F422455

General Info

Members Datasets Scaffolds Average Seq Length
362 229 361 159

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10304221|rootH1_103042212
Length 188
Sequence MNRQSAIVDQETITKHQLQTISQNSLSMKEHHYKINITWTGNRGQGTKSYTGYDRNHTIAAAGKPVIPGSSDPNFRGDPSRYNPEEMLVASLSTCHMLWFLHLCTTAGVVVVDYVDDATGTMEETADGGGHFTEVTLYPTITVASEEMIDKADALHEKANQLCFIANSCNFPVHHKPIYKIAELQSAG

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
164 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
222 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
228 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 1.93
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.91
Nodule 0
Rhizoplane 3.04
Rhizosphere 84.53
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10041086 3300002067 Bacteria 1348
2 rootH1_10111499 3300003316 Bacteria 1852
3 rootH2_10204197 3300003320 Bacteria 4404
4 rootH1_10002262 3300003323 Bacteria 13157
5 rootH1_10006515 3300003323 Bacteria 41254
6 rootH1_10304221 3300003323 Bacteria 1324
7 Ga0055533_1000001 3300003756 Bacteria 1863437
8 Ga0055525_1000329 3300003759 Bacteria 36203
9 Ga0055541_1000997 3300003841 Bacteria 6610
10 Ga0065707_10150395 3300005295 Bacteria 1665
11 Ga0070658_10317389 3300005327 Bacteria 1330
12 Ga0070683_100012707 3300005329 Bacteria 7322
13 Ga0070690_100131643 3300005330 Unclassified 1690
14 Ga0070666_10013629 3300005335 Bacteria 5162
15 Ga0070680_100003344 3300005336 Bacteria 11963
16 Ga0070680_100262355 3300005336 Bacteria 1461
17 Ga0070682_100344086 3300005337 Bacteria 1109
18 Ga0068868_100004860 3300005338 Bacteria 9439
19 Ga0070660_100121214 3300005339 Unclassified 2087
20 Ga0070660_100154589 3300005339 Unclassified 1846
21 Ga0070660_100622410 3300005339 Bacteria 903
22 Ga0070691_10005191 3300005341 Bacteria 5917
23 Ga0070661_100056482 3300005344 Bacteria 2876
24 Ga0070668_100000822 3300005347 Bacteria 21395
25 Ga0070675_100247371 3300005354 Bacteria 1559
26 Ga0070673_100019741 3300005364 Bacteria 4845
27 Ga0070659_100100403 3300005366 Bacteria 2328
28 Ga0070667_100001776 3300005367 Bacteria 19218
29 Ga0070667_100095506 3300005367 Bacteria 2563
30 Ga0070709_10108760 3300005434 Bacteria 1860
31 Ga0070714_100000679 3300005435 Bacteria 24018
32 Ga0070714_100035409 3300005435 Bacteria 4184
33 Ga0070714_100218328 3300005435 Bacteria 1751
34 Ga0070713_100008248 3300005436 Bacteria 7384
35 Ga0070713_100845083 3300005436 Bacteria 879
36 Ga0070711_100186418 3300005439 Bacteria 1591
37 Ga0070708_100656686 3300005445 Bacteria 988
38 Ga0070663_101106603 3300005455 Bacteria 693
39 Ga0070662_100076714 3300005457 Bacteria 2478
40 Ga0070662_100229064 3300005457 Bacteria 1486
41 Ga0070681_10061114 3300005458 Bacteria 3744
42 Ga0070681_10352965 3300005458 Bacteria 1381
43 Ga0068867_100056674 3300005459 Bacteria 2900
44 Ga0070706_100112098 3300005467 Bacteria 2539
45 Ga0070698_100898062 3300005471 Bacteria 832
46 Ga0070679_100001941 3300005530 Bacteria 18576
47 Ga0070679_100208318 3300005530 Bacteria 1919
48 Ga0070679_100561222 3300005530 Bacteria 1085
49 Ga0070684_100012364 3300005535 Bacteria 6838
50 Ga0070684_100052449 3300005535 Bacteria 3548
51 Ga0068853_100179018 3300005539 Bacteria 1922
52 Ga0068853_100274076 3300005539 Bacteria 1554
53 Ga0068853_100360720 3300005539 Bacteria 1354
54 Ga0068853_100380855 3300005539 Bacteria 1317
55 Ga0070672_100001662 3300005543 Bacteria 13854
56 Ga0070686_100222628 3300005544 Bacteria 1364
57 Ga0070696_100458975 3300005546 Bacteria 1007
58 Ga0070693_100013548 3300005547 Bacteria 4156
59 Ga0070665_100002275 3300005548 Bacteria 21344
60 Ga0068855_100001621 3300005563 Bacteria 28227
61 Ga0068855_100021187 3300005563 Bacteria 7793
62 Ga0068855_100021616 3300005563 Bacteria 7717
63 Ga0068855_100037794 3300005563 Bacteria 5738
64 Ga0068855_100459267 3300005563 Bacteria 1389
65 Ga0068855_100718012 3300005563 Bacteria 1068
66 Ga0068857_100013208 3300005577 Bacteria 7196
67 Ga0068854_100122409 3300005578 Bacteria 1977
68 Ga0068856_100299873 3300005614 Bacteria 1624
69 Ga0068852_100318373 3300005616 Unclassified 1510
70 Ga0068864_100001650 3300005618 Bacteria 18390
71 Ga0068864_100461405 3300005618 Bacteria 1216
72 Ga0068864_101158711 3300005618 Unclassified 771
73 Ga0068861_100049687 3300005719 Bacteria 3177
74 Ga0068851_10248367 3300005834 Bacteria 1008
75 Ga0068863_102163598 3300005841 Bacteria 566
76 Ga0068858_100002527 3300005842 Bacteria 18433
77 Ga0068860_100007261 3300005843 Bacteria 11082
78 Ga0068860_100023936 3300005843 Bacteria 5902
79 Ga0070717_10020979 3300006028 Bacteria 5146
80 Ga0070712_100285340 3300006175 Unclassified 1331
81 Ga0070712_100778392 3300006175 Bacteria 820
82 Ga0097621_100103698 3300006237 Bacteria 2396
83 Ga0097621_100408770 3300006237 Bacteria 1216
84 Ga0068865_100011261 3300006881 Bacteria 5592
85 Ga0068865_101123454 3300006881 Bacteria 693
86 Ga0105240_10002447 3300009093 Bacteria 29855
87 Ga0105240_10006678 3300009093 Bacteria 16915
88 Ga0105240_10014830 3300009093 Bacteria 10623
89 Ga0105240_10055980 3300009093 Bacteria 4936
90 Ga0105240_10219908 3300009093 Bacteria 2213
91 Ga0105240_10316371 3300009093 Unclassified 1781
92 Ga0105245_10170141 3300009098 Bacteria 2074
93 Ga0105247_10019077 3300009101 Bacteria 4118
94 Ga0105247_10214100 3300009101 Unclassified 1301
95 Ga0114129_10002505 3300009147 Bacteria 25476
96 Ga0105241_10002736 3300009174 Bacteria 13217
97 Ga0105241_10557703 3300009174 Bacteria 1029
98 Ga0105242_10016789 3300009176 Bacteria 5697
99 Ga0105242_10210702 3300009176 Bacteria 1732
100 Ga0105242_10231070 3300009176 Bacteria 1658
101 Ga0105248_10111276 3300009177 Bacteria 3088
102 Ga0105248_10780965 3300009177 Bacteria 1078
103 Ga0105237_10001934 3300009545 Bacteria 26413
104 Ga0105237_10002459 3300009545 Bacteria 22992
105 Ga0105237_10018293 3300009545 Bacteria 7252
106 Ga0105237_11197068 3300009545 Unclassified 766
107 Ga0105238_10055266 3300009551 Bacteria 3986
108 Ga0105249_10002472 3300009553 Bacteria 16005
109 Ga0105249_10387251 3300009553 Bacteria 1425
110 Ga0105249_12056345 3300009553 Bacteria 644
111 Ga0105249_12370901 3300009553 Unclassified 603
112 Ga0105239_10021607 3300010375 Bacteria 7096
113 Ga0105239_11731155 3300010375 Bacteria 724
114 Ga0157373_10041846 3300013100 Bacteria 3276
115 Ga0157371_10084020 3300013102 Bacteria 2254
116 Ga0157371_10367027 3300013102 Bacteria 1050
117 Ga0157370_10012272 3300013104 Bacteria 8893
118 Ga0157370_10028878 3300013104 Bacteria 5452
119 Ga0157370_10446385 3300013104 Bacteria 1189
120 Ga0157369_10027332 3300013105 Bacteria 6326
121 Ga0157369_10052154 3300013105 Bacteria 4427
122 Ga0157369_10103096 3300013105 Unclassified 3039
123 Ga0157369_10916418 3300013105 Bacteria 899
124 Ga0157374_10026624 3300013296 Bacteria 5206
125 Ga0157374_10345857 3300013296 Bacteria 1477
126 Ga0157374_11282269 3300013296 Unclassified 754
127 Ga0157378_10112819 3300013297 Bacteria 2494
128 Ga0157378_10582859 3300013297 Bacteria 1128
129 Ga0163162_10006336 3300013306 Bacteria 11459
130 Ga0163162_11758999 3300013306 Bacteria 708
131 Ga0157372_10000674 3300013307 Bacteria 37597
132 Ga0157372_10072399 3300013307 Bacteria 3884
133 Ga0157372_10295102 3300013307 Unclassified 1885
134 Ga0157372_10337539 3300013307 Bacteria 1755
135 Ga0157372_10346705 3300013307 Bacteria 1730
136 Ga0157372_11208447 3300013307 Unclassified 873
137 Ga0157375_10267597 3300013308 Bacteria 1871
138 Ga0157375_11532061 3300013308 Bacteria 787
139 Ga0157375_12280234 3300013308 Bacteria 645
140 Ga0163163_10001775 3300014325 Bacteria 18190
141 Ga0163163_10831334 3300014325 Unclassified 987
142 Ga0157380_10006324 3300014326 Bacteria 8324
143 Ga0157379_10001186 3300014968 Bacteria 21223
144 Ga0157376_10027718 3300014969 Bacteria 4494
145 Ga0157376_11284717 3300014969 Bacteria 762
146 Ga0157376_12801543 3300014969 Bacteria 527
147 Ga0163161_10044980 3300017792 Bacteria 3181
148 Ga0197907_10594707 3300020069 Bacteria 847
149 Ga0206356_11273775 3300020070 Unclassified 769
150 Ga0206349_1676031 3300020075 Bacteria 912
151 Ga0206352_10679253 3300020078 Bacteria 912
152 Ga0206350_11446621 3300020080 Unclassified 798
153 Ga0154015_1604720 3300020610 Bacteria 846
154 Ga0213873_10017623 3300021358 Bacteria 1632
155 Ga0213876_10060990 3300021384 Bacteria 1990
156 Ga0209566_100026 3300025225 Bacteria 367457
157 Ga0209674_100001 3300025226 Bacteria 4013750
158 Ga0209563_100001 3300025230 Bacteria 4013775
159 Ga0209646_1000745 3300025246 Bacteria 11381
160 Ga0209677_100001 3300025253 Bacteria 4013787
161 Ga0207656_10014902 3300025321 Bacteria 3003
162 Ga0207710_10100218 3300025900 Bacteria 1365
163 Ga0207680_10001762 3300025903 Bacteria 10222
164 Ga0207680_10048401 3300025903 Unclassified 2525
165 Ga0207680_10167912 3300025903 Bacteria 1476
166 Ga0207705_10161123 3300025909 Bacteria 1685
167 Ga0207654_10076118 3300025911 Unclassified 2007
168 Ga0207707_10035713 3300025912 Bacteria 4346
169 Ga0207707_10155304 3300025912 Bacteria 2001
170 Ga0207707_11170132 3300025912 Unclassified 624
171 Ga0207695_10000245 3300025913 Bacteria 141090
172 Ga0207695_10039379 3300025913 Bacteria 5081
173 Ga0207695_10093068 3300025913 Bacteria 3024
174 Ga0207695_10173136 3300025913 Bacteria 2083
175 Ga0207695_10678410 3300025913 Bacteria 911
176 Ga0207671_10003639 3300025914 Bacteria 15218
177 Ga0207671_10006793 3300025914 Bacteria 10112
178 Ga0207671_10012189 3300025914 Bacteria 6935
179 Ga0207671_10016243 3300025914 Bacteria 5793
180 Ga0207671_10017899 3300025914 Bacteria 5450
181 Ga0207671_11188769 3300025914 Unclassified 597
182 Ga0207663_11455556 3300025916 Bacteria 552
183 Ga0207660_10000354 3300025917 Bacteria 29872
184 Ga0207660_10070128 3300025917 Bacteria 2547
185 Ga0207660_10199029 3300025917 Bacteria 1564
186 Ga0207657_10005145 3300025919 Bacteria 13711
187 Ga0207657_10189807 3300025919 Bacteria 1658
188 Ga0207649_10011645 3300025920 Bacteria 4858
189 Ga0207652_10000561 3300025921 Bacteria 37514
190 Ga0207652_10094210 3300025921 Bacteria 2636
191 Ga0207652_10161846 3300025921 Bacteria 2006
192 Ga0207652_10518229 3300025921 Unclassified 1073
193 Ga0207694_10059798 3300025924 Bacteria 2964
194 Ga0207650_10047780 3300025925 Bacteria 3154
195 Ga0207659_10023709 3300025926 Bacteria 4100
196 Ga0207687_10045634 3300025927 Bacteria 3030
197 Ga0207687_10070216 3300025927 Bacteria 2500
198 Ga0207700_10016018 3300025928 Bacteria 4968
199 Ga0207700_10076737 3300025928 Bacteria 2594
200 Ga0207664_10016834 3300025929 Bacteria 5343
201 Ga0207664_10251294 3300025929 Unclassified 1543
202 Ga0207690_10050770 3300025932 Bacteria 2770
203 Ga0207706_10029146 3300025933 Bacteria 4928
204 Ga0207686_10034172 3300025934 Bacteria 3041
205 Ga0207704_10005978 3300025938 Bacteria 5644
206 Ga0207691_10003355 3300025940 Bacteria 15575
207 Ga0207711_10015366 3300025941 Bacteria 6353
208 Ga0207711_11287053 3300025941 Bacteria 673
209 Ga0207689_10007338 3300025942 Bacteria 9670
210 Ga0207689_10342873 3300025942 Bacteria 1241
211 Ga0207661_10007241 3300025944 Bacteria 7889
212 Ga0207661_10030906 3300025944 Bacteria 4129
213 Ga0207661_10192597 3300025944 Bacteria 1788
214 Ga0207679_10032145 3300025945 Bacteria 3680
215 Ga0207667_10002997 3300025949 Bacteria 20966
216 Ga0207667_10051766 3300025949 Bacteria 4327
217 Ga0207667_10139536 3300025949 Bacteria 2496
218 Ga0207667_11037596 3300025949 Bacteria 806
219 Ga0207651_10000727 3300025960 Bacteria 14091
220 Ga0207712_10463433 3300025961 Bacteria 1077
221 Ga0207668_10007114 3300025972 Bacteria 6639
222 Ga0207640_10562257 3300025981 Bacteria 960
223 Ga0207640_11518908 3300025981 Bacteria 602
224 Ga0207658_10023262 3300025986 Bacteria 4323
225 Ga0207677_10008411 3300026023 Bacteria 5759
226 Ga0207677_10268212 3300026023 Bacteria 1395
227 Ga0207703_10001592 3300026035 Bacteria 20550
228 Ga0207639_10013281 3300026041 Bacteria 5759
229 Ga0207639_10151174 3300026041 Bacteria 1944
230 Ga0207639_10222965 3300026041 Bacteria 1629
231 Ga0207639_10354209 3300026041 Bacteria 1312
232 Ga0207639_10617840 3300026041 Bacteria 1000
233 Ga0207702_10037489 3300026078 Bacteria 4058
234 Ga0207702_10085065 3300026078 Unclassified 2755
235 Ga0207641_10022465 3300026088 Bacteria 5192
236 Ga0207648_10005198 3300026089 Bacteria 13180
237 Ga0207676_10002724 3300026095 Bacteria 12575
238 Ga0207676_10008801 3300026095 Bacteria 7184
239 Ga0207676_10384037 3300026095 Bacteria 1308
240 Ga0207676_10623410 3300026095 Bacteria 1038
241 Ga0207674_10007073 3300026116 Bacteria 13115
242 Ga0207674_10026968 3300026116 Bacteria 6091
243 Ga0207675_100060769 3300026118 Bacteria 3528
244 Ga0207683_10533491 3300026121 Bacteria 1085
245 Ga0207698_10020490 3300026142 Bacteria 4553
246 Ga0268266_10005100 3300028379 Bacteria 12376
247 Ga0268264_10004143 3300028381 Bacteria 12403
248 Ga0268264_10007462 3300028381 Bacteria 9125
249 Ga0307517_10198301 3300028786 Bacteria 1260
250 Ga0265762_1000509 3300030760 Bacteria 6780
251 Ga0265320_10383750 3300031240 Unclassified 621
252 Ga0307513_10411088 3300031456 Bacteria 1085
253 Ga0307513_10475037 3300031456 Bacteria 971
254 Ga0307509_10032437 3300031507 Bacteria 5756
255 Ga0307509_10054787 3300031507 Bacteria 4243
256 Ga0307508_10396664 3300031616 Bacteria 971
257 Ga0265314_10031233 3300031711 Bacteria 3935
258 Ga0307414_10529933 3300032004 Bacteria 1047
259 Ga0373949_0169433 3300035090 Bacteria 641
260 Ga0373960_0036736 3300035121 Bacteria 1397
261 Ga0373927_0146038 3300035695 Bacteria 1548
262 Ga0373925_0071174 3300037068 Bacteria 2630
263 Ga0395899_0000002 3300037312 Bacteria 1324310
264 Ga0436363_0024231 3300039450 Bacteria 10799
265 Ga0439436_0007848 3300041404 Bacteria 3278
266 Ga0439439_0025754 3300041406 Bacteria 1481
267 Ga0451793_0775260 3300041452 Bacteria 1054
268 Ga0451793_1026402 3300041452 Bacteria 1046
269 Ga0451802_0461346 3300041460 Bacteria 2215
270 Ga0451807_1815396 3300041486 Bacteria 1117
271 Ga0451841_0366055 3300041498 Bacteria 723
272 Ga0451849_1108429 3300041505 Bacteria 1572
273 Ga0451853_2106679 3300041512 Bacteria 1023
274 Ga0439431_0011331 3300041997 Bacteria 2036
275 Ga0439433_0110838 3300041999 Bacteria 686
276 Ga0439449_0051288 3300042007 Bacteria 1526
277 Ga0439449_0092130 3300042007 Bacteria 1119
278 Ga0439457_003607 3300042014 Bacteria 4192
279 Ga0439457_035115 3300042014 Bacteria 1115
280 Ga0439457_048105 3300042014 Bacteria 955
281 Ga0439462_0028434 3300042015 Bacteria 1478
282 Ga0466969_0000912 3300044656 Bacteria 15928
283 Ga0466969_0031672 3300044656 Bacteria 2691
284 Ga0466972_0000013 3300044658 Bacteria 229345
285 Ga0466972_0000019 3300044658 Bacteria 198523
286 Ga0466972_0001173 3300044658 Bacteria 12565
287 Ga0466972_0009077 3300044658 Bacteria 4994
288 Ga0453683_0003625 3300044673 Bacteria 11325
289 Ga0453683_0493847 3300044673 Unclassified 794
290 Ga0466966_0000806 3300044684 Bacteria 19961
291 Ga0466966_0011419 3300044684 Bacteria 5891
292 Ga0466966_0193869 3300044684 Bacteria 1230
293 Ga0466961_0018532 3300044693 Bacteria 4479
294 Ga0466961_0021426 3300044693 Bacteria 4160
295 Ga0466964_0050653 3300044706 Unclassified 1703
296 Ga0453684_0100301 3300044712 Bacteria 3544
297 Ga0466971_0187711 3300044719 Unclassified 973
298 Ga0466968_0016776 3300044735 Bacteria 2919
299 Ga0466968_0133920 3300044735 Bacteria 1129
300 Ga0466968_0193828 3300044735 Unclassified 949
301 Ga0466970_0004104 3300044765 Bacteria 7159
302 Ga0466957_0000070 3300044842 Bacteria 39824
303 Ga0466960_0008086 3300044901 Bacteria 4296
304 Ga0466959_0000023 3300045049 Bacteria 124545
305 Ga0451576_0025837 3300045051 Bacteria 6325
306 Ga0451576_0221311 3300045051 Bacteria 1976
307 Ga0466958_0090027 3300045836 Bacteria 1898
308 Ga0495629_0581719 3300046459 Unclassified 750
309 Ga0495638_0114431 3300046460 Bacteria 1600
310 Ga0495653_0008916 3300046463 Bacteria 8202
311 Ga0495650_0090550 3300046471 Bacteria 1164
312 Ga0495582_0002860 3300046473 Bacteria 9662
313 Ga0495585_0002129 3300046492 Bacteria 14470
314 Ga0495616_0113282 3300046513 Bacteria 1258
315 Ga0495631_0009284 3300046518 Bacteria 4918
316 Ga0495597_0000628 3300046542 Bacteria 28802
317 Ga0495625_0296865 3300046660 Unclassified 1035
318 Ga0495661_0000014 3300046665 Bacteria 258915
319 Ga0495588_0028078 3300046674 Bacteria 2815
320 Ga0496104_0062332 3300048907 Bacteria 3536
321 Ga0496108_0781722 3300048911 Unclassified 824
322 Ga0496109_0033262 3300048912 Bacteria 4638
323 Ga0496109_0557654 3300048912 Unclassified 1081
324 Ga0496111_0582415 3300048914 Unclassified 820
325 Ga0496112_0044292 3300048915 Bacteria 4360
326 Ga0496113_0246647 3300048916 Bacteria 1425
327 Ga0496124_0028981 3300048927 Bacteria 4942
328 Ga0496126_0188291 3300048929 Bacteria 1749
329 Ga0495678_004331 3300049459 Bacteria 8270
330 Ga0501033_0031552 3300049570 Bacteria 3981
331 Ga0501034_0284192 3300049571 Bacteria 1594
332 Ga0501047_0862606 3300049581 Bacteria 719
333 Ga0501257_016808 3300049686 Bacteria 1699
334 Ga0501257_076724 3300049686 Bacteria 858
335 Ga0501225_0001739 3300049705 Bacteria 6824
336 Ga0501225_0256549 3300049705 Bacteria 577
337 Ga0501080_1158665 3300049742 Unclassified 666
338 Ga0501241_006343 3300049758 Bacteria 2177
339 Ga0501241_024293 3300049758 Bacteria 1125
340 Ga0501044_0076297 3300049823 Bacteria 3402
341 nmdc:mga0k408_18510_c1 3300050493 Bacteria 3888
342 nmdc:mga05p37_13616_c1 3300050507 Bacteria 9747
343 nmdc:mga0n895_969354_c1 3300050512 Bacteria 833
344 Ga0500578_0000150 3300053086 Bacteria 83541
345 Ga0500644_0007405 3300053088 Bacteria 2858
346 Ga0500644_0065952 3300053088 Bacteria 1290
347 Ga0500583_0000108 3300053092 Bacteria 41760
348 Ga0500583_0001145 3300053092 Bacteria 7568
349 Ga0500650_0045049 3300053098 Bacteria 2043
350 Ga0500555_032664 3300053103 Bacteria 1470
351 Ga0500562_002905 3300053108 Bacteria 4274
352 Ga0500652_037819 3300053131 Bacteria 1928
353 Ga0500604_0006155 3300053151 Bacteria 3170
354 Ga0500604_0038579 3300053151 Bacteria 1434
355 Ga0500622_0000021 3300053156 Bacteria 268013
356 Ga0500622_0001441 3300053156 Bacteria 19054
357 Ga0500622_0002588 3300053156 Bacteria 12891
358 Ga0500622_0133805 3300053156 Bacteria 1189
359 Ga0500639_102474 3300053163 Bacteria 1406
360 Ga0500611_001781 3300053727 Bacteria 2454
361 Ga0466962_0138513 3300061719 Bacteria 1178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_11197068 Ga0105237_111970681 151
2 3300025914 Ga0207671_11188769 Ga0207671_111887691 151
3 3300031240 Ga0265320_10383750 Ga0265320_103837502 151
4 3300039450 Ga0436363_0024231 Ga0436363_0024231_316_786 151
5 iso_pu_bacteria 2738541278 2738726378 151
6 3300003320 rootH2_10204197 rootH2_102041974 152
7 3300003323 rootH1_10006515 rootH1_1000651533 152
8 3300005563 Ga0068855_100718012 Ga0068855_1007180123 152
9 3300005841 Ga0068863_102163598 Ga0068863_1021635981 152
10 3300009093 Ga0105240_10219908 Ga0105240_102199083 152
11 3300014969 Ga0157376_12801543 Ga0157376_128015431 152
12 3300025913 Ga0207695_10678410 Ga0207695_106784101 152
13 3300025949 Ga0207667_11037596 Ga0207667_110375962 152
14 3300031507 Ga0307509_10032437 Ga0307509_100324378 152
15 3300041452 Ga0451793_0775260 Ga0451793_0775260_555_1025 152
16 3300041452 Ga0451793_1026402 Ga0451793_1026402_193_660 152
17 3300044658 Ga0466972_0001173 Ga0466972_0001173_5568_6032 152
18 3300044735 Ga0466968_0133920 Ga0466968_0133920_222_686 152
19 3300044901 Ga0466960_0008086 Ga0466960_0008086_803_1267 152
20 3300049758 Ga0501241_006343 Ga0501241_006343_1546_2013 152
21 3300002067 JGI24735J21928_10041086 JGI24735J21928_100410862 153
22 3300003316 rootH1_10111499 rootH1_101114992 153
23 3300003323 rootH1_10002262 rootH1_1000226217 153
24 3300003323 rootH1_10304221 rootH1_103042212 153
25 3300003756 Ga0055533_1000001 Ga0055533_1000001635 153
26 3300003759 Ga0055525_1000329 Ga0055525_100032931 153
27 3300003841 Ga0055541_1000997 Ga0055541_10009976 153
28 3300005295 Ga0065707_10150395 Ga0065707_101503953 153
29 3300005327 Ga0070658_10317389 Ga0070658_103173892 153
30 3300005329 Ga0070683_100012707 Ga0070683_1000127076 153
31 3300005330 Ga0070690_100131643 Ga0070690_1001316432 153
32 3300005335 Ga0070666_10013629 Ga0070666_100136295 153
33 3300005336 Ga0070680_100003344 Ga0070680_1000033441 153
34 3300005336 Ga0070680_100262355 Ga0070680_1002623551 153
35 3300005337 Ga0070682_100344086 Ga0070682_1003440862 153
36 3300005338 Ga0068868_100004860 Ga0068868_1000048605 153
37 3300005339 Ga0070660_100121214 Ga0070660_1001212142 153
38 3300005339 Ga0070660_100154589 Ga0070660_1001545891 153
39 3300005339 Ga0070660_100622410 Ga0070660_1006224101 153
40 3300005341 Ga0070691_10005191 Ga0070691_100051918 153
41 3300005344 Ga0070661_100056482 Ga0070661_1000564822 153
42 3300005347 Ga0070668_100000822 Ga0070668_10000082213 153
43 3300005354 Ga0070675_100247371 Ga0070675_1002473712 153
44 3300005364 Ga0070673_100019741 Ga0070673_1000197412 153
45 3300005366 Ga0070659_100100403 Ga0070659_1001004031 153
46 3300005367 Ga0070667_100001776 Ga0070667_1000017765 153
47 3300005367 Ga0070667_100095506 Ga0070667_1000955062 153
48 3300005434 Ga0070709_10108760 Ga0070709_101087603 153
49 3300005435 Ga0070714_100000679 Ga0070714_1000006798 153
50 3300005435 Ga0070714_100035409 Ga0070714_1000354093 153
51 3300005435 Ga0070714_100218328 Ga0070714_1002183282 153
52 3300005436 Ga0070713_100008248 Ga0070713_1000082481 153
53 3300005436 Ga0070713_100845083 Ga0070713_1008450831 153
54 3300005439 Ga0070711_100186418 Ga0070711_1001864182 153
55 3300005445 Ga0070708_100656686 Ga0070708_1006566861 153
56 3300005455 Ga0070663_101106603 Ga0070663_1011066031 153
57 3300005457 Ga0070662_100076714 Ga0070662_1000767144 153
58 3300005457 Ga0070662_100229064 Ga0070662_1002290642 153
59 3300005458 Ga0070681_10061114 Ga0070681_100611142 153
60 3300005458 Ga0070681_10352965 Ga0070681_103529652 153
61 3300005459 Ga0068867_100056674 Ga0068867_1000566744 153
62 3300005467 Ga0070706_100112098 Ga0070706_1001120982 153
63 3300005471 Ga0070698_100898062 Ga0070698_1008980621 153
64 3300005530 Ga0070679_100001941 Ga0070679_10000194115 153
65 3300005530 Ga0070679_100208318 Ga0070679_1002083183 153
66 3300005530 Ga0070679_100561222 Ga0070679_1005612222 153
67 3300005535 Ga0070684_100012364 Ga0070684_1000123644 153
68 3300005535 Ga0070684_100052449 Ga0070684_1000524494 153
69 3300005539 Ga0068853_100179018 Ga0068853_1001790182 153
70 3300005539 Ga0068853_100274076 Ga0068853_1002740761 153
71 3300005539 Ga0068853_100360720 Ga0068853_1003607202 153
72 3300005539 Ga0068853_100380855 Ga0068853_1003808552 153
73 3300005543 Ga0070672_100001662 Ga0070672_1000016629 153
74 3300005544 Ga0070686_100222628 Ga0070686_1002226281 153
75 3300005546 Ga0070696_100458975 Ga0070696_1004589752 153
76 3300005547 Ga0070693_100013548 Ga0070693_1000135484 153
77 3300005548 Ga0070665_100002275 Ga0070665_10000227512 153
78 3300005563 Ga0068855_100001621 Ga0068855_10000162114 153
79 3300005563 Ga0068855_100021187 Ga0068855_1000211877 153
80 3300005563 Ga0068855_100021616 Ga0068855_1000216163 153
81 3300005563 Ga0068855_100037794 Ga0068855_1000377944 153
82 3300005563 Ga0068855_100459267 Ga0068855_1004592673 153
83 3300005577 Ga0068857_100013208 Ga0068857_1000132084 153
84 3300005578 Ga0068854_100122409 Ga0068854_1001224092 153
85 3300005614 Ga0068856_100299873 Ga0068856_1002998733 153
86 3300005616 Ga0068852_100318373 Ga0068852_1003183731 153
87 3300005618 Ga0068864_100001650 Ga0068864_10000165012 153
88 3300005618 Ga0068864_100461405 Ga0068864_1004614052 153
89 3300005618 Ga0068864_101158711 Ga0068864_1011587112 153
90 3300005719 Ga0068861_100049687 Ga0068861_1000496872 153
91 3300005834 Ga0068851_10248367 Ga0068851_102483672 153
92 3300005842 Ga0068858_100002527 Ga0068858_1000025278 153
93 3300005843 Ga0068860_100007261 Ga0068860_1000072613 153
94 3300005843 Ga0068860_100023936 Ga0068860_1000239365 153
95 3300006028 Ga0070717_10020979 Ga0070717_100209796 153
96 3300006175 Ga0070712_100285340 Ga0070712_1002853402 153
97 3300006175 Ga0070712_100778392 Ga0070712_1007783921 153
98 3300006237 Ga0097621_100103698 Ga0097621_1001036982 153
99 3300006237 Ga0097621_100408770 Ga0097621_1004087702 153
100 3300006881 Ga0068865_100011261 Ga0068865_1000112615 153
101 3300006881 Ga0068865_101123454 Ga0068865_1011234542 153
102 3300009093 Ga0105240_10002447 Ga0105240_1000244717 153
103 3300009093 Ga0105240_10006678 Ga0105240_1000667814 153
104 3300009093 Ga0105240_10014830 Ga0105240_100148303 153
105 3300009093 Ga0105240_10055980 Ga0105240_100559805 153
106 3300009093 Ga0105240_10316371 Ga0105240_103163712 153
107 3300009098 Ga0105245_10170141 Ga0105245_101701413 153
108 3300009101 Ga0105247_10019077 Ga0105247_100190774 153
109 3300009101 Ga0105247_10214100 Ga0105247_102141002 153
110 3300009147 Ga0114129_10002505 Ga0114129_100025053 153
111 3300009174 Ga0105241_10002736 Ga0105241_100027362 153
112 3300009174 Ga0105241_10557703 Ga0105241_105577032 153
113 3300009176 Ga0105242_10016789 Ga0105242_100167895 153
114 3300009176 Ga0105242_10210702 Ga0105242_102107021 153
115 3300009176 Ga0105242_10231070 Ga0105242_102310702 153
116 3300009177 Ga0105248_10111276 Ga0105248_101112762 153
117 3300009177 Ga0105248_10780965 Ga0105248_107809652 153
118 3300009545 Ga0105237_10001934 Ga0105237_1000193414 153
119 3300009545 Ga0105237_10002459 Ga0105237_1000245919 153
120 3300009545 Ga0105237_10018293 Ga0105237_100182932 153
121 3300009551 Ga0105238_10055266 Ga0105238_100552663 153
122 3300009553 Ga0105249_10002472 Ga0105249_100024726 153
123 3300009553 Ga0105249_10387251 Ga0105249_103872513 153
124 3300009553 Ga0105249_12056345 Ga0105249_120563452 153
125 3300009553 Ga0105249_12370901 Ga0105249_123709011 153
126 3300010375 Ga0105239_10021607 Ga0105239_100216076 153
127 3300010375 Ga0105239_11731155 Ga0105239_117311552 153
128 3300013100 Ga0157373_10041846 Ga0157373_100418464 153
129 3300013102 Ga0157371_10084020 Ga0157371_100840202 153
130 3300013102 Ga0157371_10367027 Ga0157371_103670272 153
131 3300013104 Ga0157370_10012272 Ga0157370_100122727 153
132 3300013104 Ga0157370_10028878 Ga0157370_100288782 153
133 3300013104 Ga0157370_10446385 Ga0157370_104463852 153
134 3300013105 Ga0157369_10027332 Ga0157369_100273325 153
135 3300013105 Ga0157369_10052154 Ga0157369_100521544 153
136 3300013105 Ga0157369_10103096 Ga0157369_101030964 153
137 3300013105 Ga0157369_10916418 Ga0157369_109164182 153
138 3300013296 Ga0157374_10026624 Ga0157374_100266243 153
139 3300013296 Ga0157374_10345857 Ga0157374_103458572 153
140 3300013296 Ga0157374_11282269 Ga0157374_112822691 153
141 3300013297 Ga0157378_10112819 Ga0157378_101128194 153
142 3300013297 Ga0157378_10582859 Ga0157378_105828592 153
143 3300013306 Ga0163162_10006336 Ga0163162_1000633610 153
144 3300013306 Ga0163162_11758999 Ga0163162_117589991 153
145 3300013307 Ga0157372_10000674 Ga0157372_1000067411 153
146 3300013307 Ga0157372_10072399 Ga0157372_100723994 153
147 3300013307 Ga0157372_10295102 Ga0157372_102951023 153
148 3300013307 Ga0157372_10337539 Ga0157372_103375392 153
149 3300013307 Ga0157372_10346705 Ga0157372_103467052 153
150 3300013307 Ga0157372_11208447 Ga0157372_112084472 153
151 3300013308 Ga0157375_10267597 Ga0157375_102675971 153
152 3300013308 Ga0157375_11532061 Ga0157375_115320612 153
153 3300013308 Ga0157375_12280234 Ga0157375_122802341 153
154 3300014325 Ga0163163_10001775 Ga0163163_100017757 153
155 3300014325 Ga0163163_10831334 Ga0163163_108313342 153
156 3300014326 Ga0157380_10006324 Ga0157380_100063243 153
157 3300014968 Ga0157379_10001186 Ga0157379_100011868 153
158 3300014969 Ga0157376_10027718 Ga0157376_100277181 153
159 3300014969 Ga0157376_11284717 Ga0157376_112847172 153
160 3300017792 Ga0163161_10044980 Ga0163161_100449802 153
161 3300020069 Ga0197907_10594707 Ga0197907_105947072 153
162 3300020070 Ga0206356_11273775 Ga0206356_112737751 153
163 3300020075 Ga0206349_1676031 Ga0206349_16760312 153
164 3300020078 Ga0206352_10679253 Ga0206352_106792532 153
165 3300020080 Ga0206350_11446621 Ga0206350_114466212 153
166 3300020610 Ga0154015_1604720 Ga0154015_16047202 153
167 3300021358 Ga0213873_10017623 Ga0213873_100176232 153
168 3300021384 Ga0213876_10060990 Ga0213876_100609903 153
169 3300025225 Ga0209566_100026 Ga0209566_10002688 153
170 3300025226 Ga0209674_100001 Ga0209674_100001636 153
171 3300025230 Ga0209563_100001 Ga0209563_100001636 153
172 3300025246 Ga0209646_1000745 Ga0209646_100074510 153
173 3300025253 Ga0209677_100001 Ga0209677_100001636 153
174 3300025321 Ga0207656_10014902 Ga0207656_100149023 153
175 3300025900 Ga0207710_10100218 Ga0207710_101002181 153
176 3300025903 Ga0207680_10001762 Ga0207680_100017626 153
177 3300025903 Ga0207680_10048401 Ga0207680_100484014 153
178 3300025903 Ga0207680_10167912 Ga0207680_101679122 153
179 3300025909 Ga0207705_10161123 Ga0207705_101611233 153
180 3300025911 Ga0207654_10076118 Ga0207654_100761182 153
181 3300025912 Ga0207707_10035713 Ga0207707_100357132 153
182 3300025912 Ga0207707_10155304 Ga0207707_101553043 153
183 3300025912 Ga0207707_11170132 Ga0207707_111701321 153
184 3300025913 Ga0207695_10000245 Ga0207695_1000024518 153
185 3300025913 Ga0207695_10039379 Ga0207695_100393792 153
186 3300025913 Ga0207695_10093068 Ga0207695_100930682 153
187 3300025913 Ga0207695_10173136 Ga0207695_101731362 153
188 3300025914 Ga0207671_10003639 Ga0207671_1000363911 153
189 3300025914 Ga0207671_10006793 Ga0207671_100067936 153
190 3300025914 Ga0207671_10012189 Ga0207671_100121892 153
191 3300025914 Ga0207671_10016243 Ga0207671_100162432 153
192 3300025914 Ga0207671_10017899 Ga0207671_100178992 153
193 3300025916 Ga0207663_11455556 Ga0207663_114555561 153
194 3300025917 Ga0207660_10000354 Ga0207660_100003546 153
195 3300025917 Ga0207660_10070128 Ga0207660_100701282 153
196 3300025917 Ga0207660_10199029 Ga0207660_101990291 153
197 3300025919 Ga0207657_10005145 Ga0207657_1000514510 153
198 3300025919 Ga0207657_10189807 Ga0207657_101898071 153
199 3300025920 Ga0207649_10011645 Ga0207649_100116454 153
200 3300025921 Ga0207652_10000561 Ga0207652_100005611 153
201 3300025921 Ga0207652_10094210 Ga0207652_100942102 153
202 3300025921 Ga0207652_10161846 Ga0207652_101618462 153
203 3300025921 Ga0207652_10518229 Ga0207652_105182292 153
204 3300025924 Ga0207694_10059798 Ga0207694_100597984 153
205 3300025925 Ga0207650_10047780 Ga0207650_100477802 153
206 3300025926 Ga0207659_10023709 Ga0207659_100237092 153
207 3300025927 Ga0207687_10045634 Ga0207687_100456342 153
208 3300025927 Ga0207687_10070216 Ga0207687_100702162 153
209 3300025928 Ga0207700_10016018 Ga0207700_100160184 153
210 3300025928 Ga0207700_10076737 Ga0207700_100767373 153
211 3300025929 Ga0207664_10016834 Ga0207664_100168345 153
212 3300025929 Ga0207664_10251294 Ga0207664_102512942 153
213 3300025932 Ga0207690_10050770 Ga0207690_100507703 153
214 3300025933 Ga0207706_10029146 Ga0207706_100291462 153
215 3300025934 Ga0207686_10034172 Ga0207686_100341724 153
216 3300025938 Ga0207704_10005978 Ga0207704_100059786 153
217 3300025940 Ga0207691_10003355 Ga0207691_100033559 153
218 3300025941 Ga0207711_10015366 Ga0207711_100153664 153
219 3300025941 Ga0207711_11287053 Ga0207711_112870531 153
220 3300025942 Ga0207689_10007338 Ga0207689_100073386 153
221 3300025942 Ga0207689_10342873 Ga0207689_103428732 153
222 3300025944 Ga0207661_10007241 Ga0207661_1000724111 153
223 3300025944 Ga0207661_10030906 Ga0207661_100309063 153
224 3300025944 Ga0207661_10192597 Ga0207661_101925972 153
225 3300025945 Ga0207679_10032145 Ga0207679_100321453 153
226 3300025949 Ga0207667_10002997 Ga0207667_1000299715 153
227 3300025949 Ga0207667_10051766 Ga0207667_100517662 153
228 3300025949 Ga0207667_10139536 Ga0207667_101395362 153
229 3300025960 Ga0207651_10000727 Ga0207651_1000072713 153
230 3300025961 Ga0207712_10463433 Ga0207712_104634331 153
231 3300025972 Ga0207668_10007114 Ga0207668_100071143 153
232 3300025981 Ga0207640_10562257 Ga0207640_105622572 153
233 3300025981 Ga0207640_11518908 Ga0207640_115189081 153
234 3300025986 Ga0207658_10023262 Ga0207658_100232624 153
235 3300026023 Ga0207677_10008411 Ga0207677_100084115 153
236 3300026023 Ga0207677_10268212 Ga0207677_102682122 153
237 3300026035 Ga0207703_10001592 Ga0207703_100015928 153
238 3300026041 Ga0207639_10013281 Ga0207639_100132815 153
239 3300026041 Ga0207639_10151174 Ga0207639_101511743 153
240 3300026041 Ga0207639_10222965 Ga0207639_102229652 153
241 3300026041 Ga0207639_10354209 Ga0207639_103542092 153
242 3300026041 Ga0207639_10617840 Ga0207639_106178401 153
243 3300026078 Ga0207702_10037489 Ga0207702_100374893 153
244 3300026078 Ga0207702_10085065 Ga0207702_100850652 153
245 3300026088 Ga0207641_10022465 Ga0207641_100224653 153
246 3300026089 Ga0207648_10005198 Ga0207648_100051982 153
247 3300026095 Ga0207676_10002724 Ga0207676_1000272413 153
248 3300026095 Ga0207676_10008801 Ga0207676_100088014 153
249 3300026095 Ga0207676_10384037 Ga0207676_103840372 153
250 3300026095 Ga0207676_10623410 Ga0207676_106234102 153
251 3300026116 Ga0207674_10007073 Ga0207674_100070734 153
252 3300026116 Ga0207674_10026968 Ga0207674_100269685 153
253 3300026118 Ga0207675_100060769 Ga0207675_1000607692 153
254 3300026121 Ga0207683_10533491 Ga0207683_105334912 153
255 3300026142 Ga0207698_10020490 Ga0207698_100204902 153
256 3300028379 Ga0268266_10005100 Ga0268266_1000510013 153
257 3300028381 Ga0268264_10004143 Ga0268264_100041433 153
258 3300028381 Ga0268264_10007462 Ga0268264_100074628 153
259 3300028786 Ga0307517_10198301 Ga0307517_101983012 153
260 3300030760 Ga0265762_1000509 Ga0265762_10005096 153
261 3300031456 Ga0307513_10411088 Ga0307513_104110882 153
262 3300031456 Ga0307513_10475037 Ga0307513_104750371 153
263 3300031507 Ga0307509_10054787 Ga0307509_100547872 153
264 3300031616 Ga0307508_10396664 Ga0307508_103966642 153
265 3300031711 Ga0265314_10031233 Ga0265314_100312334 153
266 3300032004 Ga0307414_10529933 Ga0307414_105299332 153
267 3300035090 Ga0373949_0169433 Ga0373949_0169433_69_554 153
268 3300035121 Ga0373960_0036736 Ga0373960_0036736_573_1058 153
269 3300035695 Ga0373927_0146038 Ga0373927_0146038_449_925 153
270 3300037068 Ga0373925_0071174 Ga0373925_0071174_649_1125 153
271 3300037312 Ga0395899_0000002 Ga0395899_0000002_728600_729073 153
272 3300041404 Ga0439436_0007848 Ga0439436_0007848_1393_1881 153
273 3300041406 Ga0439439_0025754 Ga0439439_0025754_237_725 153
274 3300041460 Ga0451802_0461346 Ga0451802_0461346_1328_1852 153
275 3300041486 Ga0451807_1815396 Ga0451807_1815396_228_716 153
276 3300041498 Ga0451841_0366055 Ga0451841_0366055_178_702 153
277 3300041505 Ga0451849_1108429 Ga0451849_1108429_256_732 153
278 3300041512 Ga0451853_2106679 Ga0451853_2106679_404_880 153
279 3300041997 Ga0439431_0011331 Ga0439431_0011331_739_1212 153
280 3300041999 Ga0439433_0110838 Ga0439433_0110838_80_568 153
281 3300042007 Ga0439449_0051288 Ga0439449_0051288_98_571 153
282 3300042007 Ga0439449_0092130 Ga0439449_0092130_451_933 153
283 3300042014 Ga0439457_003607 Ga0439457_003607_2106_2594 153
284 3300042014 Ga0439457_035115 Ga0439457_035115_263_736 153
285 3300042014 Ga0439457_048105 Ga0439457_048105_22_504 153
286 3300042015 Ga0439462_0028434 Ga0439462_0028434_281_769 153
287 3300044656 Ga0466969_0000912 Ga0466969_0000912_2351_2833 153
288 3300044656 Ga0466969_0031672 Ga0466969_0031672_112_591 153
289 3300044658 Ga0466972_0000013 Ga0466972_0000013_67681_68169 153
290 3300044658 Ga0466972_0000019 Ga0466972_0000019_44647_45129 153
291 3300044658 Ga0466972_0009077 Ga0466972_0009077_270_758 153
292 3300044673 Ga0453683_0003625 Ga0453683_0003625_2990_3460 153
293 3300044673 Ga0453683_0493847 Ga0453683_0493847_229_699 153
294 3300044684 Ga0466966_0000806 Ga0466966_0000806_100_582 153
295 3300044684 Ga0466966_0011419 Ga0466966_0011419_4378_4857 153
296 3300044684 Ga0466966_0193869 Ga0466966_0193869_103_576 153
297 3300044693 Ga0466961_0018532 Ga0466961_0018532_772_1251 153
298 3300044693 Ga0466961_0021426 Ga0466961_0021426_2139_2624 153
299 3300044706 Ga0466964_0050653 Ga0466964_0050653_932_1414 153
300 3300044712 Ga0453684_0100301 Ga0453684_0100301_1652_2122 153
301 3300044719 Ga0466971_0187711 Ga0466971_0187711_119_604 153
302 3300044735 Ga0466968_0016776 Ga0466968_0016776_2154_2636 153
303 3300044735 Ga0466968_0193828 Ga0466968_0193828_247_729 153
304 3300044765 Ga0466970_0004104 Ga0466970_0004104_6461_6943 153
305 3300044842 Ga0466957_0000070 Ga0466957_0000070_16977_17465 153
306 3300045049 Ga0466959_0000023 Ga0466959_0000023_98660_99142 153
307 3300045051 Ga0451576_0025837 Ga0451576_0025837_2770_3240 153
308 3300045051 Ga0451576_0221311 Ga0451576_0221311_1182_1667 153
309 3300045836 Ga0466958_0090027 Ga0466958_0090027_149_628 153
310 3300046459 Ga0495629_0581719 Ga0495629_0581719_77_559 153
311 3300046460 Ga0495638_0114431 Ga0495638_0114431_1114_1590 153
312 3300046463 Ga0495653_0008916 Ga0495653_0008916_4861_5340 153
313 3300046471 Ga0495650_0090550 Ga0495650_0090550_642_1121 153
314 3300046473 Ga0495582_0002860 Ga0495582_0002860_9104_9586 153
315 3300046492 Ga0495585_0002129 Ga0495585_0002129_8516_9001 153
316 3300046513 Ga0495616_0113282 Ga0495616_0113282_161_640 153
317 3300046518 Ga0495631_0009284 Ga0495631_0009284_116_592 153
318 3300046542 Ga0495597_0000628 Ga0495597_0000628_22789_23256 153
319 3300046660 Ga0495625_0296865 Ga0495625_0296865_164_670 153
320 3300046665 Ga0495661_0000014 Ga0495661_0000014_210235_210720 153
321 3300046674 Ga0495588_0028078 Ga0495588_0028078_959_1441 153
322 3300048907 Ga0496104_0062332 Ga0496104_0062332_481_966 153
323 3300048911 Ga0496108_0781722 Ga0496108_0781722_101_586 153
324 3300048912 Ga0496109_0033262 Ga0496109_0033262_2109_2594 153
325 3300048912 Ga0496109_0557654 Ga0496109_0557654_510_980 153
326 3300048914 Ga0496111_0582415 Ga0496111_0582415_14_499 153
327 3300048915 Ga0496112_0044292 Ga0496112_0044292_532_1017 153
328 3300048916 Ga0496113_0246647 Ga0496113_0246647_229_699 153
329 3300048927 Ga0496124_0028981 Ga0496124_0028981_33_518 153
330 3300048929 Ga0496126_0188291 Ga0496126_0188291_741_1220 153
331 3300049459 Ga0495678_004331 Ga0495678_004331_3655_4134 153
332 3300049570 Ga0501033_0031552 Ga0501033_0031552_3017_3490 153
333 3300049571 Ga0501034_0284192 Ga0501034_0284192_1063_1536 153
334 3300049581 Ga0501047_0862606 Ga0501047_0862606_190_666 153
335 3300049686 Ga0501257_016808 Ga0501257_016808_327_827 153
336 3300049686 Ga0501257_076724 Ga0501257_076724_156_644 153
337 3300049705 Ga0501225_0001739 Ga0501225_0001739_5056_5562 153
338 3300049705 Ga0501225_0256549 Ga0501225_0256549_38_562 153
339 3300049742 Ga0501080_1158665 Ga0501080_1158665_90_563 153
340 3300049758 Ga0501241_024293 Ga0501241_024293_233_751 153
341 3300049823 Ga0501044_0076297 Ga0501044_0076297_1081_1554 153
342 3300050493 nmdc:mga0k408_18510_c1 nmdc:mga0k408_18510_c1_1098_1586 153
343 3300050507 nmdc:mga05p37_13616_c1 nmdc:mga05p37_13616_c1_4951_5451 153
344 3300050512 nmdc:mga0n895_969354_c1 nmdc:mga0n895_969354_c1_173_658 153
345 3300053086 Ga0500578_0000150 Ga0500578_0000150_952_1440 153
346 3300053088 Ga0500644_0007405 Ga0500644_0007405_508_996 153
347 3300053088 Ga0500644_0065952 Ga0500644_0065952_616_1098 153
348 3300053092 Ga0500583_0000108 Ga0500583_0000108_30494_30970 153
349 3300053092 Ga0500583_0001145 Ga0500583_0001145_3665_4189 153
350 3300053098 Ga0500650_0045049 Ga0500650_0045049_217_705 153
351 3300053103 Ga0500555_032664 Ga0500555_032664_700_1188 153
352 3300053108 Ga0500562_002905 Ga0500562_002905_369_851 153
353 3300053131 Ga0500652_037819 Ga0500652_037819_205_729 153
354 3300053151 Ga0500604_0006155 Ga0500604_0006155_285_758 153
355 3300053151 Ga0500604_0038579 Ga0500604_0038579_501_977 153
356 3300053156 Ga0500622_0000021 Ga0500622_0000021_229277_229750 153
357 3300053156 Ga0500622_0001441 Ga0500622_0001441_6545_7027 153
358 3300053156 Ga0500622_0002588 Ga0500622_0002588_12398_12871 153
359 3300053156 Ga0500622_0133805 Ga0500622_0133805_554_1030 153
360 3300053163 Ga0500639_102474 Ga0500639_102474_385_861 153
361 3300053727 Ga0500611_001781 Ga0500611_001781_649_1125 153
362 3300061719 Ga0466962_0138513 Ga0466962_0138513_128_616 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

77

177

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8848 1 153
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8732 1 153
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.8639 1 148
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.8319 1 148
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8216 5 153
ID Description Score Start End Superfamily
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.871 7 153 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.859 7 153 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8558 2 148 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8316 54 151 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8291 2 148 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A0Q6KAI3-F1-model_v4 Peroxiredoxin 0.9954 1 153
AF-A0A7Z7C0K9-F1-model_v4 Organic hydroperoxide reductase OsmC/OhrA 0.9952 1 153
AF-A0A2I9D7Q6-F1-model_v4 deleted 0.9944 1 152
AF-A0A5C6RFS3-F1-model_v4 OsmC family peroxiredoxin 0.9942 1 153
AF-A0A1H2AZC8-F1-model_v4 Organic hydroperoxide reductase OsmC/OhrA 0.9925 1 153

Feature Viewer

pLDDT pTM Quality
96.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map