F422542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 362 | 179 | 362 | 338 |
Family's Representative Sequence
| Representative Sequence | 3300005719|Ga0068861_100424037|Ga0068861_1004240372 |
| Length | 364 |
| Sequence | VIYAQLEPKISGQVSLPVHFDPRNILIIDFGQLGDVVLSLPALKAIRKRFPDARLTVAVGKPGGQIVTLSGFANEVIEVDRVSLRDGSKLVSIARIFRLVGKVRQAKFDFVIDLHSLSETNLLGFLSGAPQRLFAQRPGRSIDYLGNFKPKPPAESSSDHLVDRYLKVLQPLGIENPSRYPLLKTSNAGDRHIEALLKKQKAHSNTLLVGLFPGAGHEGRRWPMERFAELADFLIRNDRVRVIVFAGPEERALIPQLKTLFPATTIFLDQLTIEQLASAQARLTLFISNDTGPMHIAAAVGTPVITLLDRPTPNSFVPIGEHHKVIGGPTIQHITVEQVYSVAHETLANSRTENLFSIAKNADE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 149 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 150 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 156 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 157 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 158 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 161 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 162 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 163 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 164 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 166 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 167 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 168 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 169 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 170 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 171 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 172 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 179 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 1.93 |
| Rhizosphere | 95.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1001564 | 3300000532 | Unclassified | 1889 |
| 2 | JGI25406J46586_10006350 | 3300003203 | Bacteria | 5452 |
| 3 | rootL2_10012479 | 3300003322 | Bacteria | 6906 |
| 4 | Ga0065714_10002185 | 3300005288 | Bacteria | 199213 |
| 5 | Ga0065712_10012011 | 3300005290 | Bacteria | 4494 |
| 6 | Ga0065712_10067734 | 3300005290 | Bacteria | 110577 |
| 7 | Ga0065715_10002626 | 3300005293 | Bacteria | 6294 |
| 8 | Ga0065715_10089026 | 3300005293 | Bacteria | 16364 |
| 9 | Ga0065715_10101436 | 3300005293 | Bacteria | 3190 |
| 10 | Ga0065715_10108046 | 3300005293 | Bacteria | 2739 |
| 11 | Ga0065707_10100907 | 3300005295 | Bacteria | 2896 |
| 12 | Ga0065707_10103551 | 3300005295 | Bacteria | 2742 |
| 13 | Ga0070690_100024791 | 3300005330 | Bacteria | 3692 |
| 14 | Ga0070670_100000431 | 3300005331 | Bacteria | 34518 |
| 15 | Ga0070670_100134854 | 3300005331 | Bacteria | 2133 |
| 16 | Ga0068869_100040606 | 3300005334 | Bacteria | 3328 |
| 17 | Ga0068869_100106852 | 3300005334 | Bacteria | 2124 |
| 18 | Ga0070680_100000639 | 3300005336 | Bacteria | 24354 |
| 19 | Ga0070680_100021395 | 3300005336 | Bacteria | 5141 |
| 20 | Ga0070682_100022469 | 3300005337 | Bacteria | 3737 |
| 21 | Ga0070682_100032942 | 3300005337 | Bacteria | 3145 |
| 22 | Ga0070682_100208248 | 3300005337 | Bacteria | 1384 |
| 23 | Ga0068868_100045467 | 3300005338 | Bacteria | 3435 |
| 24 | Ga0068868_100272978 | 3300005338 | Archaea | 1429 |
| 25 | Ga0070687_100006633 | 3300005343 | Bacteria | 4757 |
| 26 | Ga0070661_100017320 | 3300005344 | Bacteria | 5111 |
| 27 | Ga0070692_10009801 | 3300005345 | Bacteria | 4336 |
| 28 | Ga0070668_100000595 | 3300005347 | Bacteria | 24239 |
| 29 | Ga0070669_100020933 | 3300005353 | Bacteria | 4673 |
| 30 | Ga0070669_100048908 | 3300005353 | Bacteria | 3087 |
| 31 | Ga0070669_100091213 | 3300005353 | Bacteria | 2285 |
| 32 | Ga0070675_100164876 | 3300005354 | Bacteria | 1908 |
| 33 | Ga0070671_100289582 | 3300005355 | Unclassified | 1394 |
| 34 | Ga0070674_100121358 | 3300005356 | Bacteria | 1935 |
| 35 | Ga0070673_100005632 | 3300005364 | Bacteria | 8040 |
| 36 | Ga0070673_100163473 | 3300005364 | Unclassified | 1895 |
| 37 | Ga0070673_100170250 | 3300005364 | Bacteria | 1859 |
| 38 | Ga0070688_100095165 | 3300005365 | Bacteria | 1954 |
| 39 | Ga0070705_100124110 | 3300005440 | Bacteria | 1673 |
| 40 | Ga0070700_100000160 | 3300005441 | Bacteria | 38863 |
| 41 | Ga0070700_100010444 | 3300005441 | Bacteria | 5128 |
| 42 | Ga0070694_100005312 | 3300005444 | Bacteria | 7789 |
| 43 | Ga0070694_100011705 | 3300005444 | Bacteria | 5435 |
| 44 | Ga0070708_100004115 | 3300005445 | Bacteria | 11416 |
| 45 | Ga0070681_10000997 | 3300005458 | Bacteria | 23962 |
| 46 | Ga0070681_10023047 | 3300005458 | Bacteria | 6261 |
| 47 | Ga0070681_10137706 | 3300005458 | Bacteria | 2371 |
| 48 | Ga0070681_10460073 | 3300005458 | Bacteria | 1185 |
| 49 | Ga0068867_100012436 | 3300005459 | Bacteria | 6022 |
| 50 | Ga0068867_100176340 | 3300005459 | Bacteria | 1696 |
| 51 | Ga0070706_100001130 | 3300005467 | Bacteria | 28845 |
| 52 | Ga0070706_100022461 | 3300005467 | Bacteria | 5806 |
| 53 | Ga0070706_100058863 | 3300005467 | Bacteria | 3545 |
| 54 | Ga0070707_100007100 | 3300005468 | Bacteria | 10385 |
| 55 | Ga0070707_100019950 | 3300005468 | Bacteria | 6319 |
| 56 | Ga0070707_100289325 | 3300005468 | Bacteria | 1592 |
| 57 | Ga0070698_100004637 | 3300005471 | Bacteria | 15109 |
| 58 | Ga0070698_100016813 | 3300005471 | Bacteria | 7716 |
| 59 | Ga0070698_100034813 | 3300005471 | Bacteria | 5210 |
| 60 | Ga0070698_100042189 | 3300005471 | Bacteria | 4680 |
| 61 | Ga0070699_100000481 | 3300005518 | Bacteria | 38015 |
| 62 | Ga0070699_100004117 | 3300005518 | Bacteria | 12854 |
| 63 | Ga0070699_100038680 | 3300005518 | Bacteria | 4130 |
| 64 | Ga0070699_100105067 | 3300005518 | Bacteria | 2477 |
| 65 | Ga0070699_100474367 | 3300005518 | Unclassified | 1135 |
| 66 | Ga0070679_100000972 | 3300005530 | Bacteria | 24934 |
| 67 | Ga0070679_100025103 | 3300005530 | Bacteria | 5845 |
| 68 | Ga0070679_100107094 | 3300005530 | Bacteria | 2781 |
| 69 | Ga0070697_100007202 | 3300005536 | Bacteria | 8650 |
| 70 | Ga0068853_100015614 | 3300005539 | Bacteria | 6238 |
| 71 | Ga0068853_100021755 | 3300005539 | Bacteria | 5350 |
| 72 | Ga0068853_100136115 | 3300005539 | Unclassified | 2202 |
| 73 | Ga0070672_100073092 | 3300005543 | Bacteria | 2732 |
| 74 | Ga0070686_100003666 | 3300005544 | Bacteria | 8433 |
| 75 | Ga0070695_100021884 | 3300005545 | Bacteria | 3917 |
| 76 | Ga0070695_100039050 | 3300005545 | Bacteria | 2998 |
| 77 | Ga0070695_100061687 | 3300005545 | Bacteria | 2433 |
| 78 | Ga0070696_100233613 | 3300005546 | Unclassified | 1384 |
| 79 | Ga0070693_100020679 | 3300005547 | Bacteria | 3476 |
| 80 | Ga0070693_100035858 | 3300005547 | Bacteria | 2754 |
| 81 | Ga0070693_100058724 | 3300005547 | Bacteria | 2228 |
| 82 | Ga0070693_100168540 | 3300005547 | Bacteria | 1400 |
| 83 | Ga0070665_100069719 | 3300005548 | Bacteria | 3524 |
| 84 | Ga0070704_100006875 | 3300005549 | Bacteria | 6738 |
| 85 | Ga0070704_100024404 | 3300005549 | Bacteria | 3967 |
| 86 | Ga0070704_100076882 | 3300005549 | Bacteria | 2443 |
| 87 | Ga0070664_100002805 | 3300005564 | Bacteria | 14080 |
| 88 | Ga0070664_100190613 | 3300005564 | Bacteria | 1826 |
| 89 | Ga0068857_100001851 | 3300005577 | Bacteria | 17036 |
| 90 | Ga0068857_100032072 | 3300005577 | Bacteria | 4644 |
| 91 | Ga0068857_100233624 | 3300005577 | Bacteria | 1682 |
| 92 | Ga0068854_100127177 | 3300005578 | Bacteria | 1942 |
| 93 | Ga0068854_100134669 | 3300005578 | Bacteria | 1890 |
| 94 | Ga0068856_100016133 | 3300005614 | Bacteria | 7222 |
| 95 | Ga0070702_100056523 | 3300005615 | Bacteria | 2266 |
| 96 | Ga0070702_100070872 | 3300005615 | Bacteria | 2059 |
| 97 | Ga0068859_100023094 | 3300005617 | Bacteria | 6238 |
| 98 | Ga0068859_100028787 | 3300005617 | Bacteria | 5570 |
| 99 | Ga0068859_100121853 | 3300005617 | Bacteria | 2674 |
| 100 | Ga0068859_100284022 | 3300005617 | Bacteria | 1748 |
| 101 | Ga0068859_100332901 | 3300005617 | Bacteria | 1612 |
| 102 | Ga0068859_100531597 | 3300005617 | Bacteria | 1271 |
| 103 | Ga0068859_100596457 | 3300005617 | Unclassified | 1198 |
| 104 | Ga0068864_100005794 | 3300005618 | Bacteria | 10135 |
| 105 | Ga0068861_100004966 | 3300005719 | Bacteria | 8960 |
| 106 | Ga0068861_100030951 | 3300005719 | Bacteria | 3926 |
| 107 | Ga0068861_100186433 | 3300005719 | Bacteria | 1731 |
| 108 | Ga0068861_100424037 | 3300005719 | Bacteria | 1186 |
| 109 | Ga0068870_10070135 | 3300005840 | Bacteria | 1909 |
| 110 | Ga0068863_100443611 | 3300005841 | Bacteria | 1273 |
| 111 | Ga0068858_100059353 | 3300005842 | Bacteria | 3536 |
| 112 | Ga0068858_100059836 | 3300005842 | Bacteria | 3521 |
| 113 | Ga0068858_100070209 | 3300005842 | Bacteria | 3246 |
| 114 | Ga0068858_100070340 | 3300005842 | Bacteria | 3244 |
| 115 | Ga0068860_100018078 | 3300005843 | Bacteria | 6865 |
| 116 | Ga0068860_100045843 | 3300005843 | Bacteria | 4169 |
| 117 | Ga0068860_100056386 | 3300005843 | Bacteria | 3736 |
| 118 | Ga0068860_100077323 | 3300005843 | Bacteria | 3164 |
| 119 | Ga0068862_100007744 | 3300005844 | Bacteria | 8883 |
| 120 | Ga0068862_100008676 | 3300005844 | Bacteria | 8407 |
| 121 | Ga0068862_100323498 | 3300005844 | Bacteria | 1424 |
| 122 | Ga0081539_10000600 | 3300005985 | Bacteria | 73358 |
| 123 | Ga0081539_10000749 | 3300005985 | Bacteria | 64587 |
| 124 | Ga0081539_10001510 | 3300005985 | Bacteria | 39264 |
| 125 | Ga0081539_10001856 | 3300005985 | Bacteria | 33258 |
| 126 | Ga0097621_100000726 | 3300006237 | Bacteria | 23045 |
| 127 | Ga0097621_100032100 | 3300006237 | Unclassified | 4173 |
| 128 | Ga0068871_100005917 | 3300006358 | Bacteria | 8606 |
| 129 | Ga0068871_100320339 | 3300006358 | Bacteria | 1365 |
| 130 | Ga0075428_100034942 | 3300006844 | Bacteria | 5541 |
| 131 | Ga0075433_10062294 | 3300006852 | Bacteria | 3267 |
| 132 | Ga0075433_10172935 | 3300006852 | Bacteria | 1922 |
| 133 | Ga0075429_100049627 | 3300006880 | Bacteria | 3649 |
| 134 | Ga0075429_100072317 | 3300006880 | Bacteria | 3003 |
| 135 | Ga0075429_100169424 | 3300006880 | Bacteria | 1913 |
| 136 | Ga0068865_100083434 | 3300006881 | Bacteria | 2300 |
| 137 | Ga0097620_100023093 | 3300006931 | Bacteria | 6238 |
| 138 | Ga0097620_100028788 | 3300006931 | Bacteria | 5570 |
| 139 | Ga0097620_100121854 | 3300006931 | Bacteria | 2674 |
| 140 | Ga0097620_100284030 | 3300006931 | Bacteria | 1748 |
| 141 | Ga0097620_100332912 | 3300006931 | Bacteria | 1612 |
| 142 | Ga0097620_100531570 | 3300006931 | Bacteria | 1271 |
| 143 | Ga0097620_100596397 | 3300006931 | Unclassified | 1198 |
| 144 | Ga0075435_100010259 | 3300007076 | Bacteria | 6846 |
| 145 | Ga0105251_10093271 | 3300009011 | Bacteria | 1381 |
| 146 | Ga0111539_10008510 | 3300009094 | Bacteria | 13035 |
| 147 | Ga0111539_10008617 | 3300009094 | Bacteria | 12955 |
| 148 | Ga0111539_10195442 | 3300009094 | Bacteria | 2360 |
| 149 | Ga0111539_10330001 | 3300009094 | Bacteria | 1776 |
| 150 | Ga0105245_10416684 | 3300009098 | Bacteria | 1345 |
| 151 | Ga0105247_10021803 | 3300009101 | Bacteria | 3854 |
| 152 | Ga0114129_10012013 | 3300009147 | Bacteria | 12316 |
| 153 | Ga0114129_10028610 | 3300009147 | Bacteria | 7896 |
| 154 | Ga0114129_10029492 | 3300009147 | Bacteria | 7771 |
| 155 | Ga0114129_10158403 | 3300009147 | Bacteria | 3095 |
| 156 | Ga0114129_10219070 | 3300009147 | Bacteria | 2569 |
| 157 | Ga0114129_10235659 | 3300009147 | Unclassified | 2463 |
| 158 | Ga0105243_10013048 | 3300009148 | Bacteria | 6278 |
| 159 | Ga0105243_10056736 | 3300009148 | Bacteria | 3116 |
| 160 | Ga0105243_10097223 | 3300009148 | Bacteria | 2437 |
| 161 | Ga0105241_10040281 | 3300009174 | Bacteria | 3526 |
| 162 | Ga0105241_10052475 | 3300009174 | Bacteria | 3113 |
| 163 | Ga0105242_10046627 | 3300009176 | Bacteria | 3516 |
| 164 | Ga0105242_10058595 | 3300009176 | Bacteria | 3158 |
| 165 | Ga0105248_10011627 | 3300009177 | Bacteria | 9696 |
| 166 | Ga0105248_10012300 | 3300009177 | Bacteria | 9439 |
| 167 | Ga0105248_10030639 | 3300009177 | Bacteria | 6008 |
| 168 | Ga0105248_10043674 | 3300009177 | Bacteria | 5027 |
| 169 | Ga0105248_10049891 | 3300009177 | Bacteria | 4692 |
| 170 | Ga0105248_10056194 | 3300009177 | Bacteria | 4415 |
| 171 | Ga0105248_10086702 | 3300009177 | Bacteria | 3523 |
| 172 | Ga0105248_10103591 | 3300009177 | Bacteria | 3208 |
| 173 | Ga0105248_10343490 | 3300009177 | Unclassified | 1680 |
| 174 | Ga0105248_10436732 | 3300009177 | Unclassified | 1475 |
| 175 | Ga0105237_10003911 | 3300009545 | Bacteria | 17450 |
| 176 | Ga0105237_10060401 | 3300009545 | Bacteria | 3792 |
| 177 | Ga0105237_10164716 | 3300009545 | Bacteria | 2216 |
| 178 | Ga0105238_10016297 | 3300009551 | Bacteria | 7522 |
| 179 | Ga0105238_10016755 | 3300009551 | Bacteria | 7428 |
| 180 | Ga0105249_10000052 | 3300009553 | Bacteria | 168047 |
| 181 | Ga0105249_10004953 | 3300009553 | Bacteria | 11486 |
| 182 | Ga0105239_10289313 | 3300010375 | Bacteria | 1845 |
| 183 | Ga0105246_10082637 | 3300011119 | Bacteria | 2293 |
| 184 | Ga0105246_10204327 | 3300011119 | Unclassified | 1538 |
| 185 | Ga0157373_10006441 | 3300013100 | Bacteria | 8770 |
| 186 | Ga0157373_10014626 | 3300013100 | Bacteria | 5753 |
| 187 | Ga0157374_10023925 | 3300013296 | Bacteria | 5470 |
| 188 | Ga0157378_10002174 | 3300013297 | Bacteria | 17393 |
| 189 | Ga0157378_10017189 | 3300013297 | Bacteria | 6341 |
| 190 | Ga0157378_10021433 | 3300013297 | Bacteria | 5682 |
| 191 | Ga0157378_10056346 | 3300013297 | Bacteria | 3502 |
| 192 | Ga0163162_10000001 | 3300013306 | Bacteria | 751833 |
| 193 | Ga0163162_10023056 | 3300013306 | Bacteria | 6140 |
| 194 | Ga0163162_10030634 | 3300013306 | Bacteria | 5331 |
| 195 | Ga0163162_10061108 | 3300013306 | Bacteria | 3805 |
| 196 | Ga0163162_10259551 | 3300013306 | Unclassified | 1869 |
| 197 | Ga0157375_10005551 | 3300013308 | Bacteria | 10977 |
| 198 | Ga0157375_10018807 | 3300013308 | Bacteria | 6270 |
| 199 | Ga0157375_10025765 | 3300013308 | Bacteria | 5471 |
| 200 | Ga0157375_10064624 | 3300013308 | Bacteria | 3644 |
| 201 | Ga0157375_10146651 | 3300013308 | Bacteria | 2491 |
| 202 | Ga0157375_10350606 | 3300013308 | Bacteria | 1642 |
| 203 | Ga0163163_10001133 | 3300014325 | Bacteria | 22637 |
| 204 | Ga0163163_10001165 | 3300014325 | Bacteria | 22349 |
| 205 | Ga0163163_10001675 | 3300014325 | Bacteria | 18696 |
| 206 | Ga0163163_10007396 | 3300014325 | Bacteria | 9695 |
| 207 | Ga0163163_10014304 | 3300014325 | Bacteria | 7294 |
| 208 | Ga0163163_10066056 | 3300014325 | Bacteria | 3592 |
| 209 | Ga0163163_10250572 | 3300014325 | Unclassified | 1821 |
| 210 | Ga0163163_10531088 | 3300014325 | Bacteria | 1239 |
| 211 | Ga0157380_10005354 | 3300014326 | Bacteria | 8967 |
| 212 | Ga0157380_10287358 | 3300014326 | Archaea | 1508 |
| 213 | Ga0157377_10034549 | 3300014745 | Bacteria | 2766 |
| 214 | Ga0163161_10092670 | 3300017792 | Unclassified | 2237 |
| 215 | Ga0213876_10000011 | 3300021384 | Bacteria | 414473 |
| 216 | Ga0213876_10000916 | 3300021384 | Bacteria | 19494 |
| 217 | Ga0207653_10002203 | 3300025885 | Bacteria | 6210 |
| 218 | Ga0207710_10002251 | 3300025900 | Bacteria | 9028 |
| 219 | Ga0207680_10140891 | 3300025903 | Bacteria | 1598 |
| 220 | Ga0207647_10056615 | 3300025904 | Bacteria | 2405 |
| 221 | Ga0207684_10000023 | 3300025910 | Bacteria | 334838 |
| 222 | Ga0207684_10008916 | 3300025910 | Bacteria | 8902 |
| 223 | Ga0207684_10174213 | 3300025910 | Bacteria | 1854 |
| 224 | Ga0207707_10000072 | 3300025912 | Bacteria | 102454 |
| 225 | Ga0207707_10099013 | 3300025912 | Bacteria | 2548 |
| 226 | Ga0207707_10112944 | 3300025912 | Bacteria | 2375 |
| 227 | Ga0207671_10002971 | 3300025914 | Bacteria | 17426 |
| 228 | Ga0207660_10023592 | 3300025917 | Bacteria | 4157 |
| 229 | Ga0207662_10008320 | 3300025918 | Bacteria | 5679 |
| 230 | Ga0207662_10213824 | 3300025918 | Bacteria | 1253 |
| 231 | Ga0207649_10070174 | 3300025920 | Bacteria | 2234 |
| 232 | Ga0207652_10000083 | 3300025921 | Bacteria | 101957 |
| 233 | Ga0207652_10094694 | 3300025921 | Bacteria | 2630 |
| 234 | Ga0207681_10004999 | 3300025923 | Bacteria | 8146 |
| 235 | Ga0207681_10050526 | 3300025923 | Bacteria | 2814 |
| 236 | Ga0207681_10061819 | 3300025923 | Bacteria | 2576 |
| 237 | Ga0207694_10019991 | 3300025924 | Bacteria | 5066 |
| 238 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 239 | Ga0207687_10321281 | 3300025927 | Bacteria | 1253 |
| 240 | Ga0207644_10062899 | 3300025931 | Bacteria | 2693 |
| 241 | Ga0207706_10083489 | 3300025933 | Bacteria | 2809 |
| 242 | Ga0207709_10007875 | 3300025935 | Bacteria | 5905 |
| 243 | Ga0207709_10049344 | 3300025935 | Bacteria | 2569 |
| 244 | Ga0207691_10201847 | 3300025940 | Bacteria | 1730 |
| 245 | Ga0207711_10031912 | 3300025941 | Bacteria | 4451 |
| 246 | Ga0207711_10196241 | 3300025941 | Bacteria | 1841 |
| 247 | Ga0207711_10311239 | 3300025941 | Unclassified | 1454 |
| 248 | Ga0207711_10367501 | 3300025941 | Unclassified | 1334 |
| 249 | Ga0207689_10000667 | 3300025942 | Bacteria | 32744 |
| 250 | Ga0207689_10014518 | 3300025942 | Bacteria | 6700 |
| 251 | Ga0207679_10014664 | 3300025945 | Bacteria | 5158 |
| 252 | Ga0207679_10039465 | 3300025945 | Bacteria | 3372 |
| 253 | Ga0207651_10003215 | 3300025960 | Bacteria | 7992 |
| 254 | Ga0207651_10041258 | 3300025960 | Bacteria | 3062 |
| 255 | Ga0207651_10101462 | 3300025960 | Unclassified | 2136 |
| 256 | Ga0207712_10000062 | 3300025961 | Bacteria | 135638 |
| 257 | Ga0207712_10025647 | 3300025961 | Bacteria | 3919 |
| 258 | Ga0207668_10000276 | 3300025972 | Bacteria | 34074 |
| 259 | Ga0207658_10063485 | 3300025986 | Bacteria | 2768 |
| 260 | Ga0207677_10153200 | 3300026023 | Bacteria | 1781 |
| 261 | Ga0207703_10056373 | 3300026035 | Bacteria | 3200 |
| 262 | Ga0207639_10007465 | 3300026041 | Bacteria | 7458 |
| 263 | Ga0207639_10075436 | 3300026041 | Bacteria | 2651 |
| 264 | Ga0207639_10142317 | 3300026041 | Bacteria | 1999 |
| 265 | Ga0207639_10211957 | 3300026041 | Bacteria | 1668 |
| 266 | Ga0207708_10000108 | 3300026075 | Bacteria | 63624 |
| 267 | Ga0207708_10003622 | 3300026075 | Bacteria | 11390 |
| 268 | Ga0207708_10012701 | 3300026075 | Bacteria | 6279 |
| 269 | Ga0207708_10085610 | 3300026075 | Bacteria | 2425 |
| 270 | Ga0207708_10113788 | 3300026075 | Bacteria | 2103 |
| 271 | Ga0207702_10042832 | 3300026078 | Bacteria | 3799 |
| 272 | Ga0207641_10190272 | 3300026088 | Bacteria | 1886 |
| 273 | Ga0207641_10430134 | 3300026088 | Unclassified | 1272 |
| 274 | Ga0207641_10510701 | 3300026088 | Bacteria | 1168 |
| 275 | Ga0207648_10007488 | 3300026089 | Bacteria | 10726 |
| 276 | Ga0207648_10032036 | 3300026089 | Bacteria | 4645 |
| 277 | Ga0207648_10134919 | 3300026089 | Bacteria | 2174 |
| 278 | Ga0207676_10048664 | 3300026095 | Bacteria | 3292 |
| 279 | Ga0207676_10161898 | 3300026095 | Bacteria | 1939 |
| 280 | Ga0207674_10000077 | 3300026116 | Bacteria | 104302 |
| 281 | Ga0207674_10026068 | 3300026116 | Bacteria | 6219 |
| 282 | Ga0207674_10065892 | 3300026116 | Bacteria | 3650 |
| 283 | Ga0207674_10127765 | 3300026116 | Bacteria | 2506 |
| 284 | Ga0207674_10381028 | 3300026116 | Bacteria | 1363 |
| 285 | Ga0207675_100016289 | 3300026118 | Bacteria | 6939 |
| 286 | Ga0207675_100422281 | 3300026118 | Bacteria | 1317 |
| 287 | Ga0207683_10376654 | 3300026121 | Bacteria | 1304 |
| 288 | Ga0207698_10171082 | 3300026142 | Bacteria | 1913 |
| 289 | Ga0207428_10286003 | 3300027907 | Unclassified | 1223 |
| 290 | Ga0268266_10085782 | 3300028379 | Unclassified | 2752 |
| 291 | Ga0268265_10004224 | 3300028380 | Bacteria | 10032 |
| 292 | Ga0268264_10023059 | 3300028381 | Bacteria | 5079 |
| 293 | Ga0268264_10095807 | 3300028381 | Bacteria | 2569 |
| 294 | Ga0268264_10192558 | 3300028381 | Bacteria | 1860 |
| 295 | Ga0268264_10402938 | 3300028381 | Bacteria | 1315 |
| 296 | Ga0307513_10002993 | 3300031456 | Bacteria | 23041 |
| 297 | Ga0307405_10004568 | 3300031731 | Bacteria | 6563 |
| 298 | Ga0307410_10013856 | 3300031852 | Bacteria | 4721 |
| 299 | Ga0307410_10104754 | 3300031852 | Bacteria | 2035 |
| 300 | Ga0307406_10003202 | 3300031901 | Bacteria | 8914 |
| 301 | Ga0307406_10196561 | 3300031901 | Bacteria | 1481 |
| 302 | Ga0307407_10001959 | 3300031903 | Bacteria | 7808 |
| 303 | Ga0307409_100078523 | 3300031995 | Bacteria | 2656 |
| 304 | Ga0307409_100188338 | 3300031995 | Bacteria | 1834 |
| 305 | Ga0307416_100009240 | 3300032002 | Bacteria | 6436 |
| 306 | Ga0307411_10011780 | 3300032005 | Bacteria | 4738 |
| 307 | Ga0307411_10133605 | 3300032005 | Bacteria | 1818 |
| 308 | Ga0307415_100001262 | 3300032126 | Bacteria | 11899 |
| 309 | Ga0307415_100055781 | 3300032126 | Bacteria | 2705 |
| 310 | Ga0373951_0000996 | 3300035091 | Bacteria | 7602 |
| 311 | Ga0373937_0308518 | 3300036401 | Bacteria | 1496 |
| 312 | Ga0395899_0231409 | 3300037312 | Unclassified | 1276 |
| 313 | Ga0395900_0091901 | 3300037418 | Bacteria | 3118 |
| 314 | Ga0395898_0060182 | 3300037466 | Bacteria | 3692 |
| 315 | Ga0395898_0147343 | 3300037466 | Bacteria | 2253 |
| 316 | Ga0395905_0001338 | 3300037471 | Bacteria | 30026 |
| 317 | Ga0395901_0043023 | 3300038443 | Bacteria | 4685 |
| 318 | Ga0242420_020635 | 3300038996 | Bacteria | 1174 |
| 319 | Ga0436365_0141476 | 3300039437 | Bacteria | 76344 |
| 320 | Ga0436365_0326416 | 3300039437 | Bacteria | 2321 |
| 321 | Ga0436365_0815906 | 3300039437 | Bacteria | 101407 |
| 322 | Ga0436365_1016548 | 3300039437 | Bacteria | 3016 |
| 323 | Ga0495632_0032176 | 3300046519 | Bacteria | 2705 |
| 324 | Ga0495668_0002577 | 3300046616 | Bacteria | 14709 |
| 325 | Ga0496104_0017683 | 3300048907 | Bacteria | 6499 |
| 326 | Ga0496108_0095144 | 3300048911 | Bacteria | 2536 |
| 327 | Ga0496109_0316381 | 3300048912 | Bacteria | 1473 |
| 328 | Ga0496112_0151882 | 3300048915 | Bacteria | 2283 |
| 329 | Ga0496112_0420629 | 3300048915 | Bacteria | 1275 |
| 330 | Ga0496112_0542482 | 3300048915 | Bacteria | 1097 |
| 331 | Ga0496113_0157930 | 3300048916 | Bacteria | 1792 |
| 332 | Ga0501299_001568 | 3300049522 | Bacteria | 2980 |
| 333 | Ga0501038_0007583 | 3300049574 | Bacteria | 10007 |
| 334 | Ga0501072_0015161 | 3300049588 | Bacteria | 5910 |
| 335 | Ga0501207_001759 | 3300049654 | Bacteria | 2740 |
| 336 | Ga0501209_007402 | 3300049656 | Bacteria | 2104 |
| 337 | Ga0501217_001083 | 3300049661 | Bacteria | 4952 |
| 338 | Ga0501223_000730 | 3300049663 | Bacteria | 7818 |
| 339 | Ga0501227_003908 | 3300049665 | Bacteria | 3218 |
| 340 | Ga0501230_001598 | 3300049667 | Bacteria | 2736 |
| 341 | Ga0501233_002253 | 3300049668 | Bacteria | 3381 |
| 342 | Ga0501252_006434 | 3300049682 | Unclassified | 1306 |
| 343 | Ga0501258_001096 | 3300049687 | Bacteria | 2115 |
| 344 | Ga0501221_013132 | 3300049704 | Bacteria | 1519 |
| 345 | Ga0501225_0000814 | 3300049705 | Bacteria | 9763 |
| 346 | Ga0501283_000398 | 3300049779 | Bacteria | 5802 |
| 347 | nmdc:mga05p37_10738_c1 | 3300050507 | Bacteria | 10871 |
| 348 | nmdc:mga05p37_161500_c1 | 3300050507 | Bacteria | 2736 |
| 349 | nmdc:mga05p37_75912_c1 | 3300050507 | Bacteria | 4137 |
| 350 | nmdc:mga09592_421187_c1 | 3300050508 | Unclassified | 1153 |
| 351 | nmdc:mga09592_61879_c1 | 3300050508 | Bacteria | 3166 |
| 352 | nmdc:mga08y16_188807_c1 | 3300050511 | Bacteria | 2138 |
| 353 | nmdc:mga08y16_60690_c1 | 3300050511 | Bacteria | 3949 |
| 354 | nmdc:mga08y16_60932_c1 | 3300050511 | Bacteria | 3940 |
| 355 | nmdc:mga0n895_108702_c1 | 3300050512 | Unclassified | 2788 |
| 356 | nmdc:mga0n895_27219_c1 | 3300050512 | Bacteria | 5428 |
| 357 | nmdc:mga0n895_52259_c1 | 3300050512 | Bacteria | 4010 |
| 358 | nmdc:mga0rr50_17949_c1 | 3300050513 | Bacteria | 4739 |
| 359 | nmdc:mga0a205_101788_c1 | 3300050515 | Bacteria | 2771 |
| 360 | nmdc:mga0a205_148763_c1 | 3300050515 | Bacteria | 2242 |
| 361 | Ga0500616_0029394 | 3300053153 | Bacteria | 3024 |
| 362 | Ga0530510_0013541 | 3300061734 | Bacteria | 5737 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014325 | Ga0163163_10066056 | Ga0163163_100660563 | 292 |
| 2 | 3300005468 | Ga0070707_100019950 | Ga0070707_1000199505 | 297 |
| 3 | 3300005471 | Ga0070698_100016813 | Ga0070698_1000168136 | 297 |
| 4 | 3300005518 | Ga0070699_100038680 | Ga0070699_1000386804 | 297 |
| 5 | 3300005467 | Ga0070706_100022461 | Ga0070706_1000224614 | 299 |
| 6 | 3300005471 | Ga0070698_100042189 | Ga0070698_1000421892 | 299 |
| 7 | 3300005549 | Ga0070704_100076882 | Ga0070704_1000768822 | 299 |
| 8 | 3300005719 | Ga0068861_100004966 | Ga0068861_1000049664 | 299 |
| 9 | 3300025910 | Ga0207684_10174213 | Ga0207684_101742131 | 299 |
| 10 | 3300026118 | Ga0207675_100016289 | Ga0207675_1000162895 | 299 |
| 11 | 3300006880 | Ga0075429_100049627 | Ga0075429_1000496273 | 303 |
| 12 | 3300036401 | Ga0373937_0308518 | Ga0373937_0308518_16_933 | 303 |
| 13 | 3300031731 | Ga0307405_10004568 | Ga0307405_100045683 | 307 |
| 14 | 3300031852 | Ga0307410_10013856 | Ga0307410_100138562 | 307 |
| 15 | 3300031901 | Ga0307406_10003202 | Ga0307406_100032023 | 307 |
| 16 | 3300031903 | Ga0307407_10001959 | Ga0307407_100019593 | 307 |
| 17 | 3300031995 | Ga0307409_100078523 | Ga0307409_1000785232 | 307 |
| 18 | 3300032002 | Ga0307416_100009240 | Ga0307416_1000092401 | 307 |
| 19 | 3300032005 | Ga0307411_10011780 | Ga0307411_100117803 | 307 |
| 20 | 3300032126 | Ga0307415_100001262 | Ga0307415_1000012625 | 307 |
| 21 | 3300049654 | Ga0501207_001759 | Ga0501207_001759_1614_2639 | 307 |
| 22 | 3300049656 | Ga0501209_007402 | Ga0501209_007402_349_1374 | 307 |
| 23 | 3300049661 | Ga0501217_001083 | Ga0501217_001083_2444_3469 | 307 |
| 24 | 3300049663 | Ga0501223_000730 | Ga0501223_000730_5544_6569 | 307 |
| 25 | 3300049665 | Ga0501227_003908 | Ga0501227_003908_2175_3200 | 307 |
| 26 | 3300049667 | Ga0501230_001598 | Ga0501230_001598_1019_2044 | 307 |
| 27 | 3300049668 | Ga0501233_002253 | Ga0501233_002253_2010_3035 | 307 |
| 28 | 3300049687 | Ga0501258_001096 | Ga0501258_001096_1003_2028 | 307 |
| 29 | 3300049704 | Ga0501221_013132 | Ga0501221_013132_178_1203 | 307 |
| 30 | 3300049705 | Ga0501225_0000814 | Ga0501225_0000814_2492_3517 | 307 |
| 31 | 3300009147 | Ga0114129_10235659 | Ga0114129_102356592 | 308 |
| 32 | 3300005843 | Ga0068860_100045843 | Ga0068860_1000458434 | 309 |
| 33 | 3300031995 | Ga0307409_100188338 | Ga0307409_1001883382 | 309 |
| 34 | 3300032005 | Ga0307411_10133605 | Ga0307411_101336052 | 309 |
| 35 | 3300005467 | Ga0070706_100001130 | Ga0070706_10000113012 | 312 |
| 36 | 3300005617 | Ga0068859_100531597 | Ga0068859_1005315972 | 312 |
| 37 | 3300006931 | Ga0097620_100531570 | Ga0097620_1005315701 | 312 |
| 38 | 3300025910 | Ga0207684_10000023 | Ga0207684_10000023262 | 312 |
| 39 | 3300037312 | Ga0395899_0231409 | Ga0395899_0231409_40_1068 | 313 |
| 40 | 3300037466 | Ga0395898_0147343 | Ga0395898_0147343_672_1700 | 313 |
| 41 | 3300026116 | Ga0207674_10381028 | Ga0207674_103810282 | 314 |
| 42 | 3300037466 | Ga0395898_0060182 | Ga0395898_0060182_1427_2452 | 314 |
| 43 | 3300005530 | Ga0070679_100107094 | Ga0070679_1001070942 | 315 |
| 44 | 3300005617 | Ga0068859_100023094 | Ga0068859_1000230944 | 315 |
| 45 | 3300006931 | Ga0097620_100023093 | Ga0097620_1000230934 | 315 |
| 46 | 3300009177 | Ga0105248_10043674 | Ga0105248_100436742 | 315 |
| 47 | 3300025921 | Ga0207652_10094694 | Ga0207652_100946942 | 315 |
| 48 | 3300025941 | Ga0207711_10031912 | Ga0207711_100319122 | 315 |
| 49 | 3300003203 | JGI25406J46586_10006350 | JGI25406J46586_100063503 | 317 |
| 50 | 3300005985 | Ga0081539_10001856 | Ga0081539_1000185614 | 317 |
| 51 | 3300025904 | Ga0207647_10056615 | Ga0207647_100566152 | 317 |
| 52 | 3300050507 | nmdc:mga05p37_161500_c1 | nmdc:mga05p37_161500_c1_47_1087 | 317 |
| 53 | 3300005353 | Ga0070669_100091213 | Ga0070669_1000912132 | 318 |
| 54 | 3300013308 | Ga0157375_10064624 | Ga0157375_100646244 | 318 |
| 55 | 3300025923 | Ga0207681_10061819 | Ga0207681_100618192 | 320 |
| 56 | 3300026142 | Ga0207698_10171082 | Ga0207698_101710822 | 320 |
| 57 | 3300005719 | Ga0068861_100030951 | Ga0068861_1000309512 | 322 |
| 58 | 3300009177 | Ga0105248_10049891 | Ga0105248_100498912 | 322 |
| 59 | 3300027907 | Ga0207428_10286003 | Ga0207428_102860031 | 322 |
| 60 | 3300006852 | Ga0075433_10062294 | Ga0075433_100622942 | 323 |
| 61 | 3300049588 | Ga0501072_0015161 | Ga0501072_0015161_2429_3427 | 324 |
| 62 | 3300005617 | Ga0068859_100028787 | Ga0068859_1000287871 | 325 |
| 63 | 3300006931 | Ga0097620_100028788 | Ga0097620_1000287884 | 325 |
| 64 | 3300025941 | Ga0207711_10311239 | Ga0207711_103112391 | 325 |
| 65 | 3300026088 | Ga0207641_10510701 | Ga0207641_105107011 | 326 |
| 66 | 3300031901 | Ga0307406_10196561 | Ga0307406_101965611 | 326 |
| 67 | 3300009545 | Ga0105237_10164716 | Ga0105237_101647162 | 329 |
| 68 | 3300028381 | Ga0268264_10095807 | Ga0268264_100958074 | 329 |
| 69 | 3300046616 | Ga0495668_0002577 | Ga0495668_0002577_8469_9479 | 330 |
| 70 | 3300005337 | Ga0070682_100208248 | Ga0070682_1002082481 | 331 |
| 71 | 3300005344 | Ga0070661_100017320 | Ga0070661_1000173202 | 331 |
| 72 | 3300005364 | Ga0070673_100163473 | Ga0070673_1001634732 | 331 |
| 73 | 3300005458 | Ga0070681_10023047 | Ga0070681_100230473 | 331 |
| 74 | 3300005530 | Ga0070679_100025103 | Ga0070679_1000251033 | 331 |
| 75 | 3300005539 | Ga0068853_100021755 | Ga0068853_1000217554 | 331 |
| 76 | 3300005564 | Ga0070664_100002805 | Ga0070664_1000028055 | 331 |
| 77 | 3300005577 | Ga0068857_100001851 | Ga0068857_10000185111 | 331 |
| 78 | 3300005578 | Ga0068854_100127177 | Ga0068854_1001271772 | 331 |
| 79 | 3300009174 | Ga0105241_10040281 | Ga0105241_100402812 | 331 |
| 80 | 3300013100 | Ga0157373_10014626 | Ga0157373_100146262 | 331 |
| 81 | 3300014325 | Ga0163163_10001675 | Ga0163163_1000167514 | 331 |
| 82 | 3300025920 | Ga0207649_10070174 | Ga0207649_100701742 | 331 |
| 83 | 3300025945 | Ga0207679_10014664 | Ga0207679_100146645 | 331 |
| 84 | 3300026041 | Ga0207639_10142317 | Ga0207639_101423172 | 331 |
| 85 | 3300026116 | Ga0207674_10000077 | Ga0207674_1000007764 | 331 |
| 86 | 3300005331 | Ga0070670_100134854 | Ga0070670_1001348542 | 333 |
| 87 | 3300005518 | Ga0070699_100000481 | Ga0070699_1000004816 | 335 |
| 88 | 3300021384 | Ga0213876_10000011 | Ga0213876_10000011261 | 335 |
| 89 | 3300039437 | Ga0436365_0141476 | Ga0436365_0141476_66992_68059 | 335 |
| 90 | 3300005295 | Ga0065707_10103551 | Ga0065707_101035512 | 336 |
| 91 | 3300009177 | Ga0105248_10056194 | Ga0105248_100561943 | 336 |
| 92 | 3300010375 | Ga0105239_10289313 | Ga0105239_102893132 | 336 |
| 93 | 3300005459 | Ga0068867_100176340 | Ga0068867_1001763401 | 337 |
| 94 | 3300005617 | Ga0068859_100596457 | Ga0068859_1005964571 | 337 |
| 95 | 3300006931 | Ga0097620_100596397 | Ga0097620_1005963971 | 337 |
| 96 | 3300009148 | Ga0105243_10013048 | Ga0105243_100130482 | 337 |
| 97 | 3300025935 | Ga0207709_10007875 | Ga0207709_100078752 | 337 |
| 98 | 3300026089 | Ga0207648_10134919 | Ga0207648_101349192 | 337 |
| 99 | 3300005347 | Ga0070668_100000595 | Ga0070668_10000059512 | 340 |
| 100 | 3300005719 | Ga0068861_100186433 | Ga0068861_1001864332 | 340 |
| 101 | 3300009148 | Ga0105243_10056736 | Ga0105243_100567362 | 340 |
| 102 | 3300009174 | Ga0105241_10052475 | Ga0105241_100524752 | 340 |
| 103 | 3300009177 | Ga0105248_10011627 | Ga0105248_100116277 | 340 |
| 104 | 3300009553 | Ga0105249_10000052 | Ga0105249_1000005267 | 340 |
| 105 | 3300013306 | Ga0163162_10000001 | Ga0163162_10000001579 | 340 |
| 106 | 3300014325 | Ga0163163_10014304 | Ga0163163_100143043 | 340 |
| 107 | 3300025935 | Ga0207709_10049344 | Ga0207709_100493442 | 340 |
| 108 | 3300025941 | Ga0207711_10196241 | Ga0207711_101962411 | 340 |
| 109 | 3300025961 | Ga0207712_10000062 | Ga0207712_100000629 | 340 |
| 110 | 3300025972 | Ga0207668_10000276 | Ga0207668_100002769 | 340 |
| 111 | 3300026089 | Ga0207648_10032036 | Ga0207648_100320363 | 340 |
| 112 | 3300026095 | Ga0207676_10048664 | Ga0207676_100486643 | 340 |
| 113 | 3300032126 | Ga0307415_100055781 | Ga0307415_1000557812 | 340 |
| 114 | 3300049522 | Ga0501299_001568 | Ga0501299_001568_1101_2123 | 340 |
| 115 | 3300049682 | Ga0501252_006434 | Ga0501252_006434_120_1142 | 340 |
| 116 | 3300049779 | Ga0501283_000398 | Ga0501283_000398_3966_4988 | 340 |
| 117 | 3300050512 | nmdc:mga0n895_52259_c1 | nmdc:mga0n895_52259_c1_1325_2347 | 340 |
| 118 | 3300003322 | rootL2_10012479 | rootL2_100124793 | 341 |
| 119 | 3300005290 | Ga0065712_10012011 | Ga0065712_100120113 | 341 |
| 120 | 3300005293 | Ga0065715_10101436 | Ga0065715_101014362 | 341 |
| 121 | 3300005334 | Ga0068869_100040606 | Ga0068869_1000406061 | 341 |
| 122 | 3300005338 | Ga0068868_100045467 | Ga0068868_1000454674 | 341 |
| 123 | 3300005354 | Ga0070675_100164876 | Ga0070675_1001648762 | 341 |
| 124 | 3300005355 | Ga0070671_100289582 | Ga0070671_1002895822 | 341 |
| 125 | 3300005365 | Ga0070688_100095165 | Ga0070688_1000951651 | 341 |
| 126 | 3300005440 | Ga0070705_100124110 | Ga0070705_1001241102 | 341 |
| 127 | 3300005441 | Ga0070700_100000160 | Ga0070700_10000016017 | 341 |
| 128 | 3300005458 | Ga0070681_10137706 | Ga0070681_101377062 | 341 |
| 129 | 3300005458 | Ga0070681_10460073 | Ga0070681_104600731 | 341 |
| 130 | 3300005536 | Ga0070697_100007202 | Ga0070697_1000072022 | 341 |
| 131 | 3300005545 | Ga0070695_100021884 | Ga0070695_1000218843 | 341 |
| 132 | 3300005547 | Ga0070693_100035858 | Ga0070693_1000358582 | 341 |
| 133 | 3300005841 | Ga0068863_100443611 | Ga0068863_1004436111 | 341 |
| 134 | 3300005985 | Ga0081539_10000600 | Ga0081539_1000060052 | 341 |
| 135 | 3300005985 | Ga0081539_10000749 | Ga0081539_100007491 | 341 |
| 136 | 3300005985 | Ga0081539_10001510 | Ga0081539_100015108 | 341 |
| 137 | 3300006852 | Ga0075433_10172935 | Ga0075433_101729352 | 341 |
| 138 | 3300009094 | Ga0111539_10008617 | Ga0111539_1000861712 | 341 |
| 139 | 3300009147 | Ga0114129_10158403 | Ga0114129_101584032 | 341 |
| 140 | 3300021384 | Ga0213876_10000916 | Ga0213876_100009168 | 341 |
| 141 | 3300025903 | Ga0207680_10140891 | Ga0207680_101408911 | 341 |
| 142 | 3300025912 | Ga0207707_10099013 | Ga0207707_100990131 | 341 |
| 143 | 3300025912 | Ga0207707_10112944 | Ga0207707_101129442 | 341 |
| 144 | 3300025927 | Ga0207687_10321281 | Ga0207687_103212811 | 341 |
| 145 | 3300025960 | Ga0207651_10041258 | Ga0207651_100412582 | 341 |
| 146 | 3300026023 | Ga0207677_10153200 | Ga0207677_101532001 | 341 |
| 147 | 3300026041 | Ga0207639_10211957 | Ga0207639_102119572 | 341 |
| 148 | 3300026075 | Ga0207708_10000108 | Ga0207708_1000010846 | 341 |
| 149 | 3300026075 | Ga0207708_10113788 | Ga0207708_101137881 | 341 |
| 150 | 3300026088 | Ga0207641_10190272 | Ga0207641_101902722 | 341 |
| 151 | 3300026095 | Ga0207676_10161898 | Ga0207676_101618982 | 341 |
| 152 | 3300026121 | Ga0207683_10376654 | Ga0207683_103766542 | 341 |
| 153 | 3300028379 | Ga0268266_10085782 | Ga0268266_100857822 | 341 |
| 154 | 3300028381 | Ga0268264_10402938 | Ga0268264_104029381 | 341 |
| 155 | 3300031456 | Ga0307513_10002993 | Ga0307513_1000299312 | 341 |
| 156 | 3300031852 | Ga0307410_10104754 | Ga0307410_101047542 | 341 |
| 157 | 3300037471 | Ga0395905_0001338 | Ga0395905_0001338_1582_2610 | 341 |
| 158 | 3300039437 | Ga0436365_0326416 | Ga0436365_0326416_154_1179 | 341 |
| 159 | 3300039437 | Ga0436365_0815906 | Ga0436365_0815906_7193_8260 | 341 |
| 160 | 3300039437 | Ga0436365_1016548 | Ga0436365_1016548_1847_2872 | 341 |
| 161 | 3300046519 | Ga0495632_0032176 | Ga0495632_0032176_1157_2182 | 341 |
| 162 | 3300048915 | Ga0496112_0151882 | Ga0496112_0151882_141_1166 | 341 |
| 163 | 3300048915 | Ga0496112_0542482 | Ga0496112_0542482_12_1037 | 341 |
| 164 | 3300048916 | Ga0496113_0157930 | Ga0496113_0157930_165_1190 | 341 |
| 165 | 3300049574 | Ga0501038_0007583 | Ga0501038_0007583_3793_4818 | 341 |
| 166 | 3300050511 | nmdc:mga08y16_60932_c1 | nmdc:mga08y16_60932_c1_1850_2875 | 341 |
| 167 | 3300053153 | Ga0500616_0029394 | Ga0500616_0029394_1430_2455 | 341 |
| 168 | 3300005288 | Ga0065714_10002185 | Ga0065714_1000218586 | 342 |
| 169 | 3300005290 | Ga0065712_10067734 | Ga0065712_1006773475 | 342 |
| 170 | 3300005293 | Ga0065715_10002626 | Ga0065715_100026264 | 342 |
| 171 | 3300005293 | Ga0065715_10089026 | Ga0065715_100890269 | 342 |
| 172 | 3300005293 | Ga0065715_10108046 | Ga0065715_101080462 | 342 |
| 173 | 3300005295 | Ga0065707_10100907 | Ga0065707_101009072 | 342 |
| 174 | 3300005331 | Ga0070670_100000431 | Ga0070670_10000043129 | 342 |
| 175 | 3300005334 | Ga0068869_100106852 | Ga0068869_1001068522 | 342 |
| 176 | 3300005337 | Ga0070682_100032942 | Ga0070682_1000329421 | 342 |
| 177 | 3300005343 | Ga0070687_100006633 | Ga0070687_1000066332 | 342 |
| 178 | 3300005345 | Ga0070692_10009801 | Ga0070692_100098012 | 342 |
| 179 | 3300005353 | Ga0070669_100020933 | Ga0070669_1000209333 | 342 |
| 180 | 3300005353 | Ga0070669_100048908 | Ga0070669_1000489082 | 342 |
| 181 | 3300005364 | Ga0070673_100170250 | Ga0070673_1001702501 | 342 |
| 182 | 3300005459 | Ga0068867_100012436 | Ga0068867_1000124361 | 342 |
| 183 | 3300005539 | Ga0068853_100015614 | Ga0068853_1000156145 | 342 |
| 184 | 3300005544 | Ga0070686_100003666 | Ga0070686_1000036663 | 342 |
| 185 | 3300005545 | Ga0070695_100039050 | Ga0070695_1000390501 | 342 |
| 186 | 3300005546 | Ga0070696_100233613 | Ga0070696_1002336132 | 342 |
| 187 | 3300005547 | Ga0070693_100020679 | Ga0070693_1000206792 | 342 |
| 188 | 3300005547 | Ga0070693_100058724 | Ga0070693_1000587242 | 342 |
| 189 | 3300005549 | Ga0070704_100024404 | Ga0070704_1000244041 | 342 |
| 190 | 3300005564 | Ga0070664_100190613 | Ga0070664_1001906132 | 342 |
| 191 | 3300005577 | Ga0068857_100032072 | Ga0068857_1000320724 | 342 |
| 192 | 3300005578 | Ga0068854_100134669 | Ga0068854_1001346692 | 342 |
| 193 | 3300005615 | Ga0070702_100070872 | Ga0070702_1000708721 | 342 |
| 194 | 3300005617 | Ga0068859_100332901 | Ga0068859_1003329012 | 342 |
| 195 | 3300005840 | Ga0068870_10070135 | Ga0068870_100701352 | 342 |
| 196 | 3300005842 | Ga0068858_100070209 | Ga0068858_1000702092 | 342 |
| 197 | 3300005842 | Ga0068858_100070340 | Ga0068858_1000703402 | 342 |
| 198 | 3300005844 | Ga0068862_100007744 | Ga0068862_1000077444 | 342 |
| 199 | 3300006237 | Ga0097621_100000726 | Ga0097621_10000072615 | 342 |
| 200 | 3300006358 | Ga0068871_100320339 | Ga0068871_1003203391 | 342 |
| 201 | 3300006881 | Ga0068865_100083434 | Ga0068865_1000834341 | 342 |
| 202 | 3300006931 | Ga0097620_100332912 | Ga0097620_1003329122 | 342 |
| 203 | 3300007076 | Ga0075435_100010259 | Ga0075435_1000102594 | 342 |
| 204 | 3300009011 | Ga0105251_10093271 | Ga0105251_100932712 | 342 |
| 205 | 3300009094 | Ga0111539_10195442 | Ga0111539_101954422 | 342 |
| 206 | 3300009101 | Ga0105247_10021803 | Ga0105247_100218033 | 342 |
| 207 | 3300009147 | Ga0114129_10219070 | Ga0114129_102190702 | 342 |
| 208 | 3300009148 | Ga0105243_10097223 | Ga0105243_100972232 | 342 |
| 209 | 3300009177 | Ga0105248_10436732 | Ga0105248_104367322 | 342 |
| 210 | 3300009545 | Ga0105237_10060401 | Ga0105237_100604012 | 342 |
| 211 | 3300009551 | Ga0105238_10016755 | Ga0105238_100167553 | 342 |
| 212 | 3300011119 | Ga0105246_10082637 | Ga0105246_100826371 | 342 |
| 213 | 3300013100 | Ga0157373_10006441 | Ga0157373_100064415 | 342 |
| 214 | 3300013297 | Ga0157378_10021433 | Ga0157378_100214334 | 342 |
| 215 | 3300013297 | Ga0157378_10056346 | Ga0157378_100563462 | 342 |
| 216 | 3300013306 | Ga0163162_10061108 | Ga0163162_100611083 | 342 |
| 217 | 3300013308 | Ga0157375_10018807 | Ga0157375_100188072 | 342 |
| 218 | 3300013308 | Ga0157375_10350606 | Ga0157375_103506062 | 342 |
| 219 | 3300014326 | Ga0157380_10005354 | Ga0157380_100053544 | 342 |
| 220 | 3300025900 | Ga0207710_10002251 | Ga0207710_100022515 | 342 |
| 221 | 3300025923 | Ga0207681_10004999 | Ga0207681_100049993 | 342 |
| 222 | 3300025923 | Ga0207681_10050526 | Ga0207681_100505262 | 342 |
| 223 | 3300025924 | Ga0207694_10019991 | Ga0207694_100199913 | 342 |
| 224 | 3300025933 | Ga0207706_10083489 | Ga0207706_100834892 | 342 |
| 225 | 3300025945 | Ga0207679_10039465 | Ga0207679_100394653 | 342 |
| 226 | 3300026035 | Ga0207703_10056373 | Ga0207703_100563733 | 342 |
| 227 | 3300026041 | Ga0207639_10007465 | Ga0207639_100074656 | 342 |
| 228 | 3300026075 | Ga0207708_10003622 | Ga0207708_100036228 | 342 |
| 229 | 3300026075 | Ga0207708_10012701 | Ga0207708_100127012 | 342 |
| 230 | 3300026088 | Ga0207641_10430134 | Ga0207641_104301341 | 342 |
| 231 | 3300026116 | Ga0207674_10026068 | Ga0207674_100260685 | 342 |
| 232 | 3300026116 | Ga0207674_10065892 | Ga0207674_100658923 | 342 |
| 233 | 3300026116 | Ga0207674_10127765 | Ga0207674_101277652 | 342 |
| 234 | 3300026118 | Ga0207675_100422281 | Ga0207675_1004222811 | 342 |
| 235 | 3300028380 | Ga0268265_10004224 | Ga0268265_100042243 | 342 |
| 236 | 3300028381 | Ga0268264_10192558 | Ga0268264_101925582 | 342 |
| 237 | 3300035091 | Ga0373951_0000996 | Ga0373951_0000996_2614_3642 | 342 |
| 238 | 3300048912 | Ga0496109_0316381 | Ga0496109_0316381_358_1389 | 342 |
| 239 | 3300048915 | Ga0496112_0420629 | Ga0496112_0420629_203_1237 | 342 |
| 240 | 3300050511 | nmdc:mga08y16_188807_c1 | nmdc:mga08y16_188807_c1_648_1679 | 342 |
| 241 | 3300050513 | nmdc:mga0rr50_17949_c1 | nmdc:mga0rr50_17949_c1_2656_3684 | 342 |
| 242 | 3300005330 | Ga0070690_100024791 | Ga0070690_1000247913 | 343 |
| 243 | 3300005336 | Ga0070680_100000639 | Ga0070680_10000063915 | 343 |
| 244 | 3300005336 | Ga0070680_100021395 | Ga0070680_1000213955 | 343 |
| 245 | 3300005337 | Ga0070682_100022469 | Ga0070682_1000224692 | 343 |
| 246 | 3300005338 | Ga0068868_100272978 | Ga0068868_1002729781 | 343 |
| 247 | 3300005356 | Ga0070674_100121358 | Ga0070674_1001213582 | 343 |
| 248 | 3300005364 | Ga0070673_100005632 | Ga0070673_1000056322 | 343 |
| 249 | 3300005441 | Ga0070700_100010444 | Ga0070700_1000104445 | 343 |
| 250 | 3300005444 | Ga0070694_100005312 | Ga0070694_1000053128 | 343 |
| 251 | 3300005444 | Ga0070694_100011705 | Ga0070694_1000117052 | 343 |
| 252 | 3300005445 | Ga0070708_100004115 | Ga0070708_1000041153 | 343 |
| 253 | 3300005458 | Ga0070681_10000997 | Ga0070681_1000099715 | 343 |
| 254 | 3300005467 | Ga0070706_100058863 | Ga0070706_1000588632 | 343 |
| 255 | 3300005468 | Ga0070707_100007100 | Ga0070707_1000071002 | 343 |
| 256 | 3300005468 | Ga0070707_100289325 | Ga0070707_1002893252 | 343 |
| 257 | 3300005471 | Ga0070698_100004637 | Ga0070698_1000046376 | 343 |
| 258 | 3300005471 | Ga0070698_100034813 | Ga0070698_1000348134 | 343 |
| 259 | 3300005518 | Ga0070699_100004117 | Ga0070699_1000041172 | 343 |
| 260 | 3300005518 | Ga0070699_100105067 | Ga0070699_1001050672 | 343 |
| 261 | 3300005518 | Ga0070699_100474367 | Ga0070699_1004743671 | 343 |
| 262 | 3300005530 | Ga0070679_100000972 | Ga0070679_10000097215 | 343 |
| 263 | 3300005539 | Ga0068853_100136115 | Ga0068853_1001361151 | 343 |
| 264 | 3300005543 | Ga0070672_100073092 | Ga0070672_1000730922 | 343 |
| 265 | 3300005545 | Ga0070695_100061687 | Ga0070695_1000616872 | 343 |
| 266 | 3300005547 | Ga0070693_100168540 | Ga0070693_1001685401 | 343 |
| 267 | 3300005548 | Ga0070665_100069719 | Ga0070665_1000697192 | 343 |
| 268 | 3300005549 | Ga0070704_100006875 | Ga0070704_1000068754 | 343 |
| 269 | 3300005577 | Ga0068857_100233624 | Ga0068857_1002336242 | 343 |
| 270 | 3300005614 | Ga0068856_100016133 | Ga0068856_1000161335 | 343 |
| 271 | 3300005615 | Ga0070702_100056523 | Ga0070702_1000565231 | 343 |
| 272 | 3300005617 | Ga0068859_100121853 | Ga0068859_1001218531 | 343 |
| 273 | 3300005617 | Ga0068859_100284022 | Ga0068859_1002840222 | 343 |
| 274 | 3300005618 | Ga0068864_100005794 | Ga0068864_1000057947 | 343 |
| 275 | 3300005719 | Ga0068861_100424037 | Ga0068861_1004240372 | 343 |
| 276 | 3300005842 | Ga0068858_100059353 | Ga0068858_1000593533 | 343 |
| 277 | 3300005842 | Ga0068858_100059836 | Ga0068858_1000598362 | 343 |
| 278 | 3300005843 | Ga0068860_100018078 | Ga0068860_1000180786 | 343 |
| 279 | 3300005843 | Ga0068860_100056386 | Ga0068860_1000563862 | 343 |
| 280 | 3300005843 | Ga0068860_100077323 | Ga0068860_1000773232 | 343 |
| 281 | 3300005844 | Ga0068862_100008676 | Ga0068862_1000086768 | 343 |
| 282 | 3300005844 | Ga0068862_100323498 | Ga0068862_1003234981 | 343 |
| 283 | 3300006237 | Ga0097621_100032100 | Ga0097621_1000321002 | 343 |
| 284 | 3300006358 | Ga0068871_100005917 | Ga0068871_1000059174 | 343 |
| 285 | 3300006844 | Ga0075428_100034942 | Ga0075428_1000349425 | 343 |
| 286 | 3300006880 | Ga0075429_100072317 | Ga0075429_1000723172 | 343 |
| 287 | 3300006880 | Ga0075429_100169424 | Ga0075429_1001694242 | 343 |
| 288 | 3300006931 | Ga0097620_100121854 | Ga0097620_1001218541 | 343 |
| 289 | 3300006931 | Ga0097620_100284030 | Ga0097620_1002840302 | 343 |
| 290 | 3300009094 | Ga0111539_10008510 | Ga0111539_100085106 | 343 |
| 291 | 3300009094 | Ga0111539_10330001 | Ga0111539_103300012 | 343 |
| 292 | 3300009098 | Ga0105245_10416684 | Ga0105245_104166841 | 343 |
| 293 | 3300009147 | Ga0114129_10012013 | Ga0114129_100120138 | 343 |
| 294 | 3300009147 | Ga0114129_10028610 | Ga0114129_100286105 | 343 |
| 295 | 3300009147 | Ga0114129_10029492 | Ga0114129_100294923 | 343 |
| 296 | 3300009176 | Ga0105242_10046627 | Ga0105242_100466271 | 343 |
| 297 | 3300009176 | Ga0105242_10058595 | Ga0105242_100585951 | 343 |
| 298 | 3300009177 | Ga0105248_10012300 | Ga0105248_100123001 | 343 |
| 299 | 3300009177 | Ga0105248_10030639 | Ga0105248_100306395 | 343 |
| 300 | 3300009177 | Ga0105248_10086702 | Ga0105248_100867022 | 343 |
| 301 | 3300009177 | Ga0105248_10343490 | Ga0105248_103434901 | 343 |
| 302 | 3300009545 | Ga0105237_10003911 | Ga0105237_100039112 | 343 |
| 303 | 3300009551 | Ga0105238_10016297 | Ga0105238_100162975 | 343 |
| 304 | 3300009553 | Ga0105249_10004953 | Ga0105249_100049535 | 343 |
| 305 | 3300011119 | Ga0105246_10204327 | Ga0105246_102043271 | 343 |
| 306 | 3300013296 | Ga0157374_10023925 | Ga0157374_100239252 | 343 |
| 307 | 3300013297 | Ga0157378_10002174 | Ga0157378_100021741 | 343 |
| 308 | 3300013297 | Ga0157378_10017189 | Ga0157378_100171894 | 343 |
| 309 | 3300013306 | Ga0163162_10023056 | Ga0163162_100230565 | 343 |
| 310 | 3300013306 | Ga0163162_10030634 | Ga0163162_100306343 | 343 |
| 311 | 3300013306 | Ga0163162_10259551 | Ga0163162_102595512 | 343 |
| 312 | 3300013308 | Ga0157375_10005551 | Ga0157375_100055515 | 343 |
| 313 | 3300013308 | Ga0157375_10025765 | Ga0157375_100257654 | 343 |
| 314 | 3300013308 | Ga0157375_10146651 | Ga0157375_101466511 | 343 |
| 315 | 3300014325 | Ga0163163_10001133 | Ga0163163_1000113317 | 343 |
| 316 | 3300014325 | Ga0163163_10001165 | Ga0163163_1000116514 | 343 |
| 317 | 3300014325 | Ga0163163_10007396 | Ga0163163_100073961 | 343 |
| 318 | 3300014325 | Ga0163163_10250572 | Ga0163163_102505722 | 343 |
| 319 | 3300014325 | Ga0163163_10531088 | Ga0163163_105310881 | 343 |
| 320 | 3300014326 | Ga0157380_10287358 | Ga0157380_102873581 | 343 |
| 321 | 3300014745 | Ga0157377_10034549 | Ga0157377_100345491 | 343 |
| 322 | 3300017792 | Ga0163161_10092670 | Ga0163161_100926702 | 343 |
| 323 | 3300025885 | Ga0207653_10002203 | Ga0207653_100022035 | 343 |
| 324 | 3300025910 | Ga0207684_10008916 | Ga0207684_100089162 | 343 |
| 325 | 3300025912 | Ga0207707_10000072 | Ga0207707_1000007264 | 343 |
| 326 | 3300025914 | Ga0207671_10002971 | Ga0207671_100029712 | 343 |
| 327 | 3300025917 | Ga0207660_10023592 | Ga0207660_100235924 | 343 |
| 328 | 3300025918 | Ga0207662_10008320 | Ga0207662_100083205 | 343 |
| 329 | 3300025918 | Ga0207662_10213824 | Ga0207662_102138241 | 343 |
| 330 | 3300025921 | Ga0207652_10000083 | Ga0207652_1000008315 | 343 |
| 331 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001633 | 343 |
| 332 | 3300025931 | Ga0207644_10062899 | Ga0207644_100628991 | 343 |
| 333 | 3300025940 | Ga0207691_10201847 | Ga0207691_102018472 | 343 |
| 334 | 3300025941 | Ga0207711_10367501 | Ga0207711_103675011 | 343 |
| 335 | 3300025942 | Ga0207689_10000667 | Ga0207689_1000066712 | 343 |
| 336 | 3300025942 | Ga0207689_10014518 | Ga0207689_100145186 | 343 |
| 337 | 3300025960 | Ga0207651_10003215 | Ga0207651_100032152 | 343 |
| 338 | 3300025960 | Ga0207651_10101462 | Ga0207651_101014622 | 343 |
| 339 | 3300025961 | Ga0207712_10025647 | Ga0207712_100256473 | 343 |
| 340 | 3300025986 | Ga0207658_10063485 | Ga0207658_100634852 | 343 |
| 341 | 3300026041 | Ga0207639_10075436 | Ga0207639_100754361 | 343 |
| 342 | 3300026075 | Ga0207708_10085610 | Ga0207708_100856102 | 343 |
| 343 | 3300026078 | Ga0207702_10042832 | Ga0207702_100428321 | 343 |
| 344 | 3300026089 | Ga0207648_10007488 | Ga0207648_100074888 | 343 |
| 345 | 3300028381 | Ga0268264_10023059 | Ga0268264_100230591 | 343 |
| 346 | 3300037418 | Ga0395900_0091901 | Ga0395900_0091901_1484_2515 | 343 |
| 347 | 3300038443 | Ga0395901_0043023 | Ga0395901_0043023_1134_2165 | 343 |
| 348 | 3300038996 | Ga0242420_020635 | Ga0242420_020635_15_1052 | 343 |
| 349 | 3300048907 | Ga0496104_0017683 | Ga0496104_0017683_1685_2722 | 343 |
| 350 | 3300048911 | Ga0496108_0095144 | Ga0496108_0095144_202_1239 | 343 |
| 351 | 3300050507 | nmdc:mga05p37_10738_c1 | nmdc:mga05p37_10738_c1_1444_2478 | 343 |
| 352 | 3300050507 | nmdc:mga05p37_75912_c1 | nmdc:mga05p37_75912_c1_1195_2259 | 343 |
| 353 | 3300050508 | nmdc:mga09592_421187_c1 | nmdc:mga09592_421187_c1_17_1081 | 343 |
| 354 | 3300050508 | nmdc:mga09592_61879_c1 | nmdc:mga09592_61879_c1_1778_2815 | 343 |
| 355 | 3300050511 | nmdc:mga08y16_60690_c1 | nmdc:mga08y16_60690_c1_2426_3460 | 343 |
| 356 | 3300050512 | nmdc:mga0n895_108702_c1 | nmdc:mga0n895_108702_c1_931_1968 | 343 |
| 357 | 3300050512 | nmdc:mga0n895_27219_c1 | nmdc:mga0n895_27219_c1_667_1701 | 343 |
| 358 | 3300050515 | nmdc:mga0a205_101788_c1 | nmdc:mga0a205_101788_c1_1038_2075 | 343 |
| 359 | 3300050515 | nmdc:mga0a205_148763_c1 | nmdc:mga0a205_148763_c1_35_1072 | 343 |
| 360 | 3300061734 | Ga0530510_0013541 | Ga0530510_0013541_2517_3551 | 343 |
| 361 | 3300000532 | CNAas_1001564 | CNAas_10015641 | 345 |
| 362 | 3300009177 | Ga0105248_10103591 | Ga0105248_101035913 | 345 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tov-assembly1.cif.gz_A | the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 | 0.8634 | 3 | 332 |
| 3tov-assembly2.cif.gz_B | the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 | 0.8571 | 8 | 332 |
| 6dfe-assembly1.cif.gz_A | the structure of a ternary complex of e. coli waac | 0.8465 | 9 | 330 |
| 6dfe-assembly1.cif.gz_A | the structure of a ternary complex of e. coli waac | 0.8319 | 9 | 330 |
| 2h1h-assembly2.cif.gz_B | e. coli heptosyltransferase waac with adp-2-deoxy-2-fluoro heptose | 0.8287 | 9 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25742_154_333_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8947 | 173 | 333 | 3.40.50.2000 |
| 3tovB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8892 | 171 | 332 | 3.40.50.2000 |
| af_P25742_1_146_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8638 | 18 | 163 | 3.40.50.2000 |
| af_P25742_1_146_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8368 | 18 | 163 | 3.40.50.2000 |
| 1pswA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8339 | 10 | 153 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H0LDX4-F1-model_v4 | lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) | 0.9211 | 6 | 291 |
GO:0005829
GO:0008713 GO:0009244 |
| AF-A0A7X3UG91-F1-model_v4 | Glycosyltransferase family 9 protein | 0.9176 | 5 | 311 |
GO:0005829
GO:0008713 GO:0009244 |
| AF-A0A7X7J4G6-F1-model_v4 | Lipopolysaccharide heptosyltransferase 1 (EC 2.4.99.23) (EC 2.4.99.24) (ADP-heptose:lipopolysaccharide heptosyltransferase I) | 0.9161 | 6 | 292 |
GO:0005829
GO:0005886 GO:0008713 GO:0009244 |
| AF-A0A661JFP8-F1-model_v4 | Lipopolysaccharide heptosyltransferase family protein | 0.9154 | 188 | 332 |
GO:0005829
GO:0008713 GO:0009244 |
| AF-A0A4R8HLJ7-F1-model_v4 | Heptosyltransferase-1 | 0.9143 | 9 | 333 |
GO:0005829
GO:0008713 GO:0009244 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar