F422542

General Info

Members Datasets Scaffolds Average Seq Length
362 179 362 338

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100424037|Ga0068861_1004240372
Length 364
Sequence VIYAQLEPKISGQVSLPVHFDPRNILIIDFGQLGDVVLSLPALKAIRKRFPDARLTVAVGKPGGQIVTLSGFANEVIEVDRVSLRDGSKLVSIARIFRLVGKVRQAKFDFVIDLHSLSETNLLGFLSGAPQRLFAQRPGRSIDYLGNFKPKPPAESSSDHLVDRYLKVLQPLGIENPSRYPLLKTSNAGDRHIEALLKKQKAHSNTLLVGLFPGAGHEGRRWPMERFAELADFLIRNDRVRVIVFAGPEERALIPQLKTLFPATTIFLDQLTIEQLASAQARLTLFISNDTGPMHIAAAVGTPVITLLDRPTPNSFVPIGEHHKVIGGPTIQHITVEQVYSVAHETLANSRTENLFSIAKNADE

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
161 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
164 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
165 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
168 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
169 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 1.93
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1001564 3300000532 Unclassified 1889
2 JGI25406J46586_10006350 3300003203 Bacteria 5452
3 rootL2_10012479 3300003322 Bacteria 6906
4 Ga0065714_10002185 3300005288 Bacteria 199213
5 Ga0065712_10012011 3300005290 Bacteria 4494
6 Ga0065712_10067734 3300005290 Bacteria 110577
7 Ga0065715_10002626 3300005293 Bacteria 6294
8 Ga0065715_10089026 3300005293 Bacteria 16364
9 Ga0065715_10101436 3300005293 Bacteria 3190
10 Ga0065715_10108046 3300005293 Bacteria 2739
11 Ga0065707_10100907 3300005295 Bacteria 2896
12 Ga0065707_10103551 3300005295 Bacteria 2742
13 Ga0070690_100024791 3300005330 Bacteria 3692
14 Ga0070670_100000431 3300005331 Bacteria 34518
15 Ga0070670_100134854 3300005331 Bacteria 2133
16 Ga0068869_100040606 3300005334 Bacteria 3328
17 Ga0068869_100106852 3300005334 Bacteria 2124
18 Ga0070680_100000639 3300005336 Bacteria 24354
19 Ga0070680_100021395 3300005336 Bacteria 5141
20 Ga0070682_100022469 3300005337 Bacteria 3737
21 Ga0070682_100032942 3300005337 Bacteria 3145
22 Ga0070682_100208248 3300005337 Bacteria 1384
23 Ga0068868_100045467 3300005338 Bacteria 3435
24 Ga0068868_100272978 3300005338 Archaea 1429
25 Ga0070687_100006633 3300005343 Bacteria 4757
26 Ga0070661_100017320 3300005344 Bacteria 5111
27 Ga0070692_10009801 3300005345 Bacteria 4336
28 Ga0070668_100000595 3300005347 Bacteria 24239
29 Ga0070669_100020933 3300005353 Bacteria 4673
30 Ga0070669_100048908 3300005353 Bacteria 3087
31 Ga0070669_100091213 3300005353 Bacteria 2285
32 Ga0070675_100164876 3300005354 Bacteria 1908
33 Ga0070671_100289582 3300005355 Unclassified 1394
34 Ga0070674_100121358 3300005356 Bacteria 1935
35 Ga0070673_100005632 3300005364 Bacteria 8040
36 Ga0070673_100163473 3300005364 Unclassified 1895
37 Ga0070673_100170250 3300005364 Bacteria 1859
38 Ga0070688_100095165 3300005365 Bacteria 1954
39 Ga0070705_100124110 3300005440 Bacteria 1673
40 Ga0070700_100000160 3300005441 Bacteria 38863
41 Ga0070700_100010444 3300005441 Bacteria 5128
42 Ga0070694_100005312 3300005444 Bacteria 7789
43 Ga0070694_100011705 3300005444 Bacteria 5435
44 Ga0070708_100004115 3300005445 Bacteria 11416
45 Ga0070681_10000997 3300005458 Bacteria 23962
46 Ga0070681_10023047 3300005458 Bacteria 6261
47 Ga0070681_10137706 3300005458 Bacteria 2371
48 Ga0070681_10460073 3300005458 Bacteria 1185
49 Ga0068867_100012436 3300005459 Bacteria 6022
50 Ga0068867_100176340 3300005459 Bacteria 1696
51 Ga0070706_100001130 3300005467 Bacteria 28845
52 Ga0070706_100022461 3300005467 Bacteria 5806
53 Ga0070706_100058863 3300005467 Bacteria 3545
54 Ga0070707_100007100 3300005468 Bacteria 10385
55 Ga0070707_100019950 3300005468 Bacteria 6319
56 Ga0070707_100289325 3300005468 Bacteria 1592
57 Ga0070698_100004637 3300005471 Bacteria 15109
58 Ga0070698_100016813 3300005471 Bacteria 7716
59 Ga0070698_100034813 3300005471 Bacteria 5210
60 Ga0070698_100042189 3300005471 Bacteria 4680
61 Ga0070699_100000481 3300005518 Bacteria 38015
62 Ga0070699_100004117 3300005518 Bacteria 12854
63 Ga0070699_100038680 3300005518 Bacteria 4130
64 Ga0070699_100105067 3300005518 Bacteria 2477
65 Ga0070699_100474367 3300005518 Unclassified 1135
66 Ga0070679_100000972 3300005530 Bacteria 24934
67 Ga0070679_100025103 3300005530 Bacteria 5845
68 Ga0070679_100107094 3300005530 Bacteria 2781
69 Ga0070697_100007202 3300005536 Bacteria 8650
70 Ga0068853_100015614 3300005539 Bacteria 6238
71 Ga0068853_100021755 3300005539 Bacteria 5350
72 Ga0068853_100136115 3300005539 Unclassified 2202
73 Ga0070672_100073092 3300005543 Bacteria 2732
74 Ga0070686_100003666 3300005544 Bacteria 8433
75 Ga0070695_100021884 3300005545 Bacteria 3917
76 Ga0070695_100039050 3300005545 Bacteria 2998
77 Ga0070695_100061687 3300005545 Bacteria 2433
78 Ga0070696_100233613 3300005546 Unclassified 1384
79 Ga0070693_100020679 3300005547 Bacteria 3476
80 Ga0070693_100035858 3300005547 Bacteria 2754
81 Ga0070693_100058724 3300005547 Bacteria 2228
82 Ga0070693_100168540 3300005547 Bacteria 1400
83 Ga0070665_100069719 3300005548 Bacteria 3524
84 Ga0070704_100006875 3300005549 Bacteria 6738
85 Ga0070704_100024404 3300005549 Bacteria 3967
86 Ga0070704_100076882 3300005549 Bacteria 2443
87 Ga0070664_100002805 3300005564 Bacteria 14080
88 Ga0070664_100190613 3300005564 Bacteria 1826
89 Ga0068857_100001851 3300005577 Bacteria 17036
90 Ga0068857_100032072 3300005577 Bacteria 4644
91 Ga0068857_100233624 3300005577 Bacteria 1682
92 Ga0068854_100127177 3300005578 Bacteria 1942
93 Ga0068854_100134669 3300005578 Bacteria 1890
94 Ga0068856_100016133 3300005614 Bacteria 7222
95 Ga0070702_100056523 3300005615 Bacteria 2266
96 Ga0070702_100070872 3300005615 Bacteria 2059
97 Ga0068859_100023094 3300005617 Bacteria 6238
98 Ga0068859_100028787 3300005617 Bacteria 5570
99 Ga0068859_100121853 3300005617 Bacteria 2674
100 Ga0068859_100284022 3300005617 Bacteria 1748
101 Ga0068859_100332901 3300005617 Bacteria 1612
102 Ga0068859_100531597 3300005617 Bacteria 1271
103 Ga0068859_100596457 3300005617 Unclassified 1198
104 Ga0068864_100005794 3300005618 Bacteria 10135
105 Ga0068861_100004966 3300005719 Bacteria 8960
106 Ga0068861_100030951 3300005719 Bacteria 3926
107 Ga0068861_100186433 3300005719 Bacteria 1731
108 Ga0068861_100424037 3300005719 Bacteria 1186
109 Ga0068870_10070135 3300005840 Bacteria 1909
110 Ga0068863_100443611 3300005841 Bacteria 1273
111 Ga0068858_100059353 3300005842 Bacteria 3536
112 Ga0068858_100059836 3300005842 Bacteria 3521
113 Ga0068858_100070209 3300005842 Bacteria 3246
114 Ga0068858_100070340 3300005842 Bacteria 3244
115 Ga0068860_100018078 3300005843 Bacteria 6865
116 Ga0068860_100045843 3300005843 Bacteria 4169
117 Ga0068860_100056386 3300005843 Bacteria 3736
118 Ga0068860_100077323 3300005843 Bacteria 3164
119 Ga0068862_100007744 3300005844 Bacteria 8883
120 Ga0068862_100008676 3300005844 Bacteria 8407
121 Ga0068862_100323498 3300005844 Bacteria 1424
122 Ga0081539_10000600 3300005985 Bacteria 73358
123 Ga0081539_10000749 3300005985 Bacteria 64587
124 Ga0081539_10001510 3300005985 Bacteria 39264
125 Ga0081539_10001856 3300005985 Bacteria 33258
126 Ga0097621_100000726 3300006237 Bacteria 23045
127 Ga0097621_100032100 3300006237 Unclassified 4173
128 Ga0068871_100005917 3300006358 Bacteria 8606
129 Ga0068871_100320339 3300006358 Bacteria 1365
130 Ga0075428_100034942 3300006844 Bacteria 5541
131 Ga0075433_10062294 3300006852 Bacteria 3267
132 Ga0075433_10172935 3300006852 Bacteria 1922
133 Ga0075429_100049627 3300006880 Bacteria 3649
134 Ga0075429_100072317 3300006880 Bacteria 3003
135 Ga0075429_100169424 3300006880 Bacteria 1913
136 Ga0068865_100083434 3300006881 Bacteria 2300
137 Ga0097620_100023093 3300006931 Bacteria 6238
138 Ga0097620_100028788 3300006931 Bacteria 5570
139 Ga0097620_100121854 3300006931 Bacteria 2674
140 Ga0097620_100284030 3300006931 Bacteria 1748
141 Ga0097620_100332912 3300006931 Bacteria 1612
142 Ga0097620_100531570 3300006931 Bacteria 1271
143 Ga0097620_100596397 3300006931 Unclassified 1198
144 Ga0075435_100010259 3300007076 Bacteria 6846
145 Ga0105251_10093271 3300009011 Bacteria 1381
146 Ga0111539_10008510 3300009094 Bacteria 13035
147 Ga0111539_10008617 3300009094 Bacteria 12955
148 Ga0111539_10195442 3300009094 Bacteria 2360
149 Ga0111539_10330001 3300009094 Bacteria 1776
150 Ga0105245_10416684 3300009098 Bacteria 1345
151 Ga0105247_10021803 3300009101 Bacteria 3854
152 Ga0114129_10012013 3300009147 Bacteria 12316
153 Ga0114129_10028610 3300009147 Bacteria 7896
154 Ga0114129_10029492 3300009147 Bacteria 7771
155 Ga0114129_10158403 3300009147 Bacteria 3095
156 Ga0114129_10219070 3300009147 Bacteria 2569
157 Ga0114129_10235659 3300009147 Unclassified 2463
158 Ga0105243_10013048 3300009148 Bacteria 6278
159 Ga0105243_10056736 3300009148 Bacteria 3116
160 Ga0105243_10097223 3300009148 Bacteria 2437
161 Ga0105241_10040281 3300009174 Bacteria 3526
162 Ga0105241_10052475 3300009174 Bacteria 3113
163 Ga0105242_10046627 3300009176 Bacteria 3516
164 Ga0105242_10058595 3300009176 Bacteria 3158
165 Ga0105248_10011627 3300009177 Bacteria 9696
166 Ga0105248_10012300 3300009177 Bacteria 9439
167 Ga0105248_10030639 3300009177 Bacteria 6008
168 Ga0105248_10043674 3300009177 Bacteria 5027
169 Ga0105248_10049891 3300009177 Bacteria 4692
170 Ga0105248_10056194 3300009177 Bacteria 4415
171 Ga0105248_10086702 3300009177 Bacteria 3523
172 Ga0105248_10103591 3300009177 Bacteria 3208
173 Ga0105248_10343490 3300009177 Unclassified 1680
174 Ga0105248_10436732 3300009177 Unclassified 1475
175 Ga0105237_10003911 3300009545 Bacteria 17450
176 Ga0105237_10060401 3300009545 Bacteria 3792
177 Ga0105237_10164716 3300009545 Bacteria 2216
178 Ga0105238_10016297 3300009551 Bacteria 7522
179 Ga0105238_10016755 3300009551 Bacteria 7428
180 Ga0105249_10000052 3300009553 Bacteria 168047
181 Ga0105249_10004953 3300009553 Bacteria 11486
182 Ga0105239_10289313 3300010375 Bacteria 1845
183 Ga0105246_10082637 3300011119 Bacteria 2293
184 Ga0105246_10204327 3300011119 Unclassified 1538
185 Ga0157373_10006441 3300013100 Bacteria 8770
186 Ga0157373_10014626 3300013100 Bacteria 5753
187 Ga0157374_10023925 3300013296 Bacteria 5470
188 Ga0157378_10002174 3300013297 Bacteria 17393
189 Ga0157378_10017189 3300013297 Bacteria 6341
190 Ga0157378_10021433 3300013297 Bacteria 5682
191 Ga0157378_10056346 3300013297 Bacteria 3502
192 Ga0163162_10000001 3300013306 Bacteria 751833
193 Ga0163162_10023056 3300013306 Bacteria 6140
194 Ga0163162_10030634 3300013306 Bacteria 5331
195 Ga0163162_10061108 3300013306 Bacteria 3805
196 Ga0163162_10259551 3300013306 Unclassified 1869
197 Ga0157375_10005551 3300013308 Bacteria 10977
198 Ga0157375_10018807 3300013308 Bacteria 6270
199 Ga0157375_10025765 3300013308 Bacteria 5471
200 Ga0157375_10064624 3300013308 Bacteria 3644
201 Ga0157375_10146651 3300013308 Bacteria 2491
202 Ga0157375_10350606 3300013308 Bacteria 1642
203 Ga0163163_10001133 3300014325 Bacteria 22637
204 Ga0163163_10001165 3300014325 Bacteria 22349
205 Ga0163163_10001675 3300014325 Bacteria 18696
206 Ga0163163_10007396 3300014325 Bacteria 9695
207 Ga0163163_10014304 3300014325 Bacteria 7294
208 Ga0163163_10066056 3300014325 Bacteria 3592
209 Ga0163163_10250572 3300014325 Unclassified 1821
210 Ga0163163_10531088 3300014325 Bacteria 1239
211 Ga0157380_10005354 3300014326 Bacteria 8967
212 Ga0157380_10287358 3300014326 Archaea 1508
213 Ga0157377_10034549 3300014745 Bacteria 2766
214 Ga0163161_10092670 3300017792 Unclassified 2237
215 Ga0213876_10000011 3300021384 Bacteria 414473
216 Ga0213876_10000916 3300021384 Bacteria 19494
217 Ga0207653_10002203 3300025885 Bacteria 6210
218 Ga0207710_10002251 3300025900 Bacteria 9028
219 Ga0207680_10140891 3300025903 Bacteria 1598
220 Ga0207647_10056615 3300025904 Bacteria 2405
221 Ga0207684_10000023 3300025910 Bacteria 334838
222 Ga0207684_10008916 3300025910 Bacteria 8902
223 Ga0207684_10174213 3300025910 Bacteria 1854
224 Ga0207707_10000072 3300025912 Bacteria 102454
225 Ga0207707_10099013 3300025912 Bacteria 2548
226 Ga0207707_10112944 3300025912 Bacteria 2375
227 Ga0207671_10002971 3300025914 Bacteria 17426
228 Ga0207660_10023592 3300025917 Bacteria 4157
229 Ga0207662_10008320 3300025918 Bacteria 5679
230 Ga0207662_10213824 3300025918 Bacteria 1253
231 Ga0207649_10070174 3300025920 Bacteria 2234
232 Ga0207652_10000083 3300025921 Bacteria 101957
233 Ga0207652_10094694 3300025921 Bacteria 2630
234 Ga0207681_10004999 3300025923 Bacteria 8146
235 Ga0207681_10050526 3300025923 Bacteria 2814
236 Ga0207681_10061819 3300025923 Bacteria 2576
237 Ga0207694_10019991 3300025924 Bacteria 5066
238 Ga0207650_10000001 3300025925 Bacteria 1545726
239 Ga0207687_10321281 3300025927 Bacteria 1253
240 Ga0207644_10062899 3300025931 Bacteria 2693
241 Ga0207706_10083489 3300025933 Bacteria 2809
242 Ga0207709_10007875 3300025935 Bacteria 5905
243 Ga0207709_10049344 3300025935 Bacteria 2569
244 Ga0207691_10201847 3300025940 Bacteria 1730
245 Ga0207711_10031912 3300025941 Bacteria 4451
246 Ga0207711_10196241 3300025941 Bacteria 1841
247 Ga0207711_10311239 3300025941 Unclassified 1454
248 Ga0207711_10367501 3300025941 Unclassified 1334
249 Ga0207689_10000667 3300025942 Bacteria 32744
250 Ga0207689_10014518 3300025942 Bacteria 6700
251 Ga0207679_10014664 3300025945 Bacteria 5158
252 Ga0207679_10039465 3300025945 Bacteria 3372
253 Ga0207651_10003215 3300025960 Bacteria 7992
254 Ga0207651_10041258 3300025960 Bacteria 3062
255 Ga0207651_10101462 3300025960 Unclassified 2136
256 Ga0207712_10000062 3300025961 Bacteria 135638
257 Ga0207712_10025647 3300025961 Bacteria 3919
258 Ga0207668_10000276 3300025972 Bacteria 34074
259 Ga0207658_10063485 3300025986 Bacteria 2768
260 Ga0207677_10153200 3300026023 Bacteria 1781
261 Ga0207703_10056373 3300026035 Bacteria 3200
262 Ga0207639_10007465 3300026041 Bacteria 7458
263 Ga0207639_10075436 3300026041 Bacteria 2651
264 Ga0207639_10142317 3300026041 Bacteria 1999
265 Ga0207639_10211957 3300026041 Bacteria 1668
266 Ga0207708_10000108 3300026075 Bacteria 63624
267 Ga0207708_10003622 3300026075 Bacteria 11390
268 Ga0207708_10012701 3300026075 Bacteria 6279
269 Ga0207708_10085610 3300026075 Bacteria 2425
270 Ga0207708_10113788 3300026075 Bacteria 2103
271 Ga0207702_10042832 3300026078 Bacteria 3799
272 Ga0207641_10190272 3300026088 Bacteria 1886
273 Ga0207641_10430134 3300026088 Unclassified 1272
274 Ga0207641_10510701 3300026088 Bacteria 1168
275 Ga0207648_10007488 3300026089 Bacteria 10726
276 Ga0207648_10032036 3300026089 Bacteria 4645
277 Ga0207648_10134919 3300026089 Bacteria 2174
278 Ga0207676_10048664 3300026095 Bacteria 3292
279 Ga0207676_10161898 3300026095 Bacteria 1939
280 Ga0207674_10000077 3300026116 Bacteria 104302
281 Ga0207674_10026068 3300026116 Bacteria 6219
282 Ga0207674_10065892 3300026116 Bacteria 3650
283 Ga0207674_10127765 3300026116 Bacteria 2506
284 Ga0207674_10381028 3300026116 Bacteria 1363
285 Ga0207675_100016289 3300026118 Bacteria 6939
286 Ga0207675_100422281 3300026118 Bacteria 1317
287 Ga0207683_10376654 3300026121 Bacteria 1304
288 Ga0207698_10171082 3300026142 Bacteria 1913
289 Ga0207428_10286003 3300027907 Unclassified 1223
290 Ga0268266_10085782 3300028379 Unclassified 2752
291 Ga0268265_10004224 3300028380 Bacteria 10032
292 Ga0268264_10023059 3300028381 Bacteria 5079
293 Ga0268264_10095807 3300028381 Bacteria 2569
294 Ga0268264_10192558 3300028381 Bacteria 1860
295 Ga0268264_10402938 3300028381 Bacteria 1315
296 Ga0307513_10002993 3300031456 Bacteria 23041
297 Ga0307405_10004568 3300031731 Bacteria 6563
298 Ga0307410_10013856 3300031852 Bacteria 4721
299 Ga0307410_10104754 3300031852 Bacteria 2035
300 Ga0307406_10003202 3300031901 Bacteria 8914
301 Ga0307406_10196561 3300031901 Bacteria 1481
302 Ga0307407_10001959 3300031903 Bacteria 7808
303 Ga0307409_100078523 3300031995 Bacteria 2656
304 Ga0307409_100188338 3300031995 Bacteria 1834
305 Ga0307416_100009240 3300032002 Bacteria 6436
306 Ga0307411_10011780 3300032005 Bacteria 4738
307 Ga0307411_10133605 3300032005 Bacteria 1818
308 Ga0307415_100001262 3300032126 Bacteria 11899
309 Ga0307415_100055781 3300032126 Bacteria 2705
310 Ga0373951_0000996 3300035091 Bacteria 7602
311 Ga0373937_0308518 3300036401 Bacteria 1496
312 Ga0395899_0231409 3300037312 Unclassified 1276
313 Ga0395900_0091901 3300037418 Bacteria 3118
314 Ga0395898_0060182 3300037466 Bacteria 3692
315 Ga0395898_0147343 3300037466 Bacteria 2253
316 Ga0395905_0001338 3300037471 Bacteria 30026
317 Ga0395901_0043023 3300038443 Bacteria 4685
318 Ga0242420_020635 3300038996 Bacteria 1174
319 Ga0436365_0141476 3300039437 Bacteria 76344
320 Ga0436365_0326416 3300039437 Bacteria 2321
321 Ga0436365_0815906 3300039437 Bacteria 101407
322 Ga0436365_1016548 3300039437 Bacteria 3016
323 Ga0495632_0032176 3300046519 Bacteria 2705
324 Ga0495668_0002577 3300046616 Bacteria 14709
325 Ga0496104_0017683 3300048907 Bacteria 6499
326 Ga0496108_0095144 3300048911 Bacteria 2536
327 Ga0496109_0316381 3300048912 Bacteria 1473
328 Ga0496112_0151882 3300048915 Bacteria 2283
329 Ga0496112_0420629 3300048915 Bacteria 1275
330 Ga0496112_0542482 3300048915 Bacteria 1097
331 Ga0496113_0157930 3300048916 Bacteria 1792
332 Ga0501299_001568 3300049522 Bacteria 2980
333 Ga0501038_0007583 3300049574 Bacteria 10007
334 Ga0501072_0015161 3300049588 Bacteria 5910
335 Ga0501207_001759 3300049654 Bacteria 2740
336 Ga0501209_007402 3300049656 Bacteria 2104
337 Ga0501217_001083 3300049661 Bacteria 4952
338 Ga0501223_000730 3300049663 Bacteria 7818
339 Ga0501227_003908 3300049665 Bacteria 3218
340 Ga0501230_001598 3300049667 Bacteria 2736
341 Ga0501233_002253 3300049668 Bacteria 3381
342 Ga0501252_006434 3300049682 Unclassified 1306
343 Ga0501258_001096 3300049687 Bacteria 2115
344 Ga0501221_013132 3300049704 Bacteria 1519
345 Ga0501225_0000814 3300049705 Bacteria 9763
346 Ga0501283_000398 3300049779 Bacteria 5802
347 nmdc:mga05p37_10738_c1 3300050507 Bacteria 10871
348 nmdc:mga05p37_161500_c1 3300050507 Bacteria 2736
349 nmdc:mga05p37_75912_c1 3300050507 Bacteria 4137
350 nmdc:mga09592_421187_c1 3300050508 Unclassified 1153
351 nmdc:mga09592_61879_c1 3300050508 Bacteria 3166
352 nmdc:mga08y16_188807_c1 3300050511 Bacteria 2138
353 nmdc:mga08y16_60690_c1 3300050511 Bacteria 3949
354 nmdc:mga08y16_60932_c1 3300050511 Bacteria 3940
355 nmdc:mga0n895_108702_c1 3300050512 Unclassified 2788
356 nmdc:mga0n895_27219_c1 3300050512 Bacteria 5428
357 nmdc:mga0n895_52259_c1 3300050512 Bacteria 4010
358 nmdc:mga0rr50_17949_c1 3300050513 Bacteria 4739
359 nmdc:mga0a205_101788_c1 3300050515 Bacteria 2771
360 nmdc:mga0a205_148763_c1 3300050515 Bacteria 2242
361 Ga0500616_0029394 3300053153 Bacteria 3024
362 Ga0530510_0013541 3300061734 Bacteria 5737

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10066056 Ga0163163_100660563 292
2 3300005468 Ga0070707_100019950 Ga0070707_1000199505 297
3 3300005471 Ga0070698_100016813 Ga0070698_1000168136 297
4 3300005518 Ga0070699_100038680 Ga0070699_1000386804 297
5 3300005467 Ga0070706_100022461 Ga0070706_1000224614 299
6 3300005471 Ga0070698_100042189 Ga0070698_1000421892 299
7 3300005549 Ga0070704_100076882 Ga0070704_1000768822 299
8 3300005719 Ga0068861_100004966 Ga0068861_1000049664 299
9 3300025910 Ga0207684_10174213 Ga0207684_101742131 299
10 3300026118 Ga0207675_100016289 Ga0207675_1000162895 299
11 3300006880 Ga0075429_100049627 Ga0075429_1000496273 303
12 3300036401 Ga0373937_0308518 Ga0373937_0308518_16_933 303
13 3300031731 Ga0307405_10004568 Ga0307405_100045683 307
14 3300031852 Ga0307410_10013856 Ga0307410_100138562 307
15 3300031901 Ga0307406_10003202 Ga0307406_100032023 307
16 3300031903 Ga0307407_10001959 Ga0307407_100019593 307
17 3300031995 Ga0307409_100078523 Ga0307409_1000785232 307
18 3300032002 Ga0307416_100009240 Ga0307416_1000092401 307
19 3300032005 Ga0307411_10011780 Ga0307411_100117803 307
20 3300032126 Ga0307415_100001262 Ga0307415_1000012625 307
21 3300049654 Ga0501207_001759 Ga0501207_001759_1614_2639 307
22 3300049656 Ga0501209_007402 Ga0501209_007402_349_1374 307
23 3300049661 Ga0501217_001083 Ga0501217_001083_2444_3469 307
24 3300049663 Ga0501223_000730 Ga0501223_000730_5544_6569 307
25 3300049665 Ga0501227_003908 Ga0501227_003908_2175_3200 307
26 3300049667 Ga0501230_001598 Ga0501230_001598_1019_2044 307
27 3300049668 Ga0501233_002253 Ga0501233_002253_2010_3035 307
28 3300049687 Ga0501258_001096 Ga0501258_001096_1003_2028 307
29 3300049704 Ga0501221_013132 Ga0501221_013132_178_1203 307
30 3300049705 Ga0501225_0000814 Ga0501225_0000814_2492_3517 307
31 3300009147 Ga0114129_10235659 Ga0114129_102356592 308
32 3300005843 Ga0068860_100045843 Ga0068860_1000458434 309
33 3300031995 Ga0307409_100188338 Ga0307409_1001883382 309
34 3300032005 Ga0307411_10133605 Ga0307411_101336052 309
35 3300005467 Ga0070706_100001130 Ga0070706_10000113012 312
36 3300005617 Ga0068859_100531597 Ga0068859_1005315972 312
37 3300006931 Ga0097620_100531570 Ga0097620_1005315701 312
38 3300025910 Ga0207684_10000023 Ga0207684_10000023262 312
39 3300037312 Ga0395899_0231409 Ga0395899_0231409_40_1068 313
40 3300037466 Ga0395898_0147343 Ga0395898_0147343_672_1700 313
41 3300026116 Ga0207674_10381028 Ga0207674_103810282 314
42 3300037466 Ga0395898_0060182 Ga0395898_0060182_1427_2452 314
43 3300005530 Ga0070679_100107094 Ga0070679_1001070942 315
44 3300005617 Ga0068859_100023094 Ga0068859_1000230944 315
45 3300006931 Ga0097620_100023093 Ga0097620_1000230934 315
46 3300009177 Ga0105248_10043674 Ga0105248_100436742 315
47 3300025921 Ga0207652_10094694 Ga0207652_100946942 315
48 3300025941 Ga0207711_10031912 Ga0207711_100319122 315
49 3300003203 JGI25406J46586_10006350 JGI25406J46586_100063503 317
50 3300005985 Ga0081539_10001856 Ga0081539_1000185614 317
51 3300025904 Ga0207647_10056615 Ga0207647_100566152 317
52 3300050507 nmdc:mga05p37_161500_c1 nmdc:mga05p37_161500_c1_47_1087 317
53 3300005353 Ga0070669_100091213 Ga0070669_1000912132 318
54 3300013308 Ga0157375_10064624 Ga0157375_100646244 318
55 3300025923 Ga0207681_10061819 Ga0207681_100618192 320
56 3300026142 Ga0207698_10171082 Ga0207698_101710822 320
57 3300005719 Ga0068861_100030951 Ga0068861_1000309512 322
58 3300009177 Ga0105248_10049891 Ga0105248_100498912 322
59 3300027907 Ga0207428_10286003 Ga0207428_102860031 322
60 3300006852 Ga0075433_10062294 Ga0075433_100622942 323
61 3300049588 Ga0501072_0015161 Ga0501072_0015161_2429_3427 324
62 3300005617 Ga0068859_100028787 Ga0068859_1000287871 325
63 3300006931 Ga0097620_100028788 Ga0097620_1000287884 325
64 3300025941 Ga0207711_10311239 Ga0207711_103112391 325
65 3300026088 Ga0207641_10510701 Ga0207641_105107011 326
66 3300031901 Ga0307406_10196561 Ga0307406_101965611 326
67 3300009545 Ga0105237_10164716 Ga0105237_101647162 329
68 3300028381 Ga0268264_10095807 Ga0268264_100958074 329
69 3300046616 Ga0495668_0002577 Ga0495668_0002577_8469_9479 330
70 3300005337 Ga0070682_100208248 Ga0070682_1002082481 331
71 3300005344 Ga0070661_100017320 Ga0070661_1000173202 331
72 3300005364 Ga0070673_100163473 Ga0070673_1001634732 331
73 3300005458 Ga0070681_10023047 Ga0070681_100230473 331
74 3300005530 Ga0070679_100025103 Ga0070679_1000251033 331
75 3300005539 Ga0068853_100021755 Ga0068853_1000217554 331
76 3300005564 Ga0070664_100002805 Ga0070664_1000028055 331
77 3300005577 Ga0068857_100001851 Ga0068857_10000185111 331
78 3300005578 Ga0068854_100127177 Ga0068854_1001271772 331
79 3300009174 Ga0105241_10040281 Ga0105241_100402812 331
80 3300013100 Ga0157373_10014626 Ga0157373_100146262 331
81 3300014325 Ga0163163_10001675 Ga0163163_1000167514 331
82 3300025920 Ga0207649_10070174 Ga0207649_100701742 331
83 3300025945 Ga0207679_10014664 Ga0207679_100146645 331
84 3300026041 Ga0207639_10142317 Ga0207639_101423172 331
85 3300026116 Ga0207674_10000077 Ga0207674_1000007764 331
86 3300005331 Ga0070670_100134854 Ga0070670_1001348542 333
87 3300005518 Ga0070699_100000481 Ga0070699_1000004816 335
88 3300021384 Ga0213876_10000011 Ga0213876_10000011261 335
89 3300039437 Ga0436365_0141476 Ga0436365_0141476_66992_68059 335
90 3300005295 Ga0065707_10103551 Ga0065707_101035512 336
91 3300009177 Ga0105248_10056194 Ga0105248_100561943 336
92 3300010375 Ga0105239_10289313 Ga0105239_102893132 336
93 3300005459 Ga0068867_100176340 Ga0068867_1001763401 337
94 3300005617 Ga0068859_100596457 Ga0068859_1005964571 337
95 3300006931 Ga0097620_100596397 Ga0097620_1005963971 337
96 3300009148 Ga0105243_10013048 Ga0105243_100130482 337
97 3300025935 Ga0207709_10007875 Ga0207709_100078752 337
98 3300026089 Ga0207648_10134919 Ga0207648_101349192 337
99 3300005347 Ga0070668_100000595 Ga0070668_10000059512 340
100 3300005719 Ga0068861_100186433 Ga0068861_1001864332 340
101 3300009148 Ga0105243_10056736 Ga0105243_100567362 340
102 3300009174 Ga0105241_10052475 Ga0105241_100524752 340
103 3300009177 Ga0105248_10011627 Ga0105248_100116277 340
104 3300009553 Ga0105249_10000052 Ga0105249_1000005267 340
105 3300013306 Ga0163162_10000001 Ga0163162_10000001579 340
106 3300014325 Ga0163163_10014304 Ga0163163_100143043 340
107 3300025935 Ga0207709_10049344 Ga0207709_100493442 340
108 3300025941 Ga0207711_10196241 Ga0207711_101962411 340
109 3300025961 Ga0207712_10000062 Ga0207712_100000629 340
110 3300025972 Ga0207668_10000276 Ga0207668_100002769 340
111 3300026089 Ga0207648_10032036 Ga0207648_100320363 340
112 3300026095 Ga0207676_10048664 Ga0207676_100486643 340
113 3300032126 Ga0307415_100055781 Ga0307415_1000557812 340
114 3300049522 Ga0501299_001568 Ga0501299_001568_1101_2123 340
115 3300049682 Ga0501252_006434 Ga0501252_006434_120_1142 340
116 3300049779 Ga0501283_000398 Ga0501283_000398_3966_4988 340
117 3300050512 nmdc:mga0n895_52259_c1 nmdc:mga0n895_52259_c1_1325_2347 340
118 3300003322 rootL2_10012479 rootL2_100124793 341
119 3300005290 Ga0065712_10012011 Ga0065712_100120113 341
120 3300005293 Ga0065715_10101436 Ga0065715_101014362 341
121 3300005334 Ga0068869_100040606 Ga0068869_1000406061 341
122 3300005338 Ga0068868_100045467 Ga0068868_1000454674 341
123 3300005354 Ga0070675_100164876 Ga0070675_1001648762 341
124 3300005355 Ga0070671_100289582 Ga0070671_1002895822 341
125 3300005365 Ga0070688_100095165 Ga0070688_1000951651 341
126 3300005440 Ga0070705_100124110 Ga0070705_1001241102 341
127 3300005441 Ga0070700_100000160 Ga0070700_10000016017 341
128 3300005458 Ga0070681_10137706 Ga0070681_101377062 341
129 3300005458 Ga0070681_10460073 Ga0070681_104600731 341
130 3300005536 Ga0070697_100007202 Ga0070697_1000072022 341
131 3300005545 Ga0070695_100021884 Ga0070695_1000218843 341
132 3300005547 Ga0070693_100035858 Ga0070693_1000358582 341
133 3300005841 Ga0068863_100443611 Ga0068863_1004436111 341
134 3300005985 Ga0081539_10000600 Ga0081539_1000060052 341
135 3300005985 Ga0081539_10000749 Ga0081539_100007491 341
136 3300005985 Ga0081539_10001510 Ga0081539_100015108 341
137 3300006852 Ga0075433_10172935 Ga0075433_101729352 341
138 3300009094 Ga0111539_10008617 Ga0111539_1000861712 341
139 3300009147 Ga0114129_10158403 Ga0114129_101584032 341
140 3300021384 Ga0213876_10000916 Ga0213876_100009168 341
141 3300025903 Ga0207680_10140891 Ga0207680_101408911 341
142 3300025912 Ga0207707_10099013 Ga0207707_100990131 341
143 3300025912 Ga0207707_10112944 Ga0207707_101129442 341
144 3300025927 Ga0207687_10321281 Ga0207687_103212811 341
145 3300025960 Ga0207651_10041258 Ga0207651_100412582 341
146 3300026023 Ga0207677_10153200 Ga0207677_101532001 341
147 3300026041 Ga0207639_10211957 Ga0207639_102119572 341
148 3300026075 Ga0207708_10000108 Ga0207708_1000010846 341
149 3300026075 Ga0207708_10113788 Ga0207708_101137881 341
150 3300026088 Ga0207641_10190272 Ga0207641_101902722 341
151 3300026095 Ga0207676_10161898 Ga0207676_101618982 341
152 3300026121 Ga0207683_10376654 Ga0207683_103766542 341
153 3300028379 Ga0268266_10085782 Ga0268266_100857822 341
154 3300028381 Ga0268264_10402938 Ga0268264_104029381 341
155 3300031456 Ga0307513_10002993 Ga0307513_1000299312 341
156 3300031852 Ga0307410_10104754 Ga0307410_101047542 341
157 3300037471 Ga0395905_0001338 Ga0395905_0001338_1582_2610 341
158 3300039437 Ga0436365_0326416 Ga0436365_0326416_154_1179 341
159 3300039437 Ga0436365_0815906 Ga0436365_0815906_7193_8260 341
160 3300039437 Ga0436365_1016548 Ga0436365_1016548_1847_2872 341
161 3300046519 Ga0495632_0032176 Ga0495632_0032176_1157_2182 341
162 3300048915 Ga0496112_0151882 Ga0496112_0151882_141_1166 341
163 3300048915 Ga0496112_0542482 Ga0496112_0542482_12_1037 341
164 3300048916 Ga0496113_0157930 Ga0496113_0157930_165_1190 341
165 3300049574 Ga0501038_0007583 Ga0501038_0007583_3793_4818 341
166 3300050511 nmdc:mga08y16_60932_c1 nmdc:mga08y16_60932_c1_1850_2875 341
167 3300053153 Ga0500616_0029394 Ga0500616_0029394_1430_2455 341
168 3300005288 Ga0065714_10002185 Ga0065714_1000218586 342
169 3300005290 Ga0065712_10067734 Ga0065712_1006773475 342
170 3300005293 Ga0065715_10002626 Ga0065715_100026264 342
171 3300005293 Ga0065715_10089026 Ga0065715_100890269 342
172 3300005293 Ga0065715_10108046 Ga0065715_101080462 342
173 3300005295 Ga0065707_10100907 Ga0065707_101009072 342
174 3300005331 Ga0070670_100000431 Ga0070670_10000043129 342
175 3300005334 Ga0068869_100106852 Ga0068869_1001068522 342
176 3300005337 Ga0070682_100032942 Ga0070682_1000329421 342
177 3300005343 Ga0070687_100006633 Ga0070687_1000066332 342
178 3300005345 Ga0070692_10009801 Ga0070692_100098012 342
179 3300005353 Ga0070669_100020933 Ga0070669_1000209333 342
180 3300005353 Ga0070669_100048908 Ga0070669_1000489082 342
181 3300005364 Ga0070673_100170250 Ga0070673_1001702501 342
182 3300005459 Ga0068867_100012436 Ga0068867_1000124361 342
183 3300005539 Ga0068853_100015614 Ga0068853_1000156145 342
184 3300005544 Ga0070686_100003666 Ga0070686_1000036663 342
185 3300005545 Ga0070695_100039050 Ga0070695_1000390501 342
186 3300005546 Ga0070696_100233613 Ga0070696_1002336132 342
187 3300005547 Ga0070693_100020679 Ga0070693_1000206792 342
188 3300005547 Ga0070693_100058724 Ga0070693_1000587242 342
189 3300005549 Ga0070704_100024404 Ga0070704_1000244041 342
190 3300005564 Ga0070664_100190613 Ga0070664_1001906132 342
191 3300005577 Ga0068857_100032072 Ga0068857_1000320724 342
192 3300005578 Ga0068854_100134669 Ga0068854_1001346692 342
193 3300005615 Ga0070702_100070872 Ga0070702_1000708721 342
194 3300005617 Ga0068859_100332901 Ga0068859_1003329012 342
195 3300005840 Ga0068870_10070135 Ga0068870_100701352 342
196 3300005842 Ga0068858_100070209 Ga0068858_1000702092 342
197 3300005842 Ga0068858_100070340 Ga0068858_1000703402 342
198 3300005844 Ga0068862_100007744 Ga0068862_1000077444 342
199 3300006237 Ga0097621_100000726 Ga0097621_10000072615 342
200 3300006358 Ga0068871_100320339 Ga0068871_1003203391 342
201 3300006881 Ga0068865_100083434 Ga0068865_1000834341 342
202 3300006931 Ga0097620_100332912 Ga0097620_1003329122 342
203 3300007076 Ga0075435_100010259 Ga0075435_1000102594 342
204 3300009011 Ga0105251_10093271 Ga0105251_100932712 342
205 3300009094 Ga0111539_10195442 Ga0111539_101954422 342
206 3300009101 Ga0105247_10021803 Ga0105247_100218033 342
207 3300009147 Ga0114129_10219070 Ga0114129_102190702 342
208 3300009148 Ga0105243_10097223 Ga0105243_100972232 342
209 3300009177 Ga0105248_10436732 Ga0105248_104367322 342
210 3300009545 Ga0105237_10060401 Ga0105237_100604012 342
211 3300009551 Ga0105238_10016755 Ga0105238_100167553 342
212 3300011119 Ga0105246_10082637 Ga0105246_100826371 342
213 3300013100 Ga0157373_10006441 Ga0157373_100064415 342
214 3300013297 Ga0157378_10021433 Ga0157378_100214334 342
215 3300013297 Ga0157378_10056346 Ga0157378_100563462 342
216 3300013306 Ga0163162_10061108 Ga0163162_100611083 342
217 3300013308 Ga0157375_10018807 Ga0157375_100188072 342
218 3300013308 Ga0157375_10350606 Ga0157375_103506062 342
219 3300014326 Ga0157380_10005354 Ga0157380_100053544 342
220 3300025900 Ga0207710_10002251 Ga0207710_100022515 342
221 3300025923 Ga0207681_10004999 Ga0207681_100049993 342
222 3300025923 Ga0207681_10050526 Ga0207681_100505262 342
223 3300025924 Ga0207694_10019991 Ga0207694_100199913 342
224 3300025933 Ga0207706_10083489 Ga0207706_100834892 342
225 3300025945 Ga0207679_10039465 Ga0207679_100394653 342
226 3300026035 Ga0207703_10056373 Ga0207703_100563733 342
227 3300026041 Ga0207639_10007465 Ga0207639_100074656 342
228 3300026075 Ga0207708_10003622 Ga0207708_100036228 342
229 3300026075 Ga0207708_10012701 Ga0207708_100127012 342
230 3300026088 Ga0207641_10430134 Ga0207641_104301341 342
231 3300026116 Ga0207674_10026068 Ga0207674_100260685 342
232 3300026116 Ga0207674_10065892 Ga0207674_100658923 342
233 3300026116 Ga0207674_10127765 Ga0207674_101277652 342
234 3300026118 Ga0207675_100422281 Ga0207675_1004222811 342
235 3300028380 Ga0268265_10004224 Ga0268265_100042243 342
236 3300028381 Ga0268264_10192558 Ga0268264_101925582 342
237 3300035091 Ga0373951_0000996 Ga0373951_0000996_2614_3642 342
238 3300048912 Ga0496109_0316381 Ga0496109_0316381_358_1389 342
239 3300048915 Ga0496112_0420629 Ga0496112_0420629_203_1237 342
240 3300050511 nmdc:mga08y16_188807_c1 nmdc:mga08y16_188807_c1_648_1679 342
241 3300050513 nmdc:mga0rr50_17949_c1 nmdc:mga0rr50_17949_c1_2656_3684 342
242 3300005330 Ga0070690_100024791 Ga0070690_1000247913 343
243 3300005336 Ga0070680_100000639 Ga0070680_10000063915 343
244 3300005336 Ga0070680_100021395 Ga0070680_1000213955 343
245 3300005337 Ga0070682_100022469 Ga0070682_1000224692 343
246 3300005338 Ga0068868_100272978 Ga0068868_1002729781 343
247 3300005356 Ga0070674_100121358 Ga0070674_1001213582 343
248 3300005364 Ga0070673_100005632 Ga0070673_1000056322 343
249 3300005441 Ga0070700_100010444 Ga0070700_1000104445 343
250 3300005444 Ga0070694_100005312 Ga0070694_1000053128 343
251 3300005444 Ga0070694_100011705 Ga0070694_1000117052 343
252 3300005445 Ga0070708_100004115 Ga0070708_1000041153 343
253 3300005458 Ga0070681_10000997 Ga0070681_1000099715 343
254 3300005467 Ga0070706_100058863 Ga0070706_1000588632 343
255 3300005468 Ga0070707_100007100 Ga0070707_1000071002 343
256 3300005468 Ga0070707_100289325 Ga0070707_1002893252 343
257 3300005471 Ga0070698_100004637 Ga0070698_1000046376 343
258 3300005471 Ga0070698_100034813 Ga0070698_1000348134 343
259 3300005518 Ga0070699_100004117 Ga0070699_1000041172 343
260 3300005518 Ga0070699_100105067 Ga0070699_1001050672 343
261 3300005518 Ga0070699_100474367 Ga0070699_1004743671 343
262 3300005530 Ga0070679_100000972 Ga0070679_10000097215 343
263 3300005539 Ga0068853_100136115 Ga0068853_1001361151 343
264 3300005543 Ga0070672_100073092 Ga0070672_1000730922 343
265 3300005545 Ga0070695_100061687 Ga0070695_1000616872 343
266 3300005547 Ga0070693_100168540 Ga0070693_1001685401 343
267 3300005548 Ga0070665_100069719 Ga0070665_1000697192 343
268 3300005549 Ga0070704_100006875 Ga0070704_1000068754 343
269 3300005577 Ga0068857_100233624 Ga0068857_1002336242 343
270 3300005614 Ga0068856_100016133 Ga0068856_1000161335 343
271 3300005615 Ga0070702_100056523 Ga0070702_1000565231 343
272 3300005617 Ga0068859_100121853 Ga0068859_1001218531 343
273 3300005617 Ga0068859_100284022 Ga0068859_1002840222 343
274 3300005618 Ga0068864_100005794 Ga0068864_1000057947 343
275 3300005719 Ga0068861_100424037 Ga0068861_1004240372 343
276 3300005842 Ga0068858_100059353 Ga0068858_1000593533 343
277 3300005842 Ga0068858_100059836 Ga0068858_1000598362 343
278 3300005843 Ga0068860_100018078 Ga0068860_1000180786 343
279 3300005843 Ga0068860_100056386 Ga0068860_1000563862 343
280 3300005843 Ga0068860_100077323 Ga0068860_1000773232 343
281 3300005844 Ga0068862_100008676 Ga0068862_1000086768 343
282 3300005844 Ga0068862_100323498 Ga0068862_1003234981 343
283 3300006237 Ga0097621_100032100 Ga0097621_1000321002 343
284 3300006358 Ga0068871_100005917 Ga0068871_1000059174 343
285 3300006844 Ga0075428_100034942 Ga0075428_1000349425 343
286 3300006880 Ga0075429_100072317 Ga0075429_1000723172 343
287 3300006880 Ga0075429_100169424 Ga0075429_1001694242 343
288 3300006931 Ga0097620_100121854 Ga0097620_1001218541 343
289 3300006931 Ga0097620_100284030 Ga0097620_1002840302 343
290 3300009094 Ga0111539_10008510 Ga0111539_100085106 343
291 3300009094 Ga0111539_10330001 Ga0111539_103300012 343
292 3300009098 Ga0105245_10416684 Ga0105245_104166841 343
293 3300009147 Ga0114129_10012013 Ga0114129_100120138 343
294 3300009147 Ga0114129_10028610 Ga0114129_100286105 343
295 3300009147 Ga0114129_10029492 Ga0114129_100294923 343
296 3300009176 Ga0105242_10046627 Ga0105242_100466271 343
297 3300009176 Ga0105242_10058595 Ga0105242_100585951 343
298 3300009177 Ga0105248_10012300 Ga0105248_100123001 343
299 3300009177 Ga0105248_10030639 Ga0105248_100306395 343
300 3300009177 Ga0105248_10086702 Ga0105248_100867022 343
301 3300009177 Ga0105248_10343490 Ga0105248_103434901 343
302 3300009545 Ga0105237_10003911 Ga0105237_100039112 343
303 3300009551 Ga0105238_10016297 Ga0105238_100162975 343
304 3300009553 Ga0105249_10004953 Ga0105249_100049535 343
305 3300011119 Ga0105246_10204327 Ga0105246_102043271 343
306 3300013296 Ga0157374_10023925 Ga0157374_100239252 343
307 3300013297 Ga0157378_10002174 Ga0157378_100021741 343
308 3300013297 Ga0157378_10017189 Ga0157378_100171894 343
309 3300013306 Ga0163162_10023056 Ga0163162_100230565 343
310 3300013306 Ga0163162_10030634 Ga0163162_100306343 343
311 3300013306 Ga0163162_10259551 Ga0163162_102595512 343
312 3300013308 Ga0157375_10005551 Ga0157375_100055515 343
313 3300013308 Ga0157375_10025765 Ga0157375_100257654 343
314 3300013308 Ga0157375_10146651 Ga0157375_101466511 343
315 3300014325 Ga0163163_10001133 Ga0163163_1000113317 343
316 3300014325 Ga0163163_10001165 Ga0163163_1000116514 343
317 3300014325 Ga0163163_10007396 Ga0163163_100073961 343
318 3300014325 Ga0163163_10250572 Ga0163163_102505722 343
319 3300014325 Ga0163163_10531088 Ga0163163_105310881 343
320 3300014326 Ga0157380_10287358 Ga0157380_102873581 343
321 3300014745 Ga0157377_10034549 Ga0157377_100345491 343
322 3300017792 Ga0163161_10092670 Ga0163161_100926702 343
323 3300025885 Ga0207653_10002203 Ga0207653_100022035 343
324 3300025910 Ga0207684_10008916 Ga0207684_100089162 343
325 3300025912 Ga0207707_10000072 Ga0207707_1000007264 343
326 3300025914 Ga0207671_10002971 Ga0207671_100029712 343
327 3300025917 Ga0207660_10023592 Ga0207660_100235924 343
328 3300025918 Ga0207662_10008320 Ga0207662_100083205 343
329 3300025918 Ga0207662_10213824 Ga0207662_102138241 343
330 3300025921 Ga0207652_10000083 Ga0207652_1000008315 343
331 3300025925 Ga0207650_10000001 Ga0207650_10000001633 343
332 3300025931 Ga0207644_10062899 Ga0207644_100628991 343
333 3300025940 Ga0207691_10201847 Ga0207691_102018472 343
334 3300025941 Ga0207711_10367501 Ga0207711_103675011 343
335 3300025942 Ga0207689_10000667 Ga0207689_1000066712 343
336 3300025942 Ga0207689_10014518 Ga0207689_100145186 343
337 3300025960 Ga0207651_10003215 Ga0207651_100032152 343
338 3300025960 Ga0207651_10101462 Ga0207651_101014622 343
339 3300025961 Ga0207712_10025647 Ga0207712_100256473 343
340 3300025986 Ga0207658_10063485 Ga0207658_100634852 343
341 3300026041 Ga0207639_10075436 Ga0207639_100754361 343
342 3300026075 Ga0207708_10085610 Ga0207708_100856102 343
343 3300026078 Ga0207702_10042832 Ga0207702_100428321 343
344 3300026089 Ga0207648_10007488 Ga0207648_100074888 343
345 3300028381 Ga0268264_10023059 Ga0268264_100230591 343
346 3300037418 Ga0395900_0091901 Ga0395900_0091901_1484_2515 343
347 3300038443 Ga0395901_0043023 Ga0395901_0043023_1134_2165 343
348 3300038996 Ga0242420_020635 Ga0242420_020635_15_1052 343
349 3300048907 Ga0496104_0017683 Ga0496104_0017683_1685_2722 343
350 3300048911 Ga0496108_0095144 Ga0496108_0095144_202_1239 343
351 3300050507 nmdc:mga05p37_10738_c1 nmdc:mga05p37_10738_c1_1444_2478 343
352 3300050507 nmdc:mga05p37_75912_c1 nmdc:mga05p37_75912_c1_1195_2259 343
353 3300050508 nmdc:mga09592_421187_c1 nmdc:mga09592_421187_c1_17_1081 343
354 3300050508 nmdc:mga09592_61879_c1 nmdc:mga09592_61879_c1_1778_2815 343
355 3300050511 nmdc:mga08y16_60690_c1 nmdc:mga08y16_60690_c1_2426_3460 343
356 3300050512 nmdc:mga0n895_108702_c1 nmdc:mga0n895_108702_c1_931_1968 343
357 3300050512 nmdc:mga0n895_27219_c1 nmdc:mga0n895_27219_c1_667_1701 343
358 3300050515 nmdc:mga0a205_101788_c1 nmdc:mga0a205_101788_c1_1038_2075 343
359 3300050515 nmdc:mga0a205_148763_c1 nmdc:mga0a205_148763_c1_35_1072 343
360 3300061734 Ga0530510_0013541 Ga0530510_0013541_2517_3551 343
361 3300000532 CNAas_1001564 CNAas_10015641 345
362 3300009177 Ga0105248_10103591 Ga0105248_101035913 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01075

Glyco_transf_9

Glycosyltransferase family 9 (heptosyltransferase)

96

344

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tov-assembly1.cif.gz_A the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8634 3 332
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8571 8 332
6dfe-assembly1.cif.gz_A the structure of a ternary complex of e. coli waac 0.8465 9 330
6dfe-assembly1.cif.gz_A the structure of a ternary complex of e. coli waac 0.8319 9 330
2h1h-assembly2.cif.gz_B e. coli heptosyltransferase waac with adp-2-deoxy-2-fluoro heptose 0.8287 9 330
ID Description Score Start End Superfamily
af_P25742_154_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8947 173 333 3.40.50.2000
3tovB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8892 171 332 3.40.50.2000
af_P25742_1_146_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8638 18 163 3.40.50.2000
af_P25742_1_146_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8368 18 163 3.40.50.2000
1pswA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8339 10 153 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2H0LDX4-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.9211 6 291 GO:0005829
GO:0008713
GO:0009244
AF-A0A7X3UG91-F1-model_v4 Glycosyltransferase family 9 protein 0.9176 5 311 GO:0005829
GO:0008713
GO:0009244
AF-A0A7X7J4G6-F1-model_v4 Lipopolysaccharide heptosyltransferase 1 (EC 2.4.99.23) (EC 2.4.99.24) (ADP-heptose:lipopolysaccharide heptosyltransferase I) 0.9161 6 292 GO:0005829
GO:0005886
GO:0008713
GO:0009244
AF-A0A661JFP8-F1-model_v4 Lipopolysaccharide heptosyltransferase family protein 0.9154 188 332 GO:0005829
GO:0008713
GO:0009244
AF-A0A4R8HLJ7-F1-model_v4 Heptosyltransferase-1 0.9143 9 333 GO:0005829
GO:0008713
GO:0009244

Feature Viewer

pLDDT pTM Quality
89.93 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map