F422106

General Info

Members Datasets Scaffolds Average Seq Length
361 182 722 189

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100080224|Ga0070670_1000802243
Length 223
Sequence LSLRQDLQDFSGLSCQSCLILQILSNAFHPMSRLPHLLLVLVFSSTCAYAQETRDKTPAKEEAPQQVTIVLATGNSLVVDEVSEGSDGYWYKRGNITTFLDRERVTRIEHPKPEGEAKASEPAAAGKWTLAEATKVERFFVSKFKRPLPLSAFGQSDLHTRWGLDHRNGMDVGLHPDSVEGRALVEFLRAESIPFLVFRGPVPGVATGPHIHIGNRSSRSYGR

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
146 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
147 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
148 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
149 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
152 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
153 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
154 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
155 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
156 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
157 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
158 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
159 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
160 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
161 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
162 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
163 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
164 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
165 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
168 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.49
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 32.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100080224 3300005331 Unclassified 2804
2 SwRhRL2b_contig_376955 2162886007 Bacteria 990
3 CNAas_1000124 3300000532 Bacteria 6420
4 JGI24751J29686_10000178 3300002459 Bacteria 29196
5 JGI25406J46586_10045373 3300003203 Bacteria 1513
6 Ga0065704_10073832 3300005289 Bacteria 6753
7 Ga0065712_10000866 3300005290 Bacteria 7711
8 Ga0065712_10010251 3300005290 Unclassified 3800
9 Ga0065712_10130899 3300005290 Bacteria 1551
10 Ga0065712_10186884 3300005290 Bacteria 1166
11 Ga0065715_10011189 3300005293 Bacteria 3316
12 Ga0065715_10013098 3300005293 Unclassified 2186
13 Ga0065715_10014582 3300005293 Unclassified 4718
14 Ga0065715_10280553 3300005293 Bacteria 1087
15 Ga0065715_10518895 3300005293 Unclassified 750
16 Ga0065707_10001165 3300005295 Bacteria 8977
17 Ga0065707_10167754 3300005295 Unclassified 1508
18 Ga0070670_100000114 3300005331 Bacteria 75910
19 Ga0070670_100101162 3300005331 Bacteria 2482
20 Ga0068869_100085400 3300005334 Bacteria 2364
21 Ga0068869_100277363 3300005334 Bacteria 1347
22 Ga0068869_100396899 3300005334 Bacteria 1134
23 Ga0070682_100006649 3300005337 Bacteria 6483
24 Ga0070689_100098547 3300005340 Unclassified 2312
25 Ga0070687_100078128 3300005343 Bacteria 1798
26 Ga0070692_10001286 3300005345 Bacteria 8986
27 Ga0070692_10040371 3300005345 Unclassified 2386
28 Ga0070692_10182918 3300005345 Bacteria 1216
29 Ga0070692_10197260 3300005345 Bacteria 1177
30 Ga0070675_100378372 3300005354 Bacteria 1260
31 Ga0070673_100141943 3300005364 Unclassified 2027
32 Ga0070673_100208697 3300005364 Bacteria 1686
33 Ga0070673_100584254 3300005364 Bacteria 1017
34 Ga0070688_100114446 3300005365 Bacteria 1798
35 Ga0070659_100118943 3300005366 Unclassified 2138
36 Ga0070703_10219871 3300005406 Unclassified 755
37 Ga0070701_10097180 3300005438 Unclassified 1625
38 Ga0070705_100057917 3300005440 Unclassified 2288
39 Ga0070705_100073311 3300005440 Bacteria 2077
40 Ga0070705_100084775 3300005440 Bacteria 1956
41 Ga0070705_100103976 3300005440 Bacteria 1800
42 Ga0070700_100044215 3300005441 Unclassified 2742
43 Ga0070700_100092581 3300005441 Unclassified 1975
44 Ga0070694_100005508 3300005444 Bacteria 7667
45 Ga0070694_100013829 3300005444 Bacteria 5046
46 Ga0070694_100057656 3300005444 Bacteria 2641
47 Ga0070685_10222142 3300005466 Unclassified 1238
48 Ga0070706_100002306 3300005467 Bacteria 19283
49 Ga0070706_100102504 3300005467 Bacteria 2660
50 Ga0070707_100154000 3300005468 Bacteria 2239
51 Ga0070707_100785500 3300005468 Unclassified 916
52 Ga0070707_100932237 3300005468 Unclassified 833
53 Ga0070699_100007242 3300005518 Bacteria 9652
54 Ga0070699_100024602 3300005518 Bacteria 5191
55 Ga0070699_100178835 3300005518 Bacteria 1882
56 Ga0070679_100019487 3300005530 Bacteria 6597
57 Ga0068853_100034730 3300005539 Unclassified 4281
58 Ga0068853_100194983 3300005539 Bacteria 1841
59 Ga0068853_100412185 3300005539 Bacteria 1266
60 Ga0068853_100951912 3300005539 Unclassified 826
61 Ga0070695_100014150 3300005545 Unclassified 4807
62 Ga0070695_100133611 3300005545 Bacteria 1713
63 Ga0070695_100145234 3300005545 Bacteria 1650
64 Ga0070695_100162485 3300005545 Unclassified 1569
65 Ga0070695_100327599 3300005545 Unclassified 1141
66 Ga0070696_100099991 3300005546 Bacteria 2077
67 Ga0070696_100151232 3300005546 Unclassified 1704
68 Ga0070696_100196426 3300005546 Unclassified 1504
69 Ga0070693_100026260 3300005547 Bacteria 3143
70 Ga0070693_100094287 3300005547 Bacteria 1811
71 Ga0070704_100021543 3300005549 Bacteria 4181
72 Ga0070704_100145474 3300005549 Unclassified 1857
73 Ga0070704_100213701 3300005549 Bacteria 1564
74 Ga0070664_100376003 3300005564 Bacteria 1296
75 Ga0068857_100501621 3300005577 Unclassified 1139
76 Ga0068854_100178983 3300005578 Unclassified 1655
77 Ga0068854_100651698 3300005578 Unclassified 904
78 Ga0070702_100005267 3300005615 Bacteria 6005
79 Ga0070702_100052009 3300005615 Bacteria 2348
80 Ga0070702_100052394 3300005615 Bacteria 2340
81 Ga0070702_100063937 3300005615 Bacteria 2150
82 Ga0068852_100057667 3300005616 Bacteria 3361
83 Ga0068852_100086887 3300005616 Bacteria 2789
84 Ga0068852_100764667 3300005616 Unclassified 979
85 Ga0068859_100027292 3300005617 Bacteria 5727
86 Ga0068859_100149836 3300005617 Bacteria 2408
87 Ga0068859_100164130 3300005617 Bacteria 2300
88 Ga0068859_100269603 3300005617 Unclassified 1794
89 Ga0068859_100538225 3300005617 Unclassified 1263
90 Ga0068859_100657985 3300005617 Bacteria 1139
91 Ga0068859_100889498 3300005617 Bacteria 975
92 Ga0068864_100002054 3300005618 Bacteria 16615
93 Ga0068864_100003495 3300005618 Bacteria 12987
94 Ga0068864_100036698 3300005618 Bacteria 4179
95 Ga0068864_100353715 3300005618 Bacteria 1387
96 Ga0068864_100398720 3300005618 Bacteria 1307
97 Ga0068864_100546842 3300005618 Bacteria 1119
98 Ga0068866_10376976 3300005718 Bacteria 909
99 Ga0068861_100002231 3300005719 Bacteria 12572
100 Ga0068851_10006507 3300005834 Bacteria 5334
101 Ga0068863_100025581 3300005841 Bacteria 5628
102 Ga0068863_100331303 3300005841 Unclassified 1480
103 Ga0068858_100140504 3300005842 Bacteria 2267
104 Ga0068858_100355062 3300005842 Bacteria 1404
105 Ga0068858_100442041 3300005842 Bacteria 1252
106 Ga0068858_100449807 3300005842 Unclassified 1241
107 Ga0068860_100039143 3300005843 Bacteria 4535
108 Ga0068860_100093026 3300005843 Bacteria 2873
109 Ga0068860_100100206 3300005843 Bacteria 2763
110 Ga0068860_100113698 3300005843 Bacteria 2588
111 Ga0068860_100169643 3300005843 Bacteria 2107
112 Ga0068860_100424953 3300005843 Unclassified 1318
113 Ga0068860_100566085 3300005843 Unclassified 1139
114 Ga0068862_100189475 3300005844 Bacteria 1850
115 Ga0068862_100523182 3300005844 Bacteria 1129
116 Ga0081539_10001697 3300005985 Bacteria 35528
117 Ga0081539_10002668 3300005985 Bacteria 24283
118 Ga0097621_100006542 3300006237 Bacteria 8276
119 Ga0097621_100454294 3300006237 Unclassified 1154
120 Ga0068871_100173423 3300006358 Bacteria 1850
121 Ga0075428_100049079 3300006844 Bacteria 4631
122 Ga0075428_100252786 3300006844 Bacteria 1899
123 Ga0075428_100549844 3300006844 Unclassified 1234
124 Ga0075430_100076761 3300006846 Bacteria 2800
125 Ga0075430_100080828 3300006846 Bacteria 2722
126 Ga0075431_100068627 3300006847 Unclassified 3658
127 Ga0075433_10015946 3300006852 Bacteria 6179
128 Ga0075433_10040920 3300006852 Unclassified 4014
129 Ga0075433_10164786 3300006852 Bacteria 1973
130 Ga0075433_10251714 3300006852 Bacteria 1567
131 Ga0075434_100003211 3300006871 Bacteria 14574
132 Ga0075434_100121944 3300006871 Unclassified 2622
133 Ga0075429_100007029 3300006880 Bacteria 9777
134 Ga0075429_100046777 3300006880 Bacteria 3764
135 Ga0068865_100234746 3300006881 Unclassified 1440
136 Ga0075436_100048447 3300006914 Unclassified 2932
137 Ga0097620_100027291 3300006931 Bacteria 5727
138 Ga0097620_100149843 3300006931 Bacteria 2408
139 Ga0097620_100164142 3300006931 Bacteria 2300
140 Ga0097620_100269594 3300006931 Unclassified 1794
141 Ga0097620_100538220 3300006931 Unclassified 1263
142 Ga0097620_100657947 3300006931 Bacteria 1139
143 Ga0097620_100889490 3300006931 Bacteria 975
144 Ga0097620_100901777 3300006931 Bacteria 969
145 Ga0075435_100006951 3300007076 Bacteria 8031
146 Ga0105240_10049705 3300009093 Bacteria 5291
147 Ga0105240_10153079 3300009093 Unclassified 2745
148 Ga0111539_10005260 3300009094 Bacteria 16759
149 Ga0111539_10009029 3300009094 Bacteria 12616
150 Ga0105247_10001363 3300009101 Bacteria 17765
151 Ga0105247_10275036 3300009101 Bacteria 1160
152 Ga0105247_10519312 3300009101 Bacteria 871
153 Ga0114129_10022539 3300009147 Bacteria 8934
154 Ga0114129_10049880 3300009147 Bacteria 5880
155 Ga0114129_10116427 3300009147 Bacteria 3683
156 Ga0114129_10138330 3300009147 Bacteria 3341
157 Ga0114129_10305551 3300009147 Unclassified 2119
158 Ga0114129_10577332 3300009147 Bacteria 1459
159 Ga0114129_10907776 3300009147 Bacteria 1116
160 Ga0105243_10070464 3300009148 Unclassified 2823
161 Ga0105243_10534953 3300009148 Bacteria 1117
162 Ga0105241_10989552 3300009174 Unclassified 786
163 Ga0105242_10368192 3300009176 Unclassified 1332
164 Ga0105248_10001900 3300009177 Bacteria 23164
165 Ga0105248_10082736 3300009177 Bacteria 3611
166 Ga0105248_10151697 3300009177 Unclassified 2615
167 Ga0105248_10210457 3300009177 Unclassified 2191
168 Ga0105248_10215088 3300009177 Bacteria 2165
169 Ga0105248_10467913 3300009177 Bacteria 1421
170 Ga0105248_11298545 3300009177 Unclassified 823
171 Ga0105237_10000767 3300009545 Bacteria 43919
172 Ga0105238_10008398 3300009551 Bacteria 10334
173 Ga0105238_10008722 3300009551 Bacteria 10143
174 Ga0105238_10248375 3300009551 Unclassified 1757
175 Ga0105249_10101283 3300009553 Bacteria 2709
176 Ga0105249_11291162 3300009553 Unclassified 801
177 Ga0105239_10194363 3300010375 Bacteria 2272
178 Ga0105239_12315227 3300010375 Unclassified 625
179 Ga0105246_10488394 3300011119 Bacteria 1043
180 Ga0105246_10535543 3300011119 Bacteria 1001
181 Ga0105246_10717932 3300011119 Unclassified 878
182 Ga0105246_10876835 3300011119 Bacteria 803
183 Ga0157373_10126023 3300013100 Unclassified 1801
184 Ga0157373_10330694 3300013100 Bacteria 1085
185 Ga0157371_10187824 3300013102 Unclassified 1479
186 Ga0157371_10247443 3300013102 Bacteria 1283
187 Ga0157371_10731224 3300013102 Bacteria 742
188 Ga0157374_11508612 3300013296 Unclassified 695
189 Ga0163162_10638752 3300013306 Bacteria 1189
190 Ga0157372_10013334 3300013307 Bacteria 8775
191 Ga0157375_10078850 3300013308 Unclassified 3328
192 Ga0157375_10095210 3300013308 Bacteria 3048
193 Ga0157375_10168492 3300013308 Unclassified 2336
194 Ga0157375_10332511 3300013308 Bacteria 1684
195 Ga0163163_10005030 3300014325 Bacteria 11393
196 Ga0163163_10005896 3300014325 Bacteria 10662
197 Ga0163163_10760640 3300014325 Bacteria 1032
198 Ga0163163_11025917 3300014325 Unclassified 888
199 Ga0157377_10078425 3300014745 Unclassified 1925
200 Ga0157377_10576285 3300014745 Unclassified 799
201 Ga0157379_10125941 3300014968 Bacteria 2305
202 Ga0157379_10500363 3300014968 Unclassified 1126
203 Ga0207656_10004333 3300025321 Bacteria 4948
204 Ga0207653_10025249 3300025885 Unclassified 1900
205 Ga0207653_10096222 3300025885 Unclassified 1042
206 Ga0207642_10402313 3300025899 Bacteria 820
207 Ga0207710_10001253 3300025900 Bacteria 12861
208 Ga0207647_10006715 3300025904 Bacteria 8357
209 Ga0207647_10227850 3300025904 Bacteria 1073
210 Ga0207643_10008772 3300025908 Bacteria 5422
211 Ga0207643_10021688 3300025908 Bacteria 3532
212 Ga0207684_10000172 3300025910 Bacteria 106888
213 Ga0207654_10058501 3300025911 Bacteria 2244
214 Ga0207654_10462874 3300025911 Unclassified 891
215 Ga0207695_10097098 3300025913 Bacteria 2947
216 Ga0207671_10012031 3300025914 Bacteria 6990
217 Ga0207662_10005295 3300025918 Bacteria 6857
218 Ga0207646_10526983 3300025922 Unclassified 1063
219 Ga0207646_10750620 3300025922 Unclassified 871
220 Ga0207694_10004349 3300025924 Bacteria 11065
221 Ga0207694_10033118 3300025924 Bacteria 3958
222 Ga0207650_10000022 3300025925 Bacteria 318878
223 Ga0207650_10103668 3300025925 Bacteria 2193
224 Ga0207650_10316092 3300025925 Unclassified 1278
225 Ga0207650_10508530 3300025925 Bacteria 1007
226 Ga0207690_10078234 3300025932 Unclassified 2301
227 Ga0207706_10207739 3300025933 Bacteria 1717
228 Ga0207686_10037590 3300025934 Unclassified 2923
229 Ga0207709_10040022 3300025935 Unclassified 2804
230 Ga0207670_10002441 3300025936 Bacteria 9751
231 Ga0207670_10128125 3300025936 Bacteria 1855
232 Ga0207704_10138678 3300025938 Bacteria 1697
233 Ga0207711_10011398 3300025941 Bacteria 7388
234 Ga0207711_10042606 3300025941 Unclassified 3868
235 Ga0207711_10154072 3300025941 Bacteria 2076
236 Ga0207711_10249513 3300025941 Bacteria 1629
237 Ga0207711_10518844 3300025941 Bacteria 1111
238 Ga0207711_11022719 3300025941 Bacteria 766
239 Ga0207689_10022406 3300025942 Bacteria 5312
240 Ga0207689_10629773 3300025942 Bacteria 903
241 Ga0207679_10153805 3300025945 Bacteria 1876
242 Ga0207679_10171672 3300025945 Unclassified 1786
243 Ga0207679_10217476 3300025945 Unclassified 1606
244 Ga0207651_10137099 3300025960 Bacteria 1884
245 Ga0207651_10829939 3300025960 Unclassified 821
246 Ga0207712_10049807 3300025961 Bacteria 2922
247 Ga0207677_11133402 3300026023 Unclassified 714
248 Ga0207639_10352945 3300026041 Bacteria 1314
249 Ga0207639_10569513 3300026041 Bacteria 1042
250 Ga0207678_10530771 3300026067 Bacteria 1028
251 Ga0207708_10007271 3300026075 Bacteria 8186
252 Ga0207708_10011116 3300026075 Bacteria 6694
253 Ga0207641_10017888 3300026088 Bacteria 5806
254 Ga0207641_10218879 3300026088 Bacteria 1765
255 Ga0207648_10038219 3300026089 Unclassified 4224
256 Ga0207676_10022986 3300026095 Bacteria 4592
257 Ga0207676_10119348 3300026095 Bacteria 2221
258 Ga0207676_11225002 3300026095 Unclassified 744
259 Ga0207674_10315205 3300026116 Bacteria 1513
260 Ga0207674_10416083 3300026116 Bacteria 1299
261 Ga0207675_100004925 3300026118 Bacteria 12866
262 Ga0207675_100033919 3300026118 Bacteria 4757
263 Ga0207698_10059374 3300026142 Bacteria 2970
264 Ga0207698_10108922 3300026142 Unclassified 2317
265 Ga0207698_10517517 3300026142 Bacteria 1164
266 Ga0207428_10009114 3300027907 Bacteria 8918
267 Ga0268264_10018563 3300028381 Bacteria 5688
268 Ga0268264_10085847 3300028381 Bacteria 2702
269 Ga0268264_10111873 3300028381 Bacteria 2393
270 Ga0307408_100056939 3300031548 Bacteria 2836
271 Ga0307408_100062730 3300031548 Archaea 2717
272 Ga0307408_100377796 3300031548 Unclassified 1210
273 Ga0307405_10161791 3300031731 Bacteria 1586
274 Ga0307412_10849978 3300031911 Unclassified 796
275 Ga0307412_10892239 3300031911 Unclassified 778
276 Ga0307416_100068615 3300032002 Archaea 2930
277 Ga0307414_10007198 3300032004 Bacteria 6244
278 Ga0307414_10025445 3300032004 Bacteria 3792
279 Ga0307415_100038059 3300032126 Bacteria 3167
280 Ga0307415_100256353 3300032126 Archaea 1424
281 Ga0373930_0136847 3300034816 Unclassified 606
282 Ga0373938_0081652 3300034957 Bacteria 788
283 Ga0373940_0060566 3300035088 Unclassified 1082
284 Ga0373951_0005932 3300035091 Bacteria 2818
285 Ga0373932_0094886 3300035112 Unclassified 963
286 Ga0373941_0047895 3300035115 Unclassified 1348
287 Ga0395900_0072635 3300037418 Bacteria 3537
288 Ga0395898_0347382 3300037466 Bacteria 1415
289 Ga0395901_0057928 3300038443 Bacteria 4030
290 Ga0395901_0420890 3300038443 Unclassified 1370
291 Ga0439446_0096081 3300042156 Bacteria 932
292 Ga0451576_0151703 3300045051 Bacteria 2417
293 Ga0451576_0362583 3300045051 Bacteria 1518
294 Ga0496102_0282055 3300048905 Unclassified 1566
295 Ga0496103_0718660 3300048906 Unclassified 633
296 Ga0496104_0226479 3300048907 Bacteria 1782
297 Ga0496110_0100942 3300048913 Bacteria 2587
298 Ga0496111_0781469 3300048914 Unclassified 692
299 Ga0496112_0067991 3300048915 Unclassified 3518
300 Ga0496112_0180322 3300048915 Bacteria 2076
301 Ga0496112_0227223 3300048915 Bacteria 1821
302 Ga0496113_0048393 3300048916 Unclassified 3163
303 Ga0501306_051312 3300049127 Unclassified 662
304 Ga0501291_005325 3300049514 Unclassified 1675
305 Ga0501292_003587 3300049515 Bacteria 2083
306 Ga0501292_005596 3300049515 Bacteria 1758
307 Ga0501298_005267 3300049521 Bacteria 2068
308 Ga0501299_004042 3300049522 Bacteria 2167
309 Ga0501299_032766 3300049522 Unclassified 1010
310 Ga0501312_029146 3300049528 Bacteria 859
311 Ga0501038_0008652 3300049574 Bacteria 9347
312 Ga0501202_004544 3300049652 Bacteria 2431
313 Ga0501207_014380 3300049654 Unclassified 1208
314 Ga0501223_014284 3300049663 Bacteria 1576
315 Ga0501224_009400 3300049664 Bacteria 1430
316 Ga0501227_007144 3300049665 Bacteria 2389
317 Ga0501227_009451 3300049665 Bacteria 2102
318 Ga0501230_002022 3300049667 Bacteria 2538
319 Ga0501235_008354 3300049669 Bacteria 2259
320 Ga0501236_037430 3300049670 Bacteria 792
321 Ga0501236_090540 3300049670 Unclassified 587
322 Ga0501239_001403 3300049672 Bacteria 2058
323 Ga0501247_003315 3300049677 Unclassified 1720
324 Ga0501252_032230 3300049682 Unclassified 730
325 Ga0501257_002959 3300049686 Bacteria 3608
326 Ga0501257_122654 3300049686 Unclassified 697
327 Ga0501259_014746 3300049688 Bacteria 1328
328 Ga0501259_023408 3300049688 Unclassified 1118
329 Ga0501261_006045 3300049690 Unclassified 1535
330 Ga0501221_032644 3300049704 Unclassified 1095
331 Ga0501225_0002787 3300049705 Bacteria 5368
332 Ga0501225_0005983 3300049705 Bacteria 3556
333 Ga0501225_0018059 3300049705 Bacteria 1957
334 Ga0501234_000635 3300049707 Bacteria 5409
335 Ga0501234_009709 3300049707 Unclassified 1502
336 Ga0501245_003655 3300049708 Bacteria 2097
337 Ga0501080_1068236 3300049742 Unclassified 698
338 Ga0501212_007541 3300049851 Bacteria 1494
339 nmdc:mga05p37_1018831_c1 3300050507 Unclassified 877
340 nmdc:mga05p37_192644_c1 3300050507 Bacteria 2474
341 nmdc:mga05p37_242537_c1 3300050507 Unclassified 2166
342 nmdc:mga05p37_418053_c1 3300050507 Bacteria 1561
343 nmdc:mga05p37_562930_c1 3300050507 Unclassified 1295
344 nmdc:mga09592_223371_c1 3300050508 Bacteria 1632
345 nmdc:mga09592_288941_c1 3300050508 Unclassified 1422
346 nmdc:mga0qj67_441358_c1 3300050509 Unclassified 1049
347 nmdc:mga06r32_178955_c1 3300050510 Unclassified 2106
348 nmdc:mga08y16_116073_c1 3300050511 Unclassified 2787
349 nmdc:mga08y16_6584_c1 3300050511 Bacteria 12181
350 nmdc:mga0n895_122706_c1 3300050512 Bacteria 2620
351 nmdc:mga0n895_381598_c1 3300050512 Bacteria 1426
352 nmdc:mga0rr50_532671_c2 3300050513 Bacteria 653
353 nmdc:mga08x19_11652_c1 3300050514 Bacteria 5293
354 nmdc:mga0a205_253091_c1 3300050515 Bacteria 1640
355 nmdc:mga0a205_460195_c1 3300050515 Bacteria 1132
356 nmdc:mga0a205_65199_c1 3300050515 Bacteria 3518
357 nmdc:mga0a205_7821_c1 3300050515 Bacteria 6233
358 nmdc:mga0a205_93069_c1 3300050515 Bacteria 2912
359 Ga0501084_0154967 3300054114 Bacteria 1932
360 Ga0590074_040706 3300059423 Unclassified 836
361 Ga0530510_0030884 3300061734 Unclassified 3850
362 Ga0070670_100080224
363 SwRhRL2b_contig_376955
364 CNAas_1000124
365 JGI24751J29686_10000178
366 JGI25406J46586_10045373
367 Ga0065704_10073832
368 Ga0065712_10000866
369 Ga0065712_10010251
370 Ga0065712_10130899
371 Ga0065712_10186884
372 Ga0065715_10011189
373 Ga0065715_10013098
374 Ga0065715_10014582
375 Ga0065715_10280553
376 Ga0065715_10518895
377 Ga0065707_10001165
378 Ga0065707_10167754
379 Ga0070670_100000114
380 Ga0070670_100101162
381 Ga0068869_100085400
382 Ga0068869_100277363
383 Ga0068869_100396899
384 Ga0070682_100006649
385 Ga0070689_100098547
386 Ga0070687_100078128
387 Ga0070692_10001286
388 Ga0070692_10040371
389 Ga0070692_10182918
390 Ga0070692_10197260
391 Ga0070675_100378372
392 Ga0070673_100141943
393 Ga0070673_100208697
394 Ga0070673_100584254
395 Ga0070688_100114446
396 Ga0070659_100118943
397 Ga0070703_10219871
398 Ga0070701_10097180
399 Ga0070705_100057917
400 Ga0070705_100073311
401 Ga0070705_100084775
402 Ga0070705_100103976
403 Ga0070700_100044215
404 Ga0070700_100092581
405 Ga0070694_100005508
406 Ga0070694_100013829
407 Ga0070694_100057656
408 Ga0070685_10222142
409 Ga0070706_100002306
410 Ga0070706_100102504
411 Ga0070707_100154000
412 Ga0070707_100785500
413 Ga0070707_100932237
414 Ga0070699_100007242
415 Ga0070699_100024602
416 Ga0070699_100178835
417 Ga0070679_100019487
418 Ga0068853_100034730
419 Ga0068853_100194983
420 Ga0068853_100412185
421 Ga0068853_100951912
422 Ga0070695_100014150
423 Ga0070695_100133611
424 Ga0070695_100145234
425 Ga0070695_100162485
426 Ga0070695_100327599
427 Ga0070696_100099991
428 Ga0070696_100151232
429 Ga0070696_100196426
430 Ga0070693_100026260
431 Ga0070693_100094287
432 Ga0070704_100021543
433 Ga0070704_100145474
434 Ga0070704_100213701
435 Ga0070664_100376003
436 Ga0068857_100501621
437 Ga0068854_100178983
438 Ga0068854_100651698
439 Ga0070702_100005267
440 Ga0070702_100052009
441 Ga0070702_100052394
442 Ga0070702_100063937
443 Ga0068852_100057667
444 Ga0068852_100086887
445 Ga0068852_100764667
446 Ga0068859_100027292
447 Ga0068859_100149836
448 Ga0068859_100164130
449 Ga0068859_100269603
450 Ga0068859_100538225
451 Ga0068859_100657985
452 Ga0068859_100889498
453 Ga0068864_100002054
454 Ga0068864_100003495
455 Ga0068864_100036698
456 Ga0068864_100353715
457 Ga0068864_100398720
458 Ga0068864_100546842
459 Ga0068866_10376976
460 Ga0068861_100002231
461 Ga0068851_10006507
462 Ga0068863_100025581
463 Ga0068863_100331303
464 Ga0068858_100140504
465 Ga0068858_100355062
466 Ga0068858_100442041
467 Ga0068858_100449807
468 Ga0068860_100039143
469 Ga0068860_100093026
470 Ga0068860_100100206
471 Ga0068860_100113698
472 Ga0068860_100169643
473 Ga0068860_100424953
474 Ga0068860_100566085
475 Ga0068862_100189475
476 Ga0068862_100523182
477 Ga0081539_10001697
478 Ga0081539_10002668
479 Ga0097621_100006542
480 Ga0097621_100454294
481 Ga0068871_100173423
482 Ga0075428_100049079
483 Ga0075428_100252786
484 Ga0075428_100549844
485 Ga0075430_100076761
486 Ga0075430_100080828
487 Ga0075431_100068627
488 Ga0075433_10015946
489 Ga0075433_10040920
490 Ga0075433_10164786
491 Ga0075433_10251714
492 Ga0075434_100003211
493 Ga0075434_100121944
494 Ga0075429_100007029
495 Ga0075429_100046777
496 Ga0068865_100234746
497 Ga0075436_100048447
498 Ga0097620_100027291
499 Ga0097620_100149843
500 Ga0097620_100164142
501 Ga0097620_100269594
502 Ga0097620_100538220
503 Ga0097620_100657947
504 Ga0097620_100889490
505 Ga0097620_100901777
506 Ga0075435_100006951
507 Ga0105240_10049705
508 Ga0105240_10153079
509 Ga0111539_10005260
510 Ga0111539_10009029
511 Ga0105247_10001363
512 Ga0105247_10275036
513 Ga0105247_10519312
514 Ga0114129_10022539
515 Ga0114129_10049880
516 Ga0114129_10116427
517 Ga0114129_10138330
518 Ga0114129_10305551
519 Ga0114129_10577332
520 Ga0114129_10907776
521 Ga0105243_10070464
522 Ga0105243_10534953
523 Ga0105241_10989552
524 Ga0105242_10368192
525 Ga0105248_10001900
526 Ga0105248_10082736
527 Ga0105248_10151697
528 Ga0105248_10210457
529 Ga0105248_10215088
530 Ga0105248_10467913
531 Ga0105248_11298545
532 Ga0105237_10000767
533 Ga0105238_10008398
534 Ga0105238_10008722
535 Ga0105238_10248375
536 Ga0105249_10101283
537 Ga0105249_11291162
538 Ga0105239_10194363
539 Ga0105239_12315227
540 Ga0105246_10488394
541 Ga0105246_10535543
542 Ga0105246_10717932
543 Ga0105246_10876835
544 Ga0157373_10126023
545 Ga0157373_10330694
546 Ga0157371_10187824
547 Ga0157371_10247443
548 Ga0157371_10731224
549 Ga0157374_11508612
550 Ga0163162_10638752
551 Ga0157372_10013334
552 Ga0157375_10078850
553 Ga0157375_10095210
554 Ga0157375_10168492
555 Ga0157375_10332511
556 Ga0163163_10005030
557 Ga0163163_10005896
558 Ga0163163_10760640
559 Ga0163163_11025917
560 Ga0157377_10078425
561 Ga0157377_10576285
562 Ga0157379_10125941
563 Ga0157379_10500363
564 Ga0207656_10004333
565 Ga0207653_10025249
566 Ga0207653_10096222
567 Ga0207642_10402313
568 Ga0207710_10001253
569 Ga0207647_10006715
570 Ga0207647_10227850
571 Ga0207643_10008772
572 Ga0207643_10021688
573 Ga0207684_10000172
574 Ga0207654_10058501
575 Ga0207654_10462874
576 Ga0207695_10097098
577 Ga0207671_10012031
578 Ga0207662_10005295
579 Ga0207646_10526983
580 Ga0207646_10750620
581 Ga0207694_10004349
582 Ga0207694_10033118
583 Ga0207650_10000022
584 Ga0207650_10103668
585 Ga0207650_10316092
586 Ga0207650_10508530
587 Ga0207690_10078234
588 Ga0207706_10207739
589 Ga0207686_10037590
590 Ga0207709_10040022
591 Ga0207670_10002441
592 Ga0207670_10128125
593 Ga0207704_10138678
594 Ga0207711_10011398
595 Ga0207711_10042606
596 Ga0207711_10154072
597 Ga0207711_10249513
598 Ga0207711_10518844
599 Ga0207711_11022719
600 Ga0207689_10022406
601 Ga0207689_10629773
602 Ga0207679_10153805
603 Ga0207679_10171672
604 Ga0207679_10217476
605 Ga0207651_10137099
606 Ga0207651_10829939
607 Ga0207712_10049807
608 Ga0207677_11133402
609 Ga0207639_10352945
610 Ga0207639_10569513
611 Ga0207678_10530771
612 Ga0207708_10007271
613 Ga0207708_10011116
614 Ga0207641_10017888
615 Ga0207641_10218879
616 Ga0207648_10038219
617 Ga0207676_10022986
618 Ga0207676_10119348
619 Ga0207676_11225002
620 Ga0207674_10315205
621 Ga0207674_10416083
622 Ga0207675_100004925
623 Ga0207675_100033919
624 Ga0207698_10059374
625 Ga0207698_10108922
626 Ga0207698_10517517
627 Ga0207428_10009114
628 Ga0268264_10018563
629 Ga0268264_10085847
630 Ga0268264_10111873
631 Ga0307408_100056939
632 Ga0307408_100062730
633 Ga0307408_100377796
634 Ga0307405_10161791
635 Ga0307412_10849978
636 Ga0307412_10892239
637 Ga0307416_100068615
638 Ga0307414_10007198
639 Ga0307414_10025445
640 Ga0307415_100038059
641 Ga0307415_100256353
642 Ga0373930_0136847
643 Ga0373938_0081652
644 Ga0373940_0060566
645 Ga0373951_0005932
646 Ga0373932_0094886
647 Ga0373941_0047895
648 Ga0395900_0072635
649 Ga0395898_0347382
650 Ga0395901_0057928
651 Ga0395901_0420890
652 Ga0439446_0096081
653 Ga0451576_0151703
654 Ga0451576_0362583
655 Ga0496102_0282055
656 Ga0496103_0718660
657 Ga0496104_0226479
658 Ga0496110_0100942
659 Ga0496111_0781469
660 Ga0496112_0067991
661 Ga0496112_0180322
662 Ga0496112_0227223
663 Ga0496113_0048393
664 Ga0501306_051312
665 Ga0501291_005325
666 Ga0501292_003587
667 Ga0501292_005596
668 Ga0501298_005267
669 Ga0501299_004042
670 Ga0501299_032766
671 Ga0501312_029146
672 Ga0501038_0008652
673 Ga0501202_004544
674 Ga0501207_014380
675 Ga0501223_014284
676 Ga0501224_009400
677 Ga0501227_007144
678 Ga0501227_009451
679 Ga0501230_002022
680 Ga0501235_008354
681 Ga0501236_037430
682 Ga0501236_090540
683 Ga0501239_001403
684 Ga0501247_003315
685 Ga0501252_032230
686 Ga0501257_002959
687 Ga0501257_122654
688 Ga0501259_014746
689 Ga0501259_023408
690 Ga0501261_006045
691 Ga0501221_032644
692 Ga0501225_0002787
693 Ga0501225_0005983
694 Ga0501225_0018059
695 Ga0501234_000635
696 Ga0501234_009709
697 Ga0501245_003655
698 Ga0501080_1068236
699 Ga0501212_007541
700 nmdc:mga05p37_1018831_c1
701 nmdc:mga05p37_192644_c1
702 nmdc:mga05p37_242537_c1
703 nmdc:mga05p37_418053_c1
704 nmdc:mga05p37_562930_c1
705 nmdc:mga09592_223371_c1
706 nmdc:mga09592_288941_c1
707 nmdc:mga0qj67_441358_c1
708 nmdc:mga06r32_178955_c1
709 nmdc:mga08y16_116073_c1
710 nmdc:mga08y16_6584_c1
711 nmdc:mga0n895_122706_c1
712 nmdc:mga0n895_381598_c1
713 nmdc:mga0rr50_532671_c2
714 nmdc:mga08x19_11652_c1
715 nmdc:mga0a205_253091_c1
716 nmdc:mga0a205_460195_c1
717 nmdc:mga0a205_65199_c1
718 nmdc:mga0a205_7821_c1
719 nmdc:mga0a205_93069_c1
720 Ga0501084_0154967
721 Ga0590074_040706
722 Ga0530510_0030884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map