F421978
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 360 | 241 | 355 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300046694|Ga0495649_0081151|Ga0495649_0081151_908_1531 |
| Length | 207 |
| Sequence | LNSKSGITSESGGSPAAASGVVPDDLVQVGFVFGAYGLVGGVRIRPFSADADALLHAKTWWLDKPGMRGVEVKRAKMHSGDVVATLVEVGDRDMAEALKGAAVFIPRSQFPKLDDEDEFYWADLIGLAVENQQGESLGVVHDMMSNGPQSILRVAPAAAPDGSTSEASSGQLSVQLSDERLIPFVDRFVIKVDKAAKKIVVDWGLDY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 3 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 4 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 5 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 6 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 119 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 132 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 141 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 142 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 143 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 144 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 145 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 146 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 147 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 187 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 188 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 189 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 192 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 193 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 194 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 195 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 196 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 197 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 198 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 207 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80 |
| Metatranscriptomes | 18.61 |
| Isolates | 1.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.17 |
| Nodule | 0 |
| Rhizoplane | 6.39 |
| Rhizosphere | 87.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006770J48903_1044971 | 3300003305 | Bacteria | 966 |
| 2 | rootH1_10078610 | 3300003316 | Bacteria | 2069 |
| 3 | Ga0007417J51691_1034645 | 3300003544 | Bacteria | 908 |
| 4 | Ga0007410J51695_1045320 | 3300003574 | Bacteria | 881 |
| 5 | Ga0007429J51699_1036152 | 3300003579 | Bacteria | 1269 |
| 6 | Ga0032354_1044129 | 3300003693 | Bacteria | 1010 |
| 7 | Ga0055529_1000478 | 3300003763 | Bacteria | 38030 |
| 8 | Ga0055526_1000709 | 3300003771 | Bacteria | 25255 |
| 9 | Ga0055526_1000967 | 3300003771 | Bacteria | 21251 |
| 10 | Ga0055537_1000822 | 3300003773 | Bacteria | 15242 |
| 11 | Ga0055524_1003597 | 3300003775 | Bacteria | 7473 |
| 12 | Ga0055534_1000601 | 3300003784 | Bacteria | 18680 |
| 13 | Ga0055528_1000050 | 3300003790 | Bacteria | 93078 |
| 14 | Ga0070658_10292657 | 3300005327 | Bacteria | 1388 |
| 15 | Ga0070676_10297788 | 3300005328 | Bacteria | 1092 |
| 16 | Ga0070683_100031806 | 3300005329 | Bacteria | 4801 |
| 17 | Ga0070683_100345248 | 3300005329 | Bacteria | 1417 |
| 18 | Ga0070690_100573873 | 3300005330 | Bacteria | 853 |
| 19 | Ga0068869_100116268 | 3300005334 | Bacteria | 2040 |
| 20 | Ga0070680_100063571 | 3300005336 | Bacteria | 3023 |
| 21 | Ga0068868_100007250 | 3300005338 | Bacteria | 7885 |
| 22 | Ga0070660_100033410 | 3300005339 | Bacteria | 3878 |
| 23 | Ga0070660_100056839 | 3300005339 | Bacteria | 3028 |
| 24 | Ga0070660_100951534 | 3300005339 | Bacteria | 725 |
| 25 | Ga0070661_100006678 | 3300005344 | Bacteria | 7957 |
| 26 | Ga0070661_100392787 | 3300005344 | Bacteria | 1095 |
| 27 | Ga0070692_10088785 | 3300005345 | Bacteria | 1677 |
| 28 | Ga0070669_100030757 | 3300005353 | Bacteria | 3875 |
| 29 | Ga0070675_100002913 | 3300005354 | Bacteria | 12900 |
| 30 | Ga0070671_100026405 | 3300005355 | Bacteria | 4772 |
| 31 | Ga0070659_100016269 | 3300005366 | Bacteria | 5583 |
| 32 | Ga0070659_100371939 | 3300005366 | Bacteria | 1202 |
| 33 | Ga0070659_100590631 | 3300005366 | Bacteria | 953 |
| 34 | Ga0070667_100027407 | 3300005367 | Bacteria | 4739 |
| 35 | Ga0070667_100098290 | 3300005367 | Bacteria | 2526 |
| 36 | Ga0070667_100145127 | 3300005367 | Bacteria | 2081 |
| 37 | Ga0070701_10229450 | 3300005438 | Bacteria | 1111 |
| 38 | Ga0070700_100346310 | 3300005441 | Bacteria | 1100 |
| 39 | Ga0070663_100002045 | 3300005455 | Bacteria | 11280 |
| 40 | Ga0070663_100933565 | 3300005455 | Unclassified | 751 |
| 41 | Ga0070678_100116129 | 3300005456 | Bacteria | 2102 |
| 42 | Ga0070662_100017564 | 3300005457 | Bacteria | 4825 |
| 43 | Ga0070681_10292477 | 3300005458 | Bacteria | 1539 |
| 44 | Ga0070681_10677835 | 3300005458 | Bacteria | 946 |
| 45 | Ga0070679_100021313 | 3300005530 | Bacteria | 6325 |
| 46 | Ga0070679_100300863 | 3300005530 | Bacteria | 1555 |
| 47 | Ga0068853_100016917 | 3300005539 | Bacteria | 6011 |
| 48 | Ga0068853_100460753 | 3300005539 | Bacteria | 1196 |
| 49 | Ga0070672_100013676 | 3300005543 | Bacteria | 5738 |
| 50 | Ga0070693_100434691 | 3300005547 | Bacteria | 917 |
| 51 | Ga0070664_100005621 | 3300005564 | Bacteria | 10089 |
| 52 | Ga0068857_100037458 | 3300005577 | Bacteria | 4296 |
| 53 | Ga0068856_100090006 | 3300005614 | Bacteria | 3052 |
| 54 | Ga0068856_100167235 | 3300005614 | Bacteria | 2210 |
| 55 | Ga0068856_100240220 | 3300005614 | Bacteria | 1827 |
| 56 | Ga0068856_101388115 | 3300005614 | Bacteria | 717 |
| 57 | Ga0068852_100007663 | 3300005616 | Bacteria | 7896 |
| 58 | Ga0068852_100084612 | 3300005616 | Bacteria | 2823 |
| 59 | Ga0068852_100323911 | 3300005616 | Bacteria | 1497 |
| 60 | Ga0068852_101656106 | 3300005616 | Bacteria | 662 |
| 61 | Ga0068859_100144987 | 3300005617 | Bacteria | 2449 |
| 62 | Ga0068859_100399405 | 3300005617 | Bacteria | 1470 |
| 63 | Ga0068864_100405350 | 3300005618 | Bacteria | 1296 |
| 64 | Ga0068861_100000757 | 3300005719 | Bacteria | 19364 |
| 65 | Ga0068851_10018213 | 3300005834 | Bacteria | 3381 |
| 66 | Ga0068851_10081821 | 3300005834 | Bacteria | 1687 |
| 67 | Ga0068863_100099315 | 3300005841 | Bacteria | 2765 |
| 68 | Ga0068863_100610029 | 3300005841 | Bacteria | 1080 |
| 69 | Ga0068858_100019626 | 3300005842 | Bacteria | 6319 |
| 70 | Ga0068860_100033406 | 3300005843 | Bacteria | 4936 |
| 71 | Ga0068860_100551594 | 3300005843 | Bacteria | 1155 |
| 72 | Ga0075432_10039542 | 3300006058 | Bacteria | 1645 |
| 73 | Ga0068871_100684300 | 3300006358 | Bacteria | 939 |
| 74 | Ga0075434_100166543 | 3300006871 | Bacteria | 2224 |
| 75 | Ga0068865_100309763 | 3300006881 | Bacteria | 1267 |
| 76 | Ga0097620_100144996 | 3300006931 | Bacteria | 2449 |
| 77 | Ga0097620_100399379 | 3300006931 | Bacteria | 1470 |
| 78 | Ga0105245_10109932 | 3300009098 | Bacteria | 2562 |
| 79 | Ga0105242_10181008 | 3300009176 | Bacteria | 1859 |
| 80 | Ga0105248_10081871 | 3300009177 | Bacteria | 3629 |
| 81 | Ga0105248_10404876 | 3300009177 | Bacteria | 1536 |
| 82 | Ga0105238_10059079 | 3300009551 | Bacteria | 3842 |
| 83 | Ga0105238_10081408 | 3300009551 | Bacteria | 3227 |
| 84 | Ga0105239_10197223 | 3300010375 | Bacteria | 2254 |
| 85 | Ga0157373_10038721 | 3300013100 | Bacteria | 3416 |
| 86 | Ga0157369_10065353 | 3300013105 | Bacteria | 3915 |
| 87 | Ga0157369_10454278 | 3300013105 | Bacteria | 1327 |
| 88 | Ga0157374_10353148 | 3300013296 | Bacteria | 1461 |
| 89 | Ga0163162_10012542 | 3300013306 | Bacteria | 8279 |
| 90 | Ga0157372_10016161 | 3300013307 | Bacteria | 8007 |
| 91 | Ga0157372_10167119 | 3300013307 | Bacteria | 2544 |
| 92 | Ga0157380_10075625 | 3300014326 | Bacteria | 2738 |
| 93 | Ga0157377_10010702 | 3300014745 | Bacteria | 4549 |
| 94 | Ga0157379_10005388 | 3300014968 | Bacteria | 10986 |
| 95 | Ga0157379_10008057 | 3300014968 | Bacteria | 9149 |
| 96 | Ga0157376_10029054 | 3300014969 | Bacteria | 4402 |
| 97 | Ga0163161_10020402 | 3300017792 | Bacteria | 4651 |
| 98 | Ga0213872_10000191 | 3300021361 | Bacteria | 54643 |
| 99 | Ga0213872_10000305 | 3300021361 | Bacteria | 41889 |
| 100 | Ga0213872_10002189 | 3300021361 | Bacteria | 11721 |
| 101 | Ga0213872_10002860 | 3300021361 | Bacteria | 9864 |
| 102 | Ga0213872_10004063 | 3300021361 | Bacteria | 7879 |
| 103 | Ga0213872_10013863 | 3300021361 | Bacteria | 3767 |
| 104 | Ga0209565_1000018 | 3300025263 | Bacteria | 460940 |
| 105 | Ga0209455_1000047 | 3300025272 | Bacteria | 379709 |
| 106 | Ga0209673_1000090 | 3300025273 | Bacteria | 202223 |
| 107 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 108 | Ga0209564_1000032 | 3300025295 | Bacteria | 464041 |
| 109 | Ga0209564_1000078 | 3300025295 | Bacteria | 275766 |
| 110 | Ga0209256_1000070 | 3300025299 | Bacteria | 245034 |
| 111 | Ga0207656_10042567 | 3300025321 | Bacteria | 1933 |
| 112 | Ga0207656_10070274 | 3300025321 | Bacteria | 1554 |
| 113 | Ga0207682_10095876 | 3300025893 | Bacteria | 1292 |
| 114 | Ga0207680_10042631 | 3300025903 | Bacteria | 2656 |
| 115 | Ga0207645_10031014 | 3300025907 | Bacteria | 3443 |
| 116 | Ga0207705_10677067 | 3300025909 | Unclassified | 802 |
| 117 | Ga0207660_10021246 | 3300025917 | Bacteria | 4364 |
| 118 | Ga0207657_10007926 | 3300025919 | Bacteria | 10832 |
| 119 | Ga0207657_10064285 | 3300025919 | Bacteria | 3132 |
| 120 | Ga0207649_10105704 | 3300025920 | Bacteria | 1871 |
| 121 | Ga0207649_10110943 | 3300025920 | Bacteria | 1832 |
| 122 | Ga0207652_10008328 | 3300025921 | Bacteria | 8336 |
| 123 | Ga0207681_10033865 | 3300025923 | Bacteria | 3354 |
| 124 | Ga0207694_10110387 | 3300025924 | Bacteria | 2187 |
| 125 | Ga0207694_10742832 | 3300025924 | Unclassified | 828 |
| 126 | Ga0207650_10124130 | 3300025925 | Bacteria | 2014 |
| 127 | Ga0207650_10848168 | 3300025925 | Bacteria | 775 |
| 128 | Ga0207659_10143819 | 3300025926 | Bacteria | 1854 |
| 129 | Ga0207687_10039484 | 3300025927 | Bacteria | 3232 |
| 130 | Ga0207644_10078530 | 3300025931 | Bacteria | 2433 |
| 131 | Ga0207644_10200778 | 3300025931 | Bacteria | 1573 |
| 132 | Ga0207690_10010177 | 3300025932 | Bacteria | 5585 |
| 133 | Ga0207690_10024909 | 3300025932 | Bacteria | 3751 |
| 134 | Ga0207690_10083619 | 3300025932 | Bacteria | 2235 |
| 135 | Ga0207706_10002060 | 3300025933 | Bacteria | 19704 |
| 136 | Ga0207686_10367892 | 3300025934 | Bacteria | 1087 |
| 137 | Ga0207691_10042085 | 3300025940 | Bacteria | 4213 |
| 138 | Ga0207711_10141451 | 3300025941 | Bacteria | 2165 |
| 139 | Ga0207711_10688168 | 3300025941 | Bacteria | 954 |
| 140 | Ga0207689_10000919 | 3300025942 | Bacteria | 28269 |
| 141 | Ga0207661_10671941 | 3300025944 | Bacteria | 952 |
| 142 | Ga0207679_10309511 | 3300025945 | Bacteria | 1364 |
| 143 | Ga0207668_10044827 | 3300025972 | Bacteria | 3012 |
| 144 | Ga0207658_10077813 | 3300025986 | Bacteria | 2532 |
| 145 | Ga0207658_10131839 | 3300025986 | Bacteria | 2009 |
| 146 | Ga0207658_10356883 | 3300025986 | Bacteria | 1274 |
| 147 | Ga0207677_10003852 | 3300026023 | Bacteria | 7986 |
| 148 | Ga0207703_10058830 | 3300026035 | Bacteria | 3138 |
| 149 | Ga0207639_10384160 | 3300026041 | Bacteria | 1262 |
| 150 | Ga0207678_10005670 | 3300026067 | Bacteria | 11156 |
| 151 | Ga0207702_10023989 | 3300026078 | Bacteria | 5061 |
| 152 | Ga0207702_10295007 | 3300026078 | Bacteria | 1537 |
| 153 | Ga0207641_10090017 | 3300026088 | Bacteria | 2682 |
| 154 | Ga0207641_10321936 | 3300026088 | Bacteria | 1466 |
| 155 | Ga0207674_10601922 | 3300026116 | Bacteria | 1062 |
| 156 | Ga0207675_100000956 | 3300026118 | Bacteria | 28809 |
| 157 | Ga0207683_10063700 | 3300026121 | Bacteria | 3248 |
| 158 | Ga0207698_10041309 | 3300026142 | Bacteria | 3435 |
| 159 | Ga0207698_10160476 | 3300026142 | Bacteria | 1965 |
| 160 | Ga0207698_10408422 | 3300026142 | Bacteria | 1300 |
| 161 | Ga0207698_10719110 | 3300026142 | Bacteria | 995 |
| 162 | Ga0268265_10246707 | 3300028380 | Bacteria | 1579 |
| 163 | Ga0268265_10443928 | 3300028380 | Bacteria | 1210 |
| 164 | Ga0268264_10225394 | 3300028381 | Bacteria | 1728 |
| 165 | Ga0268264_10392687 | 3300028381 | Bacteria | 1331 |
| 166 | Ga0316181_1128786 | 3300030744 | Bacteria | 1444 |
| 167 | Ga0265331_10030217 | 3300031250 | Bacteria | 2698 |
| 168 | Ga0307509_10771948 | 3300031507 | Bacteria | 626 |
| 169 | Ga0307408_100000401 | 3300031548 | Bacteria | 38921 |
| 170 | Ga0307408_100051568 | 3300031548 | Bacteria | 2964 |
| 171 | Ga0316575_10000494 | 3300031665 | Bacteria | 11406 |
| 172 | Ga0307405_10078072 | 3300031731 | Bacteria | 2153 |
| 173 | Ga0307518_10046074 | 3300031838 | Bacteria | 3171 |
| 174 | Ga0307412_10008266 | 3300031911 | Bacteria | 5932 |
| 175 | Ga0307412_10828330 | 3300031911 | Bacteria | 805 |
| 176 | Ga0307409_100001376 | 3300031995 | Bacteria | 11862 |
| 177 | Ga0307416_100006637 | 3300032002 | Bacteria | 7262 |
| 178 | Ga0307416_100006785 | 3300032002 | Bacteria | 7199 |
| 179 | Ga0307414_10937127 | 3300032004 | Unclassified | 795 |
| 180 | Ga0307411_10080392 | 3300032005 | Bacteria | 2241 |
| 181 | Ga0307415_100006664 | 3300032126 | Bacteria | 6250 |
| 182 | Ga0316583_10103699 | 3300032133 | Bacteria | 991 |
| 183 | Ga0373931_0005543 | 3300035691 | Bacteria | 5849 |
| 184 | Ga0395899_0003935 | 3300037312 | Bacteria | 11705 |
| 185 | Ga0395899_0069683 | 3300037312 | Bacteria | 2575 |
| 186 | Ga0395900_0002282 | 3300037418 | Bacteria | 21301 |
| 187 | Ga0395900_0010620 | 3300037418 | Bacteria | 9416 |
| 188 | Ga0395900_0026968 | 3300037418 | Bacteria | 5880 |
| 189 | Ga0395898_0018737 | 3300037466 | Bacteria | 7054 |
| 190 | Ga0395898_0431270 | 3300037466 | Bacteria | 1256 |
| 191 | Ga0395905_0190906 | 3300037471 | Bacteria | 1921 |
| 192 | Ga0395905_1177177 | 3300037471 | Bacteria | 670 |
| 193 | Ga0395901_0001532 | 3300038443 | Bacteria | 23959 |
| 194 | Ga0395901_0050852 | 3300038443 | Bacteria | 4306 |
| 195 | Ga0395901_0296625 | 3300038443 | Bacteria | 1676 |
| 196 | Ga0395901_0516407 | 3300038443 | Bacteria | 1214 |
| 197 | Ga0395901_1558348 | 3300038443 | Bacteria | 615 |
| 198 | Ga0436365_1337200 | 3300039437 | Bacteria | 2693 |
| 199 | Ga0436361_0091148 | 3300039447 | Bacteria | 7977 |
| 200 | Ga0436361_0128896 | 3300039447 | Bacteria | 18118 |
| 201 | Ga0436361_0636225 | 3300039447 | Bacteria | 2448 |
| 202 | Ga0436361_0788745 | 3300039447 | Bacteria | 34906 |
| 203 | Ga0436361_0891393 | 3300039447 | Bacteria | 99242 |
| 204 | Ga0436361_1028197 | 3300039447 | Bacteria | 31240 |
| 205 | Ga0436361_1200667 | 3300039447 | Bacteria | 4910 |
| 206 | Ga0436363_0607531 | 3300039450 | Bacteria | 1418 |
| 207 | Ga0466972_0000162 | 3300044658 | Bacteria | 53301 |
| 208 | Ga0466972_0009956 | 3300044658 | Bacteria | 4772 |
| 209 | Ga0453683_0045645 | 3300044673 | Bacteria | 2747 |
| 210 | Ga0466965_0002397 | 3300044683 | Bacteria | 7949 |
| 211 | Ga0466965_0021721 | 3300044683 | Bacteria | 3092 |
| 212 | Ga0466964_0013092 | 3300044706 | Bacteria | 3144 |
| 213 | Ga0453684_0579310 | 3300044712 | Bacteria | 1233 |
| 214 | Ga0466971_0024700 | 3300044719 | Bacteria | 2681 |
| 215 | Ga0466968_0058982 | 3300044735 | Bacteria | 1652 |
| 216 | Ga0466959_0003791 | 3300045049 | Bacteria | 10025 |
| 217 | Ga0466959_0133444 | 3300045049 | Bacteria | 1759 |
| 218 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 219 | Ga0451576_0187750 | 3300045051 | Bacteria | 2158 |
| 220 | Ga0451576_0333806 | 3300045051 | Bacteria | 1587 |
| 221 | Ga0451576_0575562 | 3300045051 | Bacteria | 1183 |
| 222 | Ga0451576_1087256 | 3300045051 | Bacteria | 837 |
| 223 | Ga0495590_0050380 | 3300046457 | Bacteria | 1453 |
| 224 | Ga0495638_0034055 | 3300046460 | Bacteria | 3253 |
| 225 | Ga0495650_0000109 | 3300046471 | Bacteria | 199925 |
| 226 | Ga0495639_0127878 | 3300046475 | Bacteria | 1215 |
| 227 | Ga0495584_0008480 | 3300046491 | Bacteria | 5322 |
| 228 | Ga0495607_0005674 | 3300046501 | Bacteria | 8890 |
| 229 | Ga0495607_0021955 | 3300046501 | Bacteria | 4014 |
| 230 | Ga0495583_0007348 | 3300046506 | Bacteria | 6941 |
| 231 | Ga0495606_0027762 | 3300046507 | Bacteria | 4006 |
| 232 | Ga0495610_0014427 | 3300046512 | Bacteria | 4640 |
| 233 | Ga0495616_0006790 | 3300046513 | Bacteria | 6898 |
| 234 | Ga0495643_0128656 | 3300046522 | Bacteria | 1273 |
| 235 | Ga0495643_0185783 | 3300046522 | Bacteria | 1007 |
| 236 | Ga0495648_0129931 | 3300046524 | Bacteria | 1341 |
| 237 | Ga0495642_0020946 | 3300046528 | Bacteria | 2570 |
| 238 | Ga0495654_0029741 | 3300046530 | Bacteria | 2784 |
| 239 | Ga0495609_0001092 | 3300046538 | Bacteria | 18861 |
| 240 | Ga0495622_0000036 | 3300046557 | Bacteria | 122551 |
| 241 | Ga0495633_0008945 | 3300046558 | Bacteria | 5580 |
| 242 | Ga0495633_0069562 | 3300046558 | Bacteria | 1643 |
| 243 | Ga0495668_0000046 | 3300046616 | Bacteria | 224203 |
| 244 | Ga0495668_0010183 | 3300046616 | Bacteria | 5714 |
| 245 | Ga0495668_0192779 | 3300046616 | Bacteria | 1116 |
| 246 | Ga0495611_0064613 | 3300046648 | Bacteria | 1667 |
| 247 | Ga0495625_0000656 | 3300046660 | Bacteria | 49427 |
| 248 | Ga0495659_0002715 | 3300046664 | Bacteria | 5690 |
| 249 | Ga0495661_0008856 | 3300046665 | Bacteria | 6936 |
| 250 | Ga0495669_0001882 | 3300046684 | Bacteria | 8607 |
| 251 | Ga0495670_0307263 | 3300046691 | Bacteria | 850 |
| 252 | Ga0495671_0039105 | 3300046692 | Bacteria | 2396 |
| 253 | Ga0495649_0056238 | 3300046694 | Bacteria | 2124 |
| 254 | Ga0495649_0081151 | 3300046694 | Bacteria | 1734 |
| 255 | Ga0495660_0010730 | 3300046810 | Bacteria | 5324 |
| 256 | Ga0495660_0036347 | 3300046810 | Bacteria | 2748 |
| 257 | Ga0495660_0306654 | 3300046810 | Bacteria | 718 |
| 258 | Ga0495672_0000005 | 3300047320 | Bacteria | 593294 |
| 259 | Ga0495677_0013193 | 3300047445 | Bacteria | 3006 |
| 260 | Ga0495679_043416 | 3300047446 | Bacteria | 1382 |
| 261 | Ga0495685_054392 | 3300047447 | Bacteria | 1354 |
| 262 | Ga0495681_0010642 | 3300047470 | Bacteria | 5557 |
| 263 | Ga0495686_0000352 | 3300047472 | Bacteria | 75409 |
| 264 | Ga0495686_0006245 | 3300047472 | Bacteria | 9175 |
| 265 | Ga0496100_0047000 | 3300048903 | Bacteria | 2779 |
| 266 | Ga0496100_0062635 | 3300048903 | Bacteria | 2455 |
| 267 | Ga0496101_0018972 | 3300048904 | Bacteria | 4687 |
| 268 | Ga0496101_0043989 | 3300048904 | Bacteria | 3194 |
| 269 | Ga0496102_0024951 | 3300048905 | Bacteria | 5318 |
| 270 | Ga0496102_0050677 | 3300048905 | Bacteria | 3781 |
| 271 | Ga0496105_0118485 | 3300048908 | Bacteria | 2184 |
| 272 | Ga0496105_0303246 | 3300048908 | Bacteria | 1284 |
| 273 | Ga0496106_0061816 | 3300048909 | Bacteria | 2842 |
| 274 | Ga0496107_0011483 | 3300048910 | Bacteria | 6171 |
| 275 | Ga0496108_0036447 | 3300048911 | Bacteria | 4092 |
| 276 | Ga0496108_0063814 | 3300048911 | Bacteria | 3102 |
| 277 | Ga0496109_0028476 | 3300048912 | Bacteria | 4996 |
| 278 | Ga0496109_0032154 | 3300048912 | Bacteria | 4714 |
| 279 | Ga0496109_1229687 | 3300048912 | Bacteria | 685 |
| 280 | Ga0496110_0008453 | 3300048913 | Bacteria | 8286 |
| 281 | Ga0496110_0331391 | 3300048913 | Bacteria | 1386 |
| 282 | Ga0496111_0015214 | 3300048914 | Bacteria | 5275 |
| 283 | Ga0496111_0102089 | 3300048914 | Bacteria | 2108 |
| 284 | Ga0496112_0394891 | 3300048915 | Bacteria | 1323 |
| 285 | Ga0496113_0217253 | 3300048916 | Bacteria | 1523 |
| 286 | Ga0496114_0053803 | 3300048917 | Bacteria | 3356 |
| 287 | Ga0496115_0143611 | 3300048918 | Bacteria | 1969 |
| 288 | Ga0496125_0000545 | 3300048928 | Bacteria | 64939 |
| 289 | Ga0501306_007174 | 3300049127 | Bacteria | 1327 |
| 290 | Ga0501305_018570 | 3300049161 | Bacteria | 1008 |
| 291 | Ga0495678_040595 | 3300049459 | Bacteria | 1869 |
| 292 | Ga0495682_0052615 | 3300049460 | Bacteria | 1479 |
| 293 | Ga0501319_006113 | 3300049535 | Bacteria | 881 |
| 294 | Ga0501320_007686 | 3300049536 | Bacteria | 1044 |
| 295 | Ga0501324_001603 | 3300049540 | Bacteria | 1532 |
| 296 | Ga0501324_004347 | 3300049540 | Bacteria | 1125 |
| 297 | Ga0501044_0296735 | 3300049823 | Bacteria | 1546 |
| 298 | Ga0500555_049174 | 3300053103 | Bacteria | 1156 |
| 299 | Ga0587084_000329 | 3300059477 | Bacteria | 3517 |
| 300 | Ga0587084_010947 | 3300059477 | Bacteria | 1199 |
| 301 | Ga0587084_018801 | 3300059477 | Bacteria | 1012 |
| 302 | Ga0587093_001569 | 3300059478 | Bacteria | 1966 |
| 303 | Ga0587066_006539 | 3300059490 | Bacteria | 1543 |
| 304 | Ga0587066_023714 | 3300059490 | Bacteria | 1038 |
| 305 | Ga0587070_002086 | 3300059491 | Bacteria | 2203 |
| 306 | Ga0587070_010920 | 3300059491 | Bacteria | 1347 |
| 307 | Ga0587077_000689 | 3300059493 | Bacteria | 3132 |
| 308 | Ga0587077_009628 | 3300059493 | Bacteria | 1471 |
| 309 | Ga0587080_000448 | 3300059503 | Bacteria | 3473 |
| 310 | Ga0587080_002416 | 3300059503 | Bacteria | 2194 |
| 311 | Ga0587082_002268 | 3300059504 | Bacteria | 2144 |
| 312 | Ga0587082_003223 | 3300059504 | Bacteria | 1937 |
| 313 | Ga0587083_0005830 | 3300059505 | Bacteria | 1803 |
| 314 | Ga0587085_003757 | 3300059506 | Bacteria | 1679 |
| 315 | Ga0587085_005645 | 3300059506 | Bacteria | 1483 |
| 316 | Ga0587086_000841 | 3300059507 | Bacteria | 2451 |
| 317 | Ga0587088_047944 | 3300059508 | Bacteria | 827 |
| 318 | Ga0587089_004116 | 3300059509 | Bacteria | 1589 |
| 319 | Ga0587089_007656 | 3300059509 | Bacteria | 1286 |
| 320 | Ga0587090_000218 | 3300059510 | Bacteria | 4197 |
| 321 | Ga0587090_000401 | 3300059510 | Bacteria | 3515 |
| 322 | Ga0587090_005284 | 3300059510 | Bacteria | 1612 |
| 323 | Ga0587091_000869 | 3300059511 | Bacteria | 2956 |
| 324 | Ga0587091_001743 | 3300059511 | Bacteria | 2435 |
| 325 | Ga0587091_032917 | 3300059511 | Bacteria | 983 |
| 326 | Ga0587094_001563 | 3300059513 | Bacteria | 2200 |
| 327 | Ga0587094_003367 | 3300059513 | Bacteria | 1738 |
| 328 | Ga0587095_004653 | 3300059514 | Bacteria | 1012 |
| 329 | Ga0587101_001053 | 3300059623 | Bacteria | 2245 |
| 330 | Ga0587101_011629 | 3300059623 | Bacteria | 1129 |
| 331 | Ga0587109_002035 | 3300059624 | Bacteria | 2492 |
| 332 | Ga0587115_002601 | 3300059626 | Bacteria | 1813 |
| 333 | Ga0587117_017971 | 3300059627 | Bacteria | 957 |
| 334 | Ga0587062_008764 | 3300059639 | Bacteria | 1215 |
| 335 | Ga0587067_001802 | 3300059640 | Bacteria | 2410 |
| 336 | Ga0587069_005798 | 3300059642 | Bacteria | 1455 |
| 337 | Ga0587072_001099 | 3300059643 | Bacteria | 3183 |
| 338 | Ga0587072_029900 | 3300059643 | Bacteria | 1012 |
| 339 | Ga0587075_003805 | 3300059644 | Bacteria | 1712 |
| 340 | Ga0587076_001164 | 3300059645 | Bacteria | 2594 |
| 341 | Ga0587076_001389 | 3300059645 | Bacteria | 2444 |
| 342 | Ga0587078_000835 | 3300059646 | Bacteria | 2524 |
| 343 | Ga0587079_003069 | 3300059647 | Bacteria | 2140 |
| 344 | Ga0587079_007840 | 3300059647 | Bacteria | 1610 |
| 345 | Ga0587079_018937 | 3300059647 | Bacteria | 1213 |
| 346 | Ga0587100_000742 | 3300059648 | Bacteria | 1694 |
| 347 | Ga0587107_008368 | 3300059652 | Bacteria | 1193 |
| 348 | Ga0587108_005477 | 3300059653 | Bacteria | 958 |
| 349 | Ga0587124_002894 | 3300059660 | Bacteria | 1242 |
| 350 | Ga0587124_003018 | 3300059660 | Bacteria | 1226 |
| 351 | Ga0587071_005731 | 3300060344 | Bacteria | 1912 |
| 352 | Ga0587071_044040 | 3300060344 | Bacteria | 903 |
| 353 | Ga0587111_0001374 | 3300060346 | Bacteria | 2898 |
| 354 | Ga0587111_0001481 | 3300060346 | Bacteria | 2835 |
| 355 | Ga0466962_0064042 | 3300061719 | Bacteria | 1755 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021361 | Ga0213872_10004063 | Ga0213872_100040632 | 144 |
| 2 | 3300031548 | Ga0307408_100051568 | Ga0307408_1000515682 | 144 |
| 3 | 3300031731 | Ga0307405_10078072 | Ga0307405_100780722 | 144 |
| 4 | 3300031911 | Ga0307412_10008266 | Ga0307412_100082664 | 144 |
| 5 | 3300031995 | Ga0307409_100001376 | Ga0307409_1000013766 | 144 |
| 6 | 3300032002 | Ga0307416_100006785 | Ga0307416_1000067859 | 144 |
| 7 | 3300032004 | Ga0307414_10937127 | Ga0307414_109371272 | 144 |
| 8 | 3300032005 | Ga0307411_10080392 | Ga0307411_100803921 | 144 |
| 9 | 3300032126 | Ga0307415_100006664 | Ga0307415_1000066642 | 144 |
| 10 | 3300005367 | Ga0070667_100098290 | Ga0070667_1000982904 | 145 |
| 11 | 3300005617 | Ga0068859_100144987 | Ga0068859_1001449873 | 145 |
| 12 | 3300006931 | Ga0097620_100144996 | Ga0097620_1001449963 | 145 |
| 13 | 3300025986 | Ga0207658_10077813 | Ga0207658_100778132 | 145 |
| 14 | 3300003773 | Ga0055537_1000822 | Ga0055537_100082215 | 146 |
| 15 | 3300003784 | Ga0055534_1000601 | Ga0055534_100060115 | 146 |
| 16 | 3300003790 | Ga0055528_1000050 | Ga0055528_100005075 | 146 |
| 17 | 3300005614 | Ga0068856_101388115 | Ga0068856_1013881151 | 146 |
| 18 | 3300010375 | Ga0105239_10197223 | Ga0105239_101972233 | 146 |
| 19 | 3300025263 | Ga0209565_1000018 | Ga0209565_1000018162 | 146 |
| 20 | 3300025273 | Ga0209673_1000090 | Ga0209673_100009015 | 146 |
| 21 | 3300025291 | Ga0209675_1000005 | Ga0209675_1000005162 | 146 |
| 22 | 3300025295 | Ga0209564_1000078 | Ga0209564_1000078102 | 146 |
| 23 | 3300025299 | Ga0209256_1000070 | Ga0209256_1000070123 | 146 |
| 24 | 3300038443 | Ga0395901_1558348 | Ga0395901_1558348_96_605 | 146 |
| 25 | 3300031250 | Ga0265331_10030217 | Ga0265331_100302173 | 147 |
| 26 | 3300032133 | Ga0316583_10103699 | Ga0316583_101036992 | 147 |
| 27 | 3300039447 | Ga0436361_0788745 | Ga0436361_0788745_28261_28788 | 147 |
| 28 | 3300044673 | Ga0453683_0045645 | Ga0453683_0045645_1118_1618 | 148 |
| 29 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_905209_905709 | 148 |
| 30 | 3300045051 | Ga0451576_1087256 | Ga0451576_1087256_260_760 | 148 |
| 31 | 3300053103 | Ga0500555_049174 | Ga0500555_049174_278_799 | 148 |
| 32 | iso_pu_bacteria | 2547132103 | 2547372621 | 148 |
| 33 | iso_pu_bacteria | 2843690924 | 2843691669 | 148 |
| 34 | iso_pu_bacteria | 2846033681 | 2846037043 | 148 |
| 35 | iso_pu_bacteria | 2846037992 | 2846040166 | 148 |
| 36 | iso_pu_bacteria | 2998344455 | 2998348354 | 148 |
| 37 | 3300021361 | Ga0213872_10002189 | Ga0213872_100021893 | 150 |
| 38 | 3300021361 | Ga0213872_10013863 | Ga0213872_100138634 | 150 |
| 39 | 3300039447 | Ga0436361_0128896 | Ga0436361_0128896_9771_10277 | 150 |
| 40 | 3300039447 | Ga0436361_0891393 | Ga0436361_0891393_83591_84097 | 150 |
| 41 | 3300003771 | Ga0055526_1000967 | Ga0055526_100096711 | 151 |
| 42 | 3300025925 | Ga0207650_10124130 | Ga0207650_101241302 | 151 |
| 43 | 3300044712 | Ga0453684_0579310 | Ga0453684_0579310_54_635 | 152 |
| 44 | 3300045051 | Ga0451576_0333806 | Ga0451576_0333806_193_774 | 152 |
| 45 | 3300003763 | Ga0055529_1000478 | Ga0055529_100047815 | 153 |
| 46 | 3300003771 | Ga0055526_1000709 | Ga0055526_100070913 | 153 |
| 47 | 3300005339 | Ga0070660_100033410 | Ga0070660_1000334103 | 153 |
| 48 | 3300005344 | Ga0070661_100006678 | Ga0070661_1000066789 | 153 |
| 49 | 3300005366 | Ga0070659_100016269 | Ga0070659_1000162695 | 153 |
| 50 | 3300021361 | Ga0213872_10000191 | Ga0213872_1000019131 | 153 |
| 51 | 3300025272 | Ga0209455_1000047 | Ga0209455_100004792 | 153 |
| 52 | 3300030744 | Ga0316181_1128786 | Ga0316181_11287863 | 153 |
| 53 | 3300031548 | Ga0307408_100000401 | Ga0307408_10000040126 | 153 |
| 54 | 3300031838 | Ga0307518_10046074 | Ga0307518_100460743 | 153 |
| 55 | 3300038443 | Ga0395901_0001532 | Ga0395901_0001532_629_1156 | 153 |
| 56 | 3300044658 | Ga0466972_0009956 | Ga0466972_0009956_3333_3875 | 153 |
| 57 | 3300044683 | Ga0466965_0002397 | Ga0466965_0002397_6143_6685 | 153 |
| 58 | 3300044706 | Ga0466964_0013092 | Ga0466964_0013092_210_752 | 153 |
| 59 | 3300044735 | Ga0466968_0058982 | Ga0466968_0058982_854_1396 | 153 |
| 60 | 3300046501 | Ga0495607_0021955 | Ga0495607_0021955_3052_3612 | 153 |
| 61 | 3300046558 | Ga0495633_0069562 | Ga0495633_0069562_372_911 | 153 |
| 62 | 3300048903 | Ga0496100_0047000 | Ga0496100_0047000_551_1090 | 153 |
| 63 | 3300048918 | Ga0496115_0143611 | Ga0496115_0143611_98_640 | 153 |
| 64 | 3300048928 | Ga0496125_0000545 | Ga0496125_0000545_33941_34480 | 153 |
| 65 | 3300049161 | Ga0501305_018570 | Ga0501305_018570_182_709 | 153 |
| 66 | 3300031665 | Ga0316575_10000494 | Ga0316575_1000049412 | 154 |
| 67 | 3300005614 | Ga0068856_100240220 | Ga0068856_1002402203 | 155 |
| 68 | 3300026078 | Ga0207702_10295007 | Ga0207702_102950072 | 155 |
| 69 | 3300046507 | Ga0495606_0027762 | Ga0495606_0027762_3291_3824 | 155 |
| 70 | 3300046616 | Ga0495668_0192779 | Ga0495668_0192779_169_714 | 155 |
| 71 | 3300003316 | rootH1_10078610 | rootH1_100786103 | 157 |
| 72 | 3300005327 | Ga0070658_10292657 | Ga0070658_102926572 | 157 |
| 73 | 3300005328 | Ga0070676_10297788 | Ga0070676_102977882 | 157 |
| 74 | 3300005329 | Ga0070683_100031806 | Ga0070683_1000318065 | 157 |
| 75 | 3300005329 | Ga0070683_100345248 | Ga0070683_1003452482 | 157 |
| 76 | 3300005330 | Ga0070690_100573873 | Ga0070690_1005738731 | 157 |
| 77 | 3300005334 | Ga0068869_100116268 | Ga0068869_1001162683 | 157 |
| 78 | 3300005336 | Ga0070680_100063571 | Ga0070680_1000635712 | 157 |
| 79 | 3300005338 | Ga0068868_100007250 | Ga0068868_10000725012 | 157 |
| 80 | 3300005339 | Ga0070660_100056839 | Ga0070660_1000568395 | 157 |
| 81 | 3300005339 | Ga0070660_100951534 | Ga0070660_1009515341 | 157 |
| 82 | 3300005344 | Ga0070661_100392787 | Ga0070661_1003927872 | 157 |
| 83 | 3300005345 | Ga0070692_10088785 | Ga0070692_100887852 | 157 |
| 84 | 3300005353 | Ga0070669_100030757 | Ga0070669_1000307575 | 157 |
| 85 | 3300005354 | Ga0070675_100002913 | Ga0070675_1000029132 | 157 |
| 86 | 3300005355 | Ga0070671_100026405 | Ga0070671_1000264056 | 157 |
| 87 | 3300005366 | Ga0070659_100371939 | Ga0070659_1003719392 | 157 |
| 88 | 3300005366 | Ga0070659_100590631 | Ga0070659_1005906312 | 157 |
| 89 | 3300005367 | Ga0070667_100027407 | Ga0070667_1000274075 | 157 |
| 90 | 3300005367 | Ga0070667_100145127 | Ga0070667_1001451272 | 157 |
| 91 | 3300005438 | Ga0070701_10229450 | Ga0070701_102294502 | 157 |
| 92 | 3300005441 | Ga0070700_100346310 | Ga0070700_1003463102 | 157 |
| 93 | 3300005455 | Ga0070663_100002045 | Ga0070663_10000204510 | 157 |
| 94 | 3300005455 | Ga0070663_100933565 | Ga0070663_1009335652 | 157 |
| 95 | 3300005456 | Ga0070678_100116129 | Ga0070678_1001161293 | 157 |
| 96 | 3300005457 | Ga0070662_100017564 | Ga0070662_1000175646 | 157 |
| 97 | 3300005458 | Ga0070681_10292477 | Ga0070681_102924772 | 157 |
| 98 | 3300005458 | Ga0070681_10677835 | Ga0070681_106778352 | 157 |
| 99 | 3300005530 | Ga0070679_100021313 | Ga0070679_1000213132 | 157 |
| 100 | 3300005530 | Ga0070679_100300863 | Ga0070679_1003008632 | 157 |
| 101 | 3300005539 | Ga0068853_100016917 | Ga0068853_1000169178 | 157 |
| 102 | 3300005539 | Ga0068853_100460753 | Ga0068853_1004607532 | 157 |
| 103 | 3300005543 | Ga0070672_100013676 | Ga0070672_1000136768 | 157 |
| 104 | 3300005547 | Ga0070693_100434691 | Ga0070693_1004346912 | 157 |
| 105 | 3300005577 | Ga0068857_100037458 | Ga0068857_1000374582 | 157 |
| 106 | 3300005614 | Ga0068856_100090006 | Ga0068856_1000900065 | 157 |
| 107 | 3300005614 | Ga0068856_100167235 | Ga0068856_1001672353 | 157 |
| 108 | 3300005616 | Ga0068852_100007663 | Ga0068852_1000076635 | 157 |
| 109 | 3300005616 | Ga0068852_100084612 | Ga0068852_1000846121 | 157 |
| 110 | 3300005616 | Ga0068852_100323911 | Ga0068852_1003239112 | 157 |
| 111 | 3300005616 | Ga0068852_101656106 | Ga0068852_1016561061 | 157 |
| 112 | 3300005617 | Ga0068859_100399405 | Ga0068859_1003994052 | 157 |
| 113 | 3300005618 | Ga0068864_100405350 | Ga0068864_1004053502 | 157 |
| 114 | 3300005719 | Ga0068861_100000757 | Ga0068861_10000075712 | 157 |
| 115 | 3300005834 | Ga0068851_10018213 | Ga0068851_100182134 | 157 |
| 116 | 3300005834 | Ga0068851_10081821 | Ga0068851_100818212 | 157 |
| 117 | 3300005841 | Ga0068863_100099315 | Ga0068863_1000993155 | 157 |
| 118 | 3300005841 | Ga0068863_100610029 | Ga0068863_1006100292 | 157 |
| 119 | 3300005842 | Ga0068858_100019626 | Ga0068858_10001962610 | 157 |
| 120 | 3300005843 | Ga0068860_100033406 | Ga0068860_1000334066 | 157 |
| 121 | 3300005843 | Ga0068860_100551594 | Ga0068860_1005515943 | 157 |
| 122 | 3300006358 | Ga0068871_100684300 | Ga0068871_1006843002 | 157 |
| 123 | 3300006871 | Ga0075434_100166543 | Ga0075434_1001665435 | 157 |
| 124 | 3300006881 | Ga0068865_100309763 | Ga0068865_1003097632 | 157 |
| 125 | 3300006931 | Ga0097620_100399379 | Ga0097620_1003993792 | 157 |
| 126 | 3300009098 | Ga0105245_10109932 | Ga0105245_101099324 | 157 |
| 127 | 3300009177 | Ga0105248_10081871 | Ga0105248_100818715 | 157 |
| 128 | 3300009551 | Ga0105238_10059079 | Ga0105238_100590793 | 157 |
| 129 | 3300009551 | Ga0105238_10081408 | Ga0105238_100814083 | 157 |
| 130 | 3300013100 | Ga0157373_10038721 | Ga0157373_100387215 | 157 |
| 131 | 3300013105 | Ga0157369_10065353 | Ga0157369_100653534 | 157 |
| 132 | 3300013105 | Ga0157369_10454278 | Ga0157369_104542782 | 157 |
| 133 | 3300013296 | Ga0157374_10353148 | Ga0157374_103531482 | 157 |
| 134 | 3300013306 | Ga0163162_10012542 | Ga0163162_100125429 | 157 |
| 135 | 3300013307 | Ga0157372_10016161 | Ga0157372_100161616 | 157 |
| 136 | 3300013307 | Ga0157372_10167119 | Ga0157372_101671192 | 157 |
| 137 | 3300014326 | Ga0157380_10075625 | Ga0157380_100756253 | 157 |
| 138 | 3300014745 | Ga0157377_10010702 | Ga0157377_100107023 | 157 |
| 139 | 3300014968 | Ga0157379_10005388 | Ga0157379_100053888 | 157 |
| 140 | 3300014968 | Ga0157379_10008057 | Ga0157379_1000805710 | 157 |
| 141 | 3300014969 | Ga0157376_10029054 | Ga0157376_100290547 | 157 |
| 142 | 3300017792 | Ga0163161_10020402 | Ga0163161_100204025 | 157 |
| 143 | 3300025321 | Ga0207656_10042567 | Ga0207656_100425672 | 157 |
| 144 | 3300025321 | Ga0207656_10070274 | Ga0207656_100702742 | 157 |
| 145 | 3300025893 | Ga0207682_10095876 | Ga0207682_100958762 | 157 |
| 146 | 3300025903 | Ga0207680_10042631 | Ga0207680_100426314 | 157 |
| 147 | 3300025907 | Ga0207645_10031014 | Ga0207645_100310142 | 157 |
| 148 | 3300025909 | Ga0207705_10677067 | Ga0207705_106770672 | 157 |
| 149 | 3300025917 | Ga0207660_10021246 | Ga0207660_100212462 | 157 |
| 150 | 3300025919 | Ga0207657_10064285 | Ga0207657_100642856 | 157 |
| 151 | 3300025920 | Ga0207649_10105704 | Ga0207649_101057044 | 157 |
| 152 | 3300025921 | Ga0207652_10008328 | Ga0207652_100083282 | 157 |
| 153 | 3300025923 | Ga0207681_10033865 | Ga0207681_100338655 | 157 |
| 154 | 3300025924 | Ga0207694_10110387 | Ga0207694_101103872 | 157 |
| 155 | 3300025924 | Ga0207694_10742832 | Ga0207694_107428322 | 157 |
| 156 | 3300025926 | Ga0207659_10143819 | Ga0207659_101438192 | 157 |
| 157 | 3300025927 | Ga0207687_10039484 | Ga0207687_100394843 | 157 |
| 158 | 3300025931 | Ga0207644_10078530 | Ga0207644_100785303 | 157 |
| 159 | 3300025931 | Ga0207644_10200778 | Ga0207644_102007782 | 157 |
| 160 | 3300025932 | Ga0207690_10024909 | Ga0207690_100249096 | 157 |
| 161 | 3300025932 | Ga0207690_10083619 | Ga0207690_100836193 | 157 |
| 162 | 3300025933 | Ga0207706_10002060 | Ga0207706_1000206017 | 157 |
| 163 | 3300025940 | Ga0207691_10042085 | Ga0207691_100420856 | 157 |
| 164 | 3300025941 | Ga0207711_10141451 | Ga0207711_101414512 | 157 |
| 165 | 3300025941 | Ga0207711_10688168 | Ga0207711_106881682 | 157 |
| 166 | 3300025942 | Ga0207689_10000919 | Ga0207689_100009199 | 157 |
| 167 | 3300025944 | Ga0207661_10671941 | Ga0207661_106719412 | 157 |
| 168 | 3300025945 | Ga0207679_10309511 | Ga0207679_103095112 | 157 |
| 169 | 3300025972 | Ga0207668_10044827 | Ga0207668_100448275 | 157 |
| 170 | 3300025986 | Ga0207658_10131839 | Ga0207658_101318393 | 157 |
| 171 | 3300025986 | Ga0207658_10356883 | Ga0207658_103568832 | 157 |
| 172 | 3300026023 | Ga0207677_10003852 | Ga0207677_1000385212 | 157 |
| 173 | 3300026035 | Ga0207703_10058830 | Ga0207703_100588302 | 157 |
| 174 | 3300026041 | Ga0207639_10384160 | Ga0207639_103841602 | 157 |
| 175 | 3300026067 | Ga0207678_10005670 | Ga0207678_1000567011 | 157 |
| 176 | 3300026078 | Ga0207702_10023989 | Ga0207702_100239895 | 157 |
| 177 | 3300026088 | Ga0207641_10090017 | Ga0207641_100900175 | 157 |
| 178 | 3300026088 | Ga0207641_10321936 | Ga0207641_103219362 | 157 |
| 179 | 3300026116 | Ga0207674_10601922 | Ga0207674_106019222 | 157 |
| 180 | 3300026118 | Ga0207675_100000956 | Ga0207675_10000095622 | 157 |
| 181 | 3300026121 | Ga0207683_10063700 | Ga0207683_100637002 | 157 |
| 182 | 3300026142 | Ga0207698_10041309 | Ga0207698_100413093 | 157 |
| 183 | 3300026142 | Ga0207698_10160476 | Ga0207698_101604764 | 157 |
| 184 | 3300026142 | Ga0207698_10408422 | Ga0207698_104084221 | 157 |
| 185 | 3300026142 | Ga0207698_10719110 | Ga0207698_107191102 | 157 |
| 186 | 3300028380 | Ga0268265_10246707 | Ga0268265_102467073 | 157 |
| 187 | 3300028381 | Ga0268264_10225394 | Ga0268264_102253943 | 157 |
| 188 | 3300028381 | Ga0268264_10392687 | Ga0268264_103926873 | 157 |
| 189 | 3300035691 | Ga0373931_0005543 | Ga0373931_0005543_5058_5621 | 157 |
| 190 | 3300037466 | Ga0395898_0431270 | Ga0395898_0431270_597_1148 | 157 |
| 191 | 3300037471 | Ga0395905_0190906 | Ga0395905_0190906_727_1278 | 157 |
| 192 | 3300039437 | Ga0436365_1337200 | Ga0436365_1337200_2048_2611 | 157 |
| 193 | 3300039450 | Ga0436363_0607531 | Ga0436363_0607531_167_730 | 157 |
| 194 | 3300045051 | Ga0451576_0187750 | Ga0451576_0187750_1478_2041 | 157 |
| 195 | 3300045051 | Ga0451576_0575562 | Ga0451576_0575562_251_814 | 157 |
| 196 | 3300046522 | Ga0495643_0128656 | Ga0495643_0128656_649_1251 | 157 |
| 197 | 3300046694 | Ga0495649_0081151 | Ga0495649_0081151_908_1531 | 157 |
| 198 | 3300048903 | Ga0496100_0062635 | Ga0496100_0062635_1880_2443 | 157 |
| 199 | 3300048904 | Ga0496101_0043989 | Ga0496101_0043989_1969_2532 | 157 |
| 200 | 3300048905 | Ga0496102_0050677 | Ga0496102_0050677_2761_3324 | 157 |
| 201 | 3300048908 | Ga0496105_0303246 | Ga0496105_0303246_31_594 | 157 |
| 202 | 3300048909 | Ga0496106_0061816 | Ga0496106_0061816_581_1144 | 157 |
| 203 | 3300048910 | Ga0496107_0011483 | Ga0496107_0011483_771_1334 | 157 |
| 204 | 3300048911 | Ga0496108_0036447 | Ga0496108_0036447_838_1401 | 157 |
| 205 | 3300048912 | Ga0496109_0028476 | Ga0496109_0028476_192_755 | 157 |
| 206 | 3300048912 | Ga0496109_1229687 | Ga0496109_1229687_60_623 | 157 |
| 207 | 3300048913 | Ga0496110_0331391 | Ga0496110_0331391_448_1011 | 157 |
| 208 | 3300048914 | Ga0496111_0015214 | Ga0496111_0015214_2023_2586 | 157 |
| 209 | 3300048915 | Ga0496112_0394891 | Ga0496112_0394891_689_1252 | 157 |
| 210 | 3300048916 | Ga0496113_0217253 | Ga0496113_0217253_422_985 | 157 |
| 211 | 3300003775 | Ga0055524_1003597 | Ga0055524_10035978 | 158 |
| 212 | 3300005564 | Ga0070664_100005621 | Ga0070664_1000056215 | 158 |
| 213 | 3300006058 | Ga0075432_10039542 | Ga0075432_100395422 | 158 |
| 214 | 3300009176 | Ga0105242_10181008 | Ga0105242_101810083 | 158 |
| 215 | 3300009177 | Ga0105248_10404876 | Ga0105248_104048763 | 158 |
| 216 | 3300021361 | Ga0213872_10000305 | Ga0213872_100003051 | 158 |
| 217 | 3300021361 | Ga0213872_10002860 | Ga0213872_100028605 | 158 |
| 218 | 3300025295 | Ga0209564_1000032 | Ga0209564_100003231 | 158 |
| 219 | 3300025919 | Ga0207657_10007926 | Ga0207657_1000792610 | 158 |
| 220 | 3300025920 | Ga0207649_10110943 | Ga0207649_101109432 | 158 |
| 221 | 3300025932 | Ga0207690_10010177 | Ga0207690_100101775 | 158 |
| 222 | 3300025934 | Ga0207686_10367892 | Ga0207686_103678922 | 158 |
| 223 | 3300028380 | Ga0268265_10443928 | Ga0268265_104439282 | 158 |
| 224 | 3300031507 | Ga0307509_10771948 | Ga0307509_107719481 | 158 |
| 225 | 3300031911 | Ga0307412_10828330 | Ga0307412_108283302 | 158 |
| 226 | 3300032002 | Ga0307416_100006637 | Ga0307416_1000066374 | 158 |
| 227 | 3300037312 | Ga0395899_0003935 | Ga0395899_0003935_7589_8140 | 158 |
| 228 | 3300037312 | Ga0395899_0069683 | Ga0395899_0069683_1011_1562 | 158 |
| 229 | 3300037418 | Ga0395900_0002282 | Ga0395900_0002282_17448_17999 | 158 |
| 230 | 3300037418 | Ga0395900_0010620 | Ga0395900_0010620_6398_6949 | 158 |
| 231 | 3300037418 | Ga0395900_0026968 | Ga0395900_0026968_4671_5222 | 158 |
| 232 | 3300037466 | Ga0395898_0018737 | Ga0395898_0018737_2794_3345 | 158 |
| 233 | 3300037471 | Ga0395905_1177177 | Ga0395905_1177177_48_599 | 158 |
| 234 | 3300038443 | Ga0395901_0050852 | Ga0395901_0050852_1648_2199 | 158 |
| 235 | 3300038443 | Ga0395901_0296625 | Ga0395901_0296625_128_679 | 158 |
| 236 | 3300038443 | Ga0395901_0516407 | Ga0395901_0516407_520_1071 | 158 |
| 237 | 3300039447 | Ga0436361_0091148 | Ga0436361_0091148_4255_4806 | 158 |
| 238 | 3300039447 | Ga0436361_0636225 | Ga0436361_0636225_1570_2127 | 158 |
| 239 | 3300039447 | Ga0436361_1028197 | Ga0436361_1028197_19787_20338 | 158 |
| 240 | 3300039447 | Ga0436361_1200667 | Ga0436361_1200667_2274_2888 | 158 |
| 241 | 3300044658 | Ga0466972_0000162 | Ga0466972_0000162_17974_18534 | 158 |
| 242 | 3300044683 | Ga0466965_0021721 | Ga0466965_0021721_2083_2634 | 158 |
| 243 | 3300044719 | Ga0466971_0024700 | Ga0466971_0024700_1756_2307 | 158 |
| 244 | 3300045049 | Ga0466959_0003791 | Ga0466959_0003791_2923_3474 | 158 |
| 245 | 3300045049 | Ga0466959_0133444 | Ga0466959_0133444_60_611 | 158 |
| 246 | 3300046457 | Ga0495590_0050380 | Ga0495590_0050380_651_1196 | 158 |
| 247 | 3300046460 | Ga0495638_0034055 | Ga0495638_0034055_2389_2934 | 158 |
| 248 | 3300046471 | Ga0495650_0000109 | Ga0495650_0000109_80297_80866 | 158 |
| 249 | 3300046491 | Ga0495584_0008480 | Ga0495584_0008480_4256_4801 | 158 |
| 250 | 3300046501 | Ga0495607_0005674 | Ga0495607_0005674_6949_7494 | 158 |
| 251 | 3300046506 | Ga0495583_0007348 | Ga0495583_0007348_4540_5085 | 158 |
| 252 | 3300046512 | Ga0495610_0014427 | Ga0495610_0014427_3188_3760 | 158 |
| 253 | 3300046513 | Ga0495616_0006790 | Ga0495616_0006790_3373_3918 | 158 |
| 254 | 3300046522 | Ga0495643_0185783 | Ga0495643_0185783_285_830 | 158 |
| 255 | 3300046524 | Ga0495648_0129931 | Ga0495648_0129931_81_626 | 158 |
| 256 | 3300046528 | Ga0495642_0020946 | Ga0495642_0020946_840_1385 | 158 |
| 257 | 3300046530 | Ga0495654_0029741 | Ga0495654_0029741_1702_2259 | 158 |
| 258 | 3300046538 | Ga0495609_0001092 | Ga0495609_0001092_14959_15504 | 158 |
| 259 | 3300046557 | Ga0495622_0000036 | Ga0495622_0000036_111765_112334 | 158 |
| 260 | 3300046558 | Ga0495633_0008945 | Ga0495633_0008945_3244_3801 | 158 |
| 261 | 3300046616 | Ga0495668_0000046 | Ga0495668_0000046_114517_115062 | 158 |
| 262 | 3300046616 | Ga0495668_0010183 | Ga0495668_0010183_1724_2269 | 158 |
| 263 | 3300046648 | Ga0495611_0064613 | Ga0495611_0064613_59_604 | 158 |
| 264 | 3300046660 | Ga0495625_0000656 | Ga0495625_0000656_23215_23760 | 158 |
| 265 | 3300046664 | Ga0495659_0002715 | Ga0495659_0002715_2870_3415 | 158 |
| 266 | 3300046665 | Ga0495661_0008856 | Ga0495661_0008856_4556_5101 | 158 |
| 267 | 3300046684 | Ga0495669_0001882 | Ga0495669_0001882_646_1191 | 158 |
| 268 | 3300046691 | Ga0495670_0307263 | Ga0495670_0307263_138_683 | 158 |
| 269 | 3300046692 | Ga0495671_0039105 | Ga0495671_0039105_1235_1780 | 158 |
| 270 | 3300046694 | Ga0495649_0056238 | Ga0495649_0056238_1355_1900 | 158 |
| 271 | 3300046810 | Ga0495660_0010730 | Ga0495660_0010730_3546_4091 | 158 |
| 272 | 3300046810 | Ga0495660_0036347 | Ga0495660_0036347_1909_2463 | 158 |
| 273 | 3300046810 | Ga0495660_0306654 | Ga0495660_0306654_11_556 | 158 |
| 274 | 3300047320 | Ga0495672_0000005 | Ga0495672_0000005_115726_116289 | 158 |
| 275 | 3300047445 | Ga0495677_0013193 | Ga0495677_0013193_2035_2580 | 158 |
| 276 | 3300047446 | Ga0495679_043416 | Ga0495679_043416_312_857 | 158 |
| 277 | 3300047447 | Ga0495685_054392 | Ga0495685_054392_604_1149 | 158 |
| 278 | 3300047470 | Ga0495681_0010642 | Ga0495681_0010642_1795_2340 | 158 |
| 279 | 3300047472 | Ga0495686_0000352 | Ga0495686_0000352_39137_39703 | 158 |
| 280 | 3300047472 | Ga0495686_0006245 | Ga0495686_0006245_2583_3128 | 158 |
| 281 | 3300049127 | Ga0501306_007174 | Ga0501306_007174_469_1047 | 158 |
| 282 | 3300049459 | Ga0495678_040595 | Ga0495678_040595_517_1062 | 158 |
| 283 | 3300049460 | Ga0495682_0052615 | Ga0495682_0052615_203_760 | 158 |
| 284 | 3300049535 | Ga0501319_006113 | Ga0501319_006113_95_640 | 158 |
| 285 | 3300049536 | Ga0501320_007686 | Ga0501320_007686_284_829 | 158 |
| 286 | 3300049540 | Ga0501324_001603 | Ga0501324_001603_648_1199 | 158 |
| 287 | 3300049540 | Ga0501324_004347 | Ga0501324_004347_332_901 | 158 |
| 288 | 3300049823 | Ga0501044_0296735 | Ga0501044_0296735_405_956 | 158 |
| 289 | 3300059477 | Ga0587084_000329 | Ga0587084_000329_1685_2230 | 158 |
| 290 | 3300059477 | Ga0587084_010947 | Ga0587084_010947_280_831 | 158 |
| 291 | 3300059477 | Ga0587084_018801 | Ga0587084_018801_286_831 | 158 |
| 292 | 3300059478 | Ga0587093_001569 | Ga0587093_001569_1219_1770 | 158 |
| 293 | 3300059490 | Ga0587066_006539 | Ga0587066_006539_814_1365 | 158 |
| 294 | 3300059490 | Ga0587066_023714 | Ga0587066_023714_192_743 | 158 |
| 295 | 3300059491 | Ga0587070_002086 | Ga0587070_002086_815_1366 | 158 |
| 296 | 3300059491 | Ga0587070_010920 | Ga0587070_010920_263_808 | 158 |
| 297 | 3300059493 | Ga0587077_000689 | Ga0587077_000689_1795_2346 | 158 |
| 298 | 3300059493 | Ga0587077_009628 | Ga0587077_009628_568_1119 | 158 |
| 299 | 3300059503 | Ga0587080_000448 | Ga0587080_000448_1224_1775 | 158 |
| 300 | 3300059503 | Ga0587080_002416 | Ga0587080_002416_388_939 | 158 |
| 301 | 3300059504 | Ga0587082_002268 | Ga0587082_002268_388_939 | 158 |
| 302 | 3300059504 | Ga0587082_003223 | Ga0587082_003223_262_813 | 158 |
| 303 | 3300059505 | Ga0587083_0005830 | Ga0587083_0005830_1125_1676 | 158 |
| 304 | 3300059506 | Ga0587085_003757 | Ga0587085_003757_305_856 | 158 |
| 305 | 3300059506 | Ga0587085_005645 | Ga0587085_005645_119_670 | 158 |
| 306 | 3300059507 | Ga0587086_000841 | Ga0587086_000841_222_767 | 158 |
| 307 | 3300059508 | Ga0587088_047944 | Ga0587088_047944_125_670 | 158 |
| 308 | 3300059509 | Ga0587089_004116 | Ga0587089_004116_708_1259 | 158 |
| 309 | 3300059509 | Ga0587089_007656 | Ga0587089_007656_532_1083 | 158 |
| 310 | 3300059510 | Ga0587090_000218 | Ga0587090_000218_483_1034 | 158 |
| 311 | 3300059510 | Ga0587090_000401 | Ga0587090_000401_1289_1834 | 158 |
| 312 | 3300059510 | Ga0587090_005284 | Ga0587090_005284_825_1376 | 158 |
| 313 | 3300059511 | Ga0587091_000869 | Ga0587091_000869_1704_2255 | 158 |
| 314 | 3300059511 | Ga0587091_001743 | Ga0587091_001743_1685_2230 | 158 |
| 315 | 3300059511 | Ga0587091_032917 | Ga0587091_032917_366_917 | 158 |
| 316 | 3300059513 | Ga0587094_001563 | Ga0587094_001563_809_1360 | 158 |
| 317 | 3300059513 | Ga0587094_003367 | Ga0587094_003367_828_1379 | 158 |
| 318 | 3300059514 | Ga0587095_004653 | Ga0587095_004653_185_736 | 158 |
| 319 | 3300059623 | Ga0587101_001053 | Ga0587101_001053_1042_1593 | 158 |
| 320 | 3300059623 | Ga0587101_011629 | Ga0587101_011629_187_732 | 158 |
| 321 | 3300059624 | Ga0587109_002035 | Ga0587109_002035_1664_2215 | 158 |
| 322 | 3300059626 | Ga0587115_002601 | Ga0587115_002601_412_963 | 158 |
| 323 | 3300059627 | Ga0587117_017971 | Ga0587117_017971_280_831 | 158 |
| 324 | 3300059639 | Ga0587062_008764 | Ga0587062_008764_483_1034 | 158 |
| 325 | 3300059640 | Ga0587067_001802 | Ga0587067_001802_1685_2230 | 158 |
| 326 | 3300059642 | Ga0587069_005798 | Ga0587069_005798_203_754 | 158 |
| 327 | 3300059643 | Ga0587072_001099 | Ga0587072_001099_957_1502 | 158 |
| 328 | 3300059643 | Ga0587072_029900 | Ga0587072_029900_286_831 | 158 |
| 329 | 3300059644 | Ga0587075_003805 | Ga0587075_003805_519_1070 | 158 |
| 330 | 3300059645 | Ga0587076_001164 | Ga0587076_001164_684_1235 | 158 |
| 331 | 3300059645 | Ga0587076_001389 | Ga0587076_001389_1694_2239 | 158 |
| 332 | 3300059646 | Ga0587078_000835 | Ga0587078_000835_1455_2006 | 158 |
| 333 | 3300059647 | Ga0587079_003069 | Ga0587079_003069_1321_1872 | 158 |
| 334 | 3300059647 | Ga0587079_007840 | Ga0587079_007840_244_795 | 158 |
| 335 | 3300059647 | Ga0587079_018937 | Ga0587079_018937_479_1030 | 158 |
| 336 | 3300059648 | Ga0587100_000742 | Ga0587100_000742_888_1439 | 158 |
| 337 | 3300059652 | Ga0587107_008368 | Ga0587107_008368_179_730 | 158 |
| 338 | 3300059653 | Ga0587108_005477 | Ga0587108_005477_159_710 | 158 |
| 339 | 3300059660 | Ga0587124_002894 | Ga0587124_002894_516_1061 | 158 |
| 340 | 3300059660 | Ga0587124_003018 | Ga0587124_003018_188_733 | 158 |
| 341 | 3300060344 | Ga0587071_005731 | Ga0587071_005731_1085_1636 | 158 |
| 342 | 3300060344 | Ga0587071_044040 | Ga0587071_044040_182_727 | 158 |
| 343 | 3300060346 | Ga0587111_0001374 | Ga0587111_0001374_1997_2548 | 158 |
| 344 | 3300060346 | Ga0587111_0001481 | Ga0587111_0001481_604_1149 | 158 |
| 345 | 3300061719 | Ga0466962_0064042 | Ga0466962_0064042_242_793 | 158 |
| 346 | 3300003305 | Ga0006770J48903_1044971 | Ga0006770J48903_10449712 | 159 |
| 347 | 3300003544 | Ga0007417J51691_1034645 | Ga0007417J51691_10346452 | 159 |
| 348 | 3300003574 | Ga0007410J51695_1045320 | Ga0007410J51695_10453202 | 159 |
| 349 | 3300003579 | Ga0007429J51699_1036152 | Ga0007429J51699_10361522 | 159 |
| 350 | 3300003693 | Ga0032354_1044129 | Ga0032354_10441292 | 159 |
| 351 | 3300025925 | Ga0207650_10848168 | Ga0207650_108481681 | 159 |
| 352 | 3300046475 | Ga0495639_0127878 | Ga0495639_0127878_11_556 | 159 |
| 353 | 3300048904 | Ga0496101_0018972 | Ga0496101_0018972_1682_2227 | 159 |
| 354 | 3300048905 | Ga0496102_0024951 | Ga0496102_0024951_3568_4113 | 159 |
| 355 | 3300048908 | Ga0496105_0118485 | Ga0496105_0118485_707_1252 | 159 |
| 356 | 3300048911 | Ga0496108_0063814 | Ga0496108_0063814_1978_2523 | 159 |
| 357 | 3300048912 | Ga0496109_0032154 | Ga0496109_0032154_2653_3198 | 159 |
| 358 | 3300048913 | Ga0496110_0008453 | Ga0496110_0008453_1518_2063 | 159 |
| 359 | 3300048914 | Ga0496111_0102089 | Ga0496111_0102089_142_687 | 159 |
| 360 | 3300048917 | Ga0496114_0053803 | Ga0496114_0053803_1886_2431 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dog-assembly1.cif.gz_A | solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 | 0.8726 | 12 | 100 |
| 2dog-assembly1.cif.gz_A | solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 | 0.8449 | 12 | 100 |
| 3a1p-assembly2.cif.gz_C | structure of ribosome maturation protein rimm and ribosomal protein s19 | 0.8083 | 12 | 142 |
| 7cq1-assembly1.cif.gz_A | solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm | 0.7122 | 102 | 153 |
| 3a1p-assembly2.cif.gz_C | structure of ribosome maturation protein rimm and ribosomal protein s19 | 0.6507 | 12 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3a1pC01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM | 0.9183 | 12 | 99 | 2.40.30.60 |
| 3a1pC01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM | 0.8977 | 12 | 99 | 2.40.30.60 |
| af_I1KSK3_79_172_2.40.30.60 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM | 0.871 | 13 | 97 | 2.40.30.60 |
| 2f1lA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM | 0.8626 | 11 | 98 | 2.40.30.60 |
| af_Q2FZ44_1_87_2.40.30.60 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM | 0.8616 | 12 | 95 | 2.40.30.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A177QY58-F1-model_v4 | Ribosome maturation factor RimM | 0.8957 | 13 | 141 |
GO:0005737
GO:0005840 GO:0006364 GO:0042274 GO:0043022 |
| AF-A0A117KNZ0-F1-model_v4 | Ribosome maturation factor RimM | 0.8862 | 8 | 142 |
GO:0005737
GO:0005840 GO:0006364 GO:0042274 GO:0043022 |
| AF-A0A3D3PNT2-F1-model_v4 | Ribosome maturation factor RimM | 0.8854 | 3 | 141 |
GO:0005737
GO:0005840 GO:0006364 GO:0043022 |
| AF-A0A3N5SMV8-F1-model_v4 | deleted | 0.8713 | 6 | 120 |
|
| AF-A0A3N5SMV8-F1-model_v4 | deleted | 0.8573 | 6 | 120 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar