100589431 Ga0307416_1005894312 203
281 3300032002 Ga0307416_100621967 Ga0307416_1006219672 203
282 3300032004 Ga0307414_10009782 Ga0307414_100097822 203
283 3300032004 Ga0307414_10060344 Ga0307414_100603442 203
284 3300032004 Ga0307414_10422157 Ga0307414_104221572 203
285 3300032004 Ga0307414_10458809 Ga0307414_104588092 203
286 3300032004 Ga0307414_10512580 Ga0307414_105125801 203
287 3300032004 Ga0307414_10515592 Ga0307414_105155922 203
288 3300032004 Ga0307414_10638915 Ga0307414_106389151 203
289 3300032005 Ga0307411_10003050 Ga0307411_100030505 203
290 3300032005 Ga0307411_10073806 Ga0307411_100738063 203
291 3300032005 Ga0307411_10299760 Ga0307411_102997602 203
292 3300032005 Ga0307411_10564294 Ga0307411_105642942 203
293 3300032005 Ga0307411_10620273 Ga0307411_106202731 203
294 3300032005 Ga0307411_10832181 Ga0307411_108321812 203
295 3300032126 Ga0307415_100049736 Ga0307415_1000497361 203
296 3300032126 Ga0307415_100168433 Ga0307415_1001684332 203
297 3300032126 Ga0307415_100168560 Ga0307415_1001685603 203
298 3300032126 Ga0307415_100190404 Ga0307415_1001904041 203
299 3300032126 Ga0307415_100497197 Ga0307415_1004971971 203
300 3300037312 Ga0395899_0000582 Ga0395899_0000582_36696_37307 203
301 3300037312 Ga0395899_0000738 Ga0395899_0000738_305_916 203
302 3300037312 Ga0395899_0133532 Ga0395899_0133532_431_1042 203
303 3300037312 Ga0395899_0170742 Ga0395899_0170742_874_1485 203
304 3300037312 Ga0395899_0194553 Ga0395899_0194553_431_1042 203
305 3300037312 Ga0395899_0353276 Ga0395899_0353276_294_905 203
306 3300037418 Ga0395900_0001617 Ga0395900_0001617_5828_6439 203
307 3300037418 Ga0395900_0002003 Ga0395900_0002003_8060_8671 203
308 3300037418 Ga0395900_0143849 Ga0395900_0143849_289_900 203
309 3300037418 Ga0395900_0238662 Ga0395900_0238662_993_1604 203
310 3300037418 Ga0395900_0281500 Ga0395900_0281500_339_1022 203
311 3300037418 Ga0395900_0337020 Ga0395900_0337020_751_1362 203
312 3300037418 Ga0395900_0339359 Ga0395900_0339359_805_1416 203
313 3300037418 Ga0395900_0591750 Ga0395900_0591750_419_1030 203
314 3300037418 Ga0395900_0807124 Ga0395900_0807124_23_634 203
315 3300037466 Ga0395898_0001601 Ga0395898_0001601_10901_11512 203
316 3300037466 Ga0395898_0077636 Ga0395898_0077636_1175_1786 203
317 3300037466 Ga0395898_0194934 Ga0395898_0194934_990_1601 203
318 3300037466 Ga0395898_0435295 Ga0395898_0435295_193_804 203
319 3300037471 Ga0395905_0002381 Ga0395905_0002381_12937_13548 203
320 3300037471 Ga0395905_0004005 Ga0395905_0004005_8872_9483 203
321 3300037471 Ga0395905_0022309 Ga0395905_0022309_485_1096 203
322 3300037471 Ga0395905_0045455 Ga0395905_0045455_2513_3241 203
323 3300037471 Ga0395905_0051963 Ga0395905_0051963_2379_3062 203
324 3300037471 Ga0395905_0148238 Ga0395905_0148238_881_1492 203
325 3300037471 Ga0395905_0156783 Ga0395905_0156783_1206_1817 203
326 3300037471 Ga0395905_0221277 Ga0395905_0221277_168_779 203
327 3300037471 Ga0395905_0265888 Ga0395905_0265888_599_1210 203
328 3300037471 Ga0395905_0840685 Ga0395905_0840685_116_727 203
329 3300038443 Ga0395901_0000938 Ga0395901_0000938_15085_15696 203
330 3300038443 Ga0395901_0001383 Ga0395901_0001383_8444_9055 203
331 3300038443 Ga0395901_0002443 Ga0395901_0002443_10471_11082 203
332 3300038443 Ga0395901_0006322 Ga0395901_0006322_5312_5923 203
333 3300038443 Ga0395901_0219697 Ga0395901_0219697_879_1490 203
334 3300039437 Ga0436365_1716132 Ga0436365_1716132_143_763 203
335 3300039450 Ga0436363_1288012 Ga0436363_1288012_596_1216 203
336 3300039453 Ga0436362_0517774 Ga0436362_0517774_23_637 203
337 3300044683 Ga0466965_0126427 Ga0466965_0126427_503_1174 203
338 3300044712 Ga0453684_0779654 Ga0453684_0779654_345_971 203
339 3300046616 Ga0495668_0017842 Ga0495668_0017842_954_1568 203
340 3300046684 Ga0495669_0060666 Ga0495669_0060666_978_1589 203
341 3300048903 Ga0496100_0077261 Ga0496100_0077261_1263_1934 203
342 3300048904 Ga0496101_0177527 Ga0496101_0177527_173_784 203
343 3300048905 Ga0496102_0674560 Ga0496102_0674560_109_720 203
344 3300048911 Ga0496108_0006669 Ga0496108_0006669_7427_8038 203
345 3300048912 Ga0496109_0042084 Ga0496109_0042084_602_1213 203
346 3300048912 Ga0496109_0308054 Ga0496109_0308054_493_1107 203
347 3300048912 Ga0496109_1407942 Ga0496109_1407942_10_621 203
348 3300048914 Ga0496111_0313875 Ga0496111_0313875_292_903 203
349 3300048915 Ga0496112_0052793 Ga0496112_0052793_393_1004 203
350 3300048917 Ga0496114_0904534 Ga0496114_0904534_45_665 203
351 3300048918 Ga0496115_0005539 Ga0496115_0005539_6529_7179 203
352 3300048924 Ga0496121_0000147 Ga0496121_0000147_104660_105271 203
353 3300048925 Ga0496122_0004742 Ga0496122_0004742_2660_3274 203
354 3300048926 Ga0496123_0000643 Ga0496123_0000643_33131_33745 203
355 3300048927 Ga0496124_0033592 Ga0496124_0033592_2133_2747 203
356 3300049569 Ga0501032_0503755 Ga0501032_0503755_27_638 203
357 3300049571 Ga0501034_0421488 Ga0501034_0421488_188_799 203
358 3300049585 Ga0501069_0282784 Ga0501069_0282784_80_691 203
359 3300049758 Ga0501241_006677 Ga0501241_006677_814_1425 203
360 3300053128 Ga0500626_133441 Ga0500626_133441_67_678 203
361 3300053131 Ga0500652_124947 Ga0500652_124947_247_861 203
362 3300053136 Ga0500559_0116192 Ga0500559_0116192_218_925 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

21

67

0.97

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

92

196

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nsr-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c181r cysteine mutant complexed with 26bp double-strand operator dna and apo-cifr c99t-c181r 0.8931 12 201
6nsm-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c107s-c181r cysteines mutant complexed with 26bp double-strand operator dna 0.8924 11 201
6nsr-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c181r cysteine mutant complexed with 26bp double-strand operator dna and apo-cifr c99t-c181r 0.8849 12 201
6nsm-assembly1.cif.gz_B tetr family transcriptional regulator cifr c99t-c107s-c181r cysteines mutant complexed with 26bp double-strand operator dna 0.8833 11 201
7amt-assembly1.cif.gz_B structure of luxr with dna (activation) 0.8452 20 199
ID Description Score Start End Superfamily
2i10B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9638 21 69 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.939 20 66 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9365 20 66 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9331 20 66 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.93 20 66 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Q7U9N7-F1-model_v4 deleted 0.9343 10 198
AF-A0A837CJD3-F1-model_v4 Putative transcriptional regulatory protein 0.9328 28 198 GO:0003677
GO:0006355
AF-A0A5S4WZQ5-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9312 11 198 GO:0003677
GO:0006355
AF-A0A5P6NZ80-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9256 10 198 GO:0003677
GO:0006355
AF-A0A4Z0NV39-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9235 11 198 GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
80.92 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map