F421957

General Info

Members Datasets Scaffolds Average Seq Length
360 195 720 278

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0022203|Ga0466971_0022203_1904_2809
Length 301
Sequence MERATGKGRSTEMIRLLIAPLIAIVMPALTTAAAAQTPTATNYSVDEPMPRPAQAQLVWSDEFDNDALDTSKWGYDGSRNKSGWYNGELQYYGARPENVRVANGQLIIEARRETLNPRQFPDYGGQAYTSGKVWTKGKASWTYGYYEIRAKLPCARGTWPAIWMMPEGQYAWPDGGEIDIMEQVGSQPEVVHGTLHTALFVHTKGTQRGAELRVPGNCDAFHNYQLEWTPSTIRMGVDGRAYMKVRNDQPGGAGAWPFDHPFYLILNLAMGGNWAAAKGMDDAALPQRMLVDYVRVYRLPR

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
192 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
193 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.28
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0
Rhizoplane 3.33
Rhizosphere 90.28
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0022203 3300044719 Bacteria 2826
2 JGI24736J21556_1006457 3300001904 Bacteria 1972
3 JGI24741J21665_1008805 3300001915 Bacteria 1886
4 JGI24739J22299_10001557 3300001989 Bacteria 8685
5 JGI24739J22299_10011740 3300001989 Bacteria 3228
6 JGI24739J22299_10032100 3300001989 Bacteria 1809
7 JGI24739J22299_10042542 3300001989 Bacteria 1506
8 JGI24737J22298_10000812 3300001990 Bacteria 11083
9 JGI24737J22298_10003958 3300001990 Bacteria 5188
10 JGI24737J22298_10022481 3300001990 Bacteria 2005
11 JGI24735J21928_10005135 3300002067 Bacteria 4357
12 JGI24735J21928_10006366 3300002067 Bacteria 3893
13 JGI24738J21930_10001632 3300002075 Bacteria 6159
14 JGI24738J21930_10005750 3300002075 Bacteria 2949
15 JGI25157J39369_1012284 3300002741 Bacteria 1092
16 JGI25165J46597_1000127 3300003214 Bacteria 130786
17 rootL2_10159722 3300003322 Bacteria 1608
18 rootL2_10160224 3300003322 Bacteria 2549
19 Ga0065712_10068302 3300005290 Bacteria 12026
20 Ga0070658_10001074 3300005327 Bacteria 23325
21 Ga0070658_10017297 3300005327 Bacteria 5770
22 Ga0070658_10022723 3300005327 Bacteria 5033
23 Ga0070658_10039891 3300005327 Bacteria 3788
24 Ga0070658_10051555 3300005327 Bacteria 3335
25 Ga0070676_10005631 3300005328 Bacteria 6672
26 Ga0070676_10201718 3300005328 Bacteria 1304
27 Ga0070683_100001697 3300005329 Bacteria 17120
28 Ga0070670_100000383 3300005331 Bacteria 36691
29 Ga0070670_100049443 3300005331 Bacteria 3615
30 Ga0068869_100047914 3300005334 Bacteria 3088
31 Ga0070666_10025028 3300005335 Bacteria 3890
32 Ga0068868_100000053 3300005338 Bacteria 65580
33 Ga0070660_100020267 3300005339 Bacteria 4884
34 Ga0070660_100185165 3300005339 Bacteria 1686
35 Ga0070660_100568783 3300005339 Bacteria 946
36 Ga0070661_100012106 3300005344 Bacteria 6031
37 Ga0070669_100086446 3300005353 Bacteria 2343
38 Ga0070675_100001468 3300005354 Bacteria 17388
39 Ga0070675_100006810 3300005354 Bacteria 8776
40 Ga0070671_100002180 3300005355 Bacteria 15116
41 Ga0070671_100016138 3300005355 Bacteria 6039
42 Ga0070671_100224576 3300005355 Bacteria 1593
43 Ga0070674_100097007 3300005356 Bacteria 2140
44 Ga0070673_100000010 3300005364 Bacteria 153851
45 Ga0070673_100002525 3300005364 Bacteria 11179
46 Ga0070659_100018461 3300005366 Bacteria 5264
47 Ga0070659_100027383 3300005366 Bacteria 4392
48 Ga0070659_100070280 3300005366 Bacteria 2781
49 Ga0070659_100302202 3300005366 Bacteria 1335
50 Ga0070667_100002028 3300005367 Bacteria 17933
51 Ga0070667_100010184 3300005367 Bacteria 7769
52 Ga0070667_100362780 3300005367 Bacteria 1313
53 Ga0070714_100065065 3300005435 Bacteria 3140
54 Ga0070713_100019468 3300005436 Bacteria 5184
55 Ga0070701_10212881 3300005438 Bacteria 1148
56 Ga0070663_100060402 3300005455 Bacteria 2726
57 Ga0070678_100021427 3300005456 Bacteria 4262
58 Ga0070678_100029138 3300005456 Bacteria 3777
59 Ga0070662_100001060 3300005457 Bacteria 16794
60 Ga0070662_100093922 3300005457 Bacteria 2258
61 Ga0070662_100189676 3300005457 Bacteria 1625
62 Ga0070662_100193135 3300005457 Bacteria 1611
63 Ga0068867_100000007 3300005459 Bacteria 148726
64 Ga0070684_100001906 3300005535 Bacteria 15288
65 Ga0068853_100005194 3300005539 Bacteria 10182
66 Ga0068853_100056600 3300005539 Bacteria 3382
67 Ga0070672_100001310 3300005543 Bacteria 15350
68 Ga0070672_100013451 3300005543 Bacteria 5782
69 Ga0070686_100001142 3300005544 Bacteria 15252
70 Ga0070665_100000103 3300005548 Bacteria 158183
71 Ga0070665_100000154 3300005548 Bacteria 125835
72 Ga0070665_100061956 3300005548 Bacteria 3751
73 Ga0068855_100000239 3300005563 Bacteria 69455
74 Ga0068855_100222017 3300005563 Bacteria 2118
75 Ga0070664_100002173 3300005564 Bacteria 15748
76 Ga0070664_100102645 3300005564 Bacteria 2488
77 Ga0070664_100220630 3300005564 Bacteria 1696
78 Ga0070664_100228394 3300005564 Bacteria 1668
79 Ga0068857_100004651 3300005577 Bacteria 11630
80 Ga0068857_100094544 3300005577 Bacteria 2677
81 Ga0068854_100003087 3300005578 Bacteria 10371
82 Ga0068856_100043480 3300005614 Bacteria 4420
83 Ga0068856_100174884 3300005614 Bacteria 2159
84 Ga0068852_100000965 3300005616 Bacteria 18878
85 Ga0068852_100010740 3300005616 Bacteria 6858
86 Ga0068852_100304231 3300005616 Bacteria 1544
87 Ga0068864_100016452 3300005618 Bacteria 6156
88 Ga0068851_10068543 3300005834 Bacteria 1831
89 Ga0068851_10086570 3300005834 Bacteria 1644
90 Ga0068863_100013642 3300005841 Bacteria 7839
91 Ga0068863_100124683 3300005841 Bacteria 2457
92 Ga0068863_100348269 3300005841 Bacteria 1442
93 Ga0068858_100698376 3300005842 Bacteria 987
94 Ga0070717_10084807 3300006028 Bacteria 2665
95 Ga0075366_10105371 3300006195 Bacteria 1695
96 Ga0097621_100061222 3300006237 Bacteria 3087
97 Ga0068865_100000010 3300006881 Bacteria 159548
98 Ga0075435_100111939 3300007076 Bacteria 2271
99 Ga0105240_10127094 3300009093 Bacteria 3062
100 Ga0105240_10210685 3300009093 Bacteria 2271
101 Ga0105245_10000174 3300009098 Bacteria 61234
102 Ga0105245_10257112 3300009098 Bacteria 1698
103 Ga0105245_10730102 3300009098 Bacteria 1025
104 Ga0105243_10000054 3300009148 Bacteria 136517
105 Ga0105242_10000821 3300009176 Bacteria 24146
106 Ga0105248_10002052 3300009177 Bacteria 22304
107 Ga0105248_10006388 3300009177 Bacteria 12936
108 Ga0105248_10027330 3300009177 Bacteria 6350
109 Ga0105248_10037498 3300009177 Bacteria 5423
110 Ga0105237_10053547 3300009545 Bacteria 4047
111 Ga0105238_10017970 3300009551 Bacteria 7188
112 Ga0105249_10009100 3300009553 Bacteria 8686
113 Ga0105239_10020550 3300010375 Bacteria 7284
114 Ga0105246_10001706 3300011119 Bacteria 13114
115 Ga0105246_10058619 3300011119 Bacteria 2668
116 Ga0105246_10088122 3300011119 Bacteria 2229
117 Ga0157373_10050485 3300013100 Bacteria 2962
118 Ga0157371_10001856 3300013102 Bacteria 21208
119 Ga0157370_10000749 3300013104 Bacteria 40556
120 Ga0157370_10033937 3300013104 Bacteria 4972
121 Ga0157369_10005102 3300013105 Bacteria 15368
122 Ga0157369_10073551 3300013105 Bacteria 3667
123 Ga0157369_10530232 3300013105 Bacteria 1218
124 Ga0157374_10000468 3300013296 Bacteria 36718
125 Ga0157374_10016508 3300013296 Bacteria 6493
126 Ga0157378_10000494 3300013297 Bacteria 37394
127 Ga0163162_10070308 3300013306 Bacteria 3552
128 Ga0163162_10126782 3300013306 Bacteria 2659
129 Ga0157372_10214930 3300013307 Bacteria 2228
130 Ga0157372_10632360 3300013307 Bacteria 1247
131 Ga0157375_10000306 3300013308 Bacteria 44319
132 Ga0157375_10246923 3300013308 Bacteria 1945
133 Ga0163163_10059554 3300014325 Bacteria 3778
134 Ga0157377_10051614 3300014745 Bacteria 2320
135 Ga0157376_10000047 3300014969 Bacteria 107974
136 Ga0163161_10028134 3300017792 Bacteria 3990
137 Ga0163161_10060360 3300017792 Bacteria 2760
138 Ga0206356_11301174 3300020070 Bacteria 3106
139 Ga0213876_10004546 3300021384 Bacteria 7749
140 Ga0207427_103481 3300025231 Bacteria 3269
141 Ga0209026_1001909 3300025250 Bacteria 8448
142 Ga0209148_1000285 3300025254 Bacteria 75960
143 Ga0209233_1000120 3300025261 Bacteria 233311
144 Ga0209455_1000629 3300025272 Bacteria 21805
145 Ga0207680_10014425 3300025903 Bacteria 4089
146 Ga0207647_10003436 3300025904 Bacteria 11888
147 Ga0207647_10028106 3300025904 Bacteria 3657
148 Ga0207647_10069602 3300025904 Bacteria 2127
149 Ga0207645_10002621 3300025907 Bacteria 14025
150 Ga0207645_10113721 3300025907 Bacteria 1754
151 Ga0207705_10000066 3300025909 Bacteria 136520
152 Ga0207705_10013953 3300025909 Bacteria 5793
153 Ga0207705_10168821 3300025909 Bacteria 1647
154 Ga0207695_10192658 3300025913 Bacteria 1955
155 Ga0207657_10004877 3300025919 Bacteria 14116
156 Ga0207657_10067788 3300025919 Bacteria 3033
157 Ga0207657_10143435 3300025919 Bacteria 1950
158 Ga0207657_10410340 3300025919 Bacteria 1065
159 Ga0207649_10007221 3300025920 Bacteria 6039
160 Ga0207694_10011589 3300025924 Bacteria 6653
161 Ga0207650_10003046 3300025925 Bacteria 11539
162 Ga0207650_10060014 3300025925 Bacteria 2837
163 Ga0207659_10001634 3300025926 Bacteria 13314
164 Ga0207659_10004441 3300025926 Bacteria 8487
165 Ga0207700_10139105 3300025928 Bacteria 1993
166 Ga0207664_10055615 3300025929 Bacteria 3141
167 Ga0207644_10001342 3300025931 Bacteria 15808
168 Ga0207644_10021200 3300025931 Bacteria 4424
169 Ga0207644_10049763 3300025931 Bacteria 3002
170 Ga0207644_10077389 3300025931 Bacteria 2450
171 Ga0207690_10007224 3300025932 Bacteria 6598
172 Ga0207690_10056358 3300025932 Bacteria 2651
173 Ga0207690_10229902 3300025932 Bacteria 1423
174 Ga0207690_10299721 3300025932 Bacteria 1257
175 Ga0207690_10513083 3300025932 Bacteria 971
176 Ga0207706_10001833 3300025933 Bacteria 20853
177 Ga0207706_10006990 3300025933 Bacteria 10429
178 Ga0207706_10074568 3300025933 Bacteria 2983
179 Ga0207706_10114084 3300025933 Bacteria 2377
180 Ga0207706_10117172 3300025933 Bacteria 2342
181 Ga0207706_10191354 3300025933 Bacteria 1796
182 Ga0207686_10000556 3300025934 Bacteria 24000
183 Ga0207709_10000050 3300025935 Bacteria 234391
184 Ga0207669_10037724 3300025937 Bacteria 2775
185 Ga0207669_10040959 3300025937 Bacteria 2692
186 Ga0207704_10000020 3300025938 Bacteria 148847
187 Ga0207691_10001067 3300025940 Bacteria 27255
188 Ga0207691_10086890 3300025940 Bacteria 2806
189 Ga0207711_10001981 3300025941 Bacteria 18546
190 Ga0207711_10006842 3300025941 Bacteria 9578
191 Ga0207711_10050008 3300025941 Bacteria 3579
192 Ga0207711_10067587 3300025941 Bacteria 3094
193 Ga0207689_10000268 3300025942 Bacteria 47140
194 Ga0207661_10019755 3300025944 Bacteria 5028
195 Ga0207679_10002166 3300025945 Bacteria 12148
196 Ga0207679_10079784 3300025945 Bacteria 2497
197 Ga0207667_10000007 3300025949 Bacteria 630590
198 Ga0207667_10321700 3300025949 Bacteria 1580
199 Ga0207651_10000005 3300025960 Bacteria 246132
200 Ga0207651_10011356 3300025960 Bacteria 4984
201 Ga0207640_10006411 3300025981 Bacteria 6454
202 Ga0207658_10002830 3300025986 Bacteria 12436
203 Ga0207658_10007504 3300025986 Bacteria 7428
204 Ga0207658_10318551 3300025986 Bacteria 1345
205 Ga0207677_10000094 3300026023 Bacteria 73172
206 Ga0207703_10625266 3300026035 Bacteria 1020
207 Ga0207639_10004705 3300026041 Bacteria 9187
208 Ga0207678_10003141 3300026067 Bacteria 14942
209 Ga0207678_10398397 3300026067 Unclassified 1192
210 Ga0207702_10010097 3300026078 Bacteria 7911
211 Ga0207702_10020574 3300026078 Bacteria 5463
212 Ga0207641_10008989 3300026088 Bacteria 8253
213 Ga0207641_10107874 3300026088 Bacteria 2464
214 Ga0207641_10145235 3300026088 Bacteria 2144
215 Ga0207648_10000017 3300026089 Bacteria 148699
216 Ga0207676_10077935 3300026095 Bacteria 2682
217 Ga0207674_10003309 3300026116 Bacteria 19811
218 Ga0207674_10016307 3300026116 Bacteria 8137
219 Ga0207674_10138564 3300026116 Bacteria 2394
220 Ga0207674_10289079 3300026116 Bacteria 1588
221 Ga0207683_10024365 3300026121 Bacteria 5211
222 Ga0207683_10081735 3300026121 Bacteria 2868
223 Ga0207698_10000140 3300026142 Bacteria 45780
224 Ga0207698_10209006 3300026142 Bacteria 1754
225 Ga0268266_10000002 3300028379 Bacteria 3059047
226 Ga0268266_10000093 3300028379 Bacteria 191879
227 Ga0268266_10044060 3300028379 Bacteria 3813
228 Ga0268266_10295967 3300028379 Bacteria 1508
229 Ga0307513_10030141 3300031456 Bacteria 6167
230 Ga0307408_100061750 3300031548 Bacteria 2736
231 Ga0307405_10152890 3300031731 Bacteria 1625
232 Ga0307405_10406372 3300031731 Bacteria 1067
233 Ga0307413_10010595 3300031824 Bacteria 4483
234 Ga0307413_10097408 3300031824 Bacteria 1934
235 Ga0307410_10237743 3300031852 Bacteria 1410
236 Ga0307406_10445052 3300031901 Bacteria 1038
237 Ga0307412_10171958 3300031911 Bacteria 1621
238 Ga0307409_100130429 3300031995 Bacteria 2147
239 Ga0307409_100214913 3300031995 Bacteria 1731
240 Ga0307414_10365969 3300032004 Bacteria 1242
241 Ga0307411_10037951 3300032005 Bacteria 3034
242 Ga0307411_10291992 3300032005 Bacteria 1303
243 Ga0307415_100033806 3300032126 Bacteria 3321
244 Ga0307415_100246786 3300032126 Bacteria 1448
245 Ga0307415_100279010 3300032126 Bacteria 1373
246 Ga0307510_10000180 3300033180 Bacteria 54116
247 Ga0307510_10260908 3300033180 Bacteria 1214
248 Ga0373923_0035351 3300035111 Bacteria 2034
249 Ga0373933_0328411 3300035724 Bacteria 992
250 Ga0395899_0002654 3300037312 Bacteria 14411
251 Ga0395899_0005592 3300037312 Bacteria 9746
252 Ga0395899_0026903 3300037312 Bacteria 4339
253 Ga0395899_0198648 3300037312 Bacteria 1400
254 Ga0395900_0011917 3300037418 Bacteria 8888
255 Ga0395900_0021076 3300037418 Bacteria 6660
256 Ga0395900_0024624 3300037418 Bacteria 6159
257 Ga0395900_0034300 3300037418 Bacteria 5224
258 Ga0395900_0067574 3300037418 Bacteria 3672
259 Ga0395900_0072931 3300037418 Bacteria 3529
260 Ga0395900_0105846 3300037418 Bacteria 2890
261 Ga0395900_0116694 3300037418 Bacteria 2739
262 Ga0395900_0249995 3300037418 Bacteria 1775
263 Ga0395900_0320490 3300037418 Bacteria 1530
264 Ga0395900_0351779 3300037418 Unclassified 1447
265 Ga0395898_0015661 3300037466 Bacteria 7770
266 Ga0395898_0050597 3300037466 Bacteria 4065
267 Ga0395898_0166070 3300037466 Bacteria 2111
268 Ga0395905_0000215 3300037471 Bacteria 89274
269 Ga0395905_0006900 3300037471 Bacteria 11354
270 Ga0395905_0012922 3300037471 Bacteria 8027
271 Ga0395905_0023694 3300037471 Bacteria 5796
272 Ga0395905_0032373 3300037471 Bacteria 4917
273 Ga0395905_0054691 3300037471 Bacteria 3735
274 Ga0395905_0055288 3300037471 Bacteria 3715
275 Ga0395905_0075198 3300037471 Bacteria 3166
276 Ga0395905_0075303 3300037471 Bacteria 3164
277 Ga0395905_0140097 3300037471 Bacteria 2276
278 Ga0395905_0153794 3300037471 Bacteria 2163
279 Ga0395905_0229391 3300037471 Bacteria 1736
280 Ga0395905_0907691 3300037471 Bacteria 784
281 Ga0395901_0001112 3300038443 Bacteria 28573
282 Ga0395901_0015998 3300038443 Bacteria 7643
283 Ga0395901_0021237 3300038443 Bacteria 6649
284 Ga0395901_0041721 3300038443 Bacteria 4756
285 Ga0395901_0058819 3300038443 Bacteria 3998
286 Ga0395901_0096405 3300038443 Bacteria 3100
287 Ga0436365_0046729 3300039437 Bacteria 5213
288 Ga0439445_0002922 3300042004 Bacteria 3817
289 Ga0439448_0000909 3300042005 Bacteria 7284
290 Ga0439448_0008782 3300042005 Bacteria 2963
291 Ga0439448_0055061 3300042005 Bacteria 1307
292 Ga0439455_0000214 3300042012 Bacteria 6833
293 Ga0439455_0002021 3300042012 Bacteria 3591
294 Ga0439455_0017124 3300042012 Bacteria 1684
295 Ga0439458_0000595 3300042157 Bacteria 9303
296 Ga0439458_0002191 3300042157 Bacteria 4829
297 Ga0439458_0005586 3300042157 Bacteria 2825
298 Ga0466969_0003904 3300044656 Bacteria 7914
299 Ga0466972_0043708 3300044658 Bacteria 2175
300 Ga0466965_0037399 3300044683 Bacteria 2383
301 Ga0466966_0001106 3300044684 Bacteria 17289
302 Ga0466966_0066420 3300044684 Bacteria 2267
303 Ga0466961_0000182 3300044693 Bacteria 42657
304 Ga0466961_0008117 3300044693 Bacteria 6684
305 Ga0466961_0020396 3300044693 Bacteria 4263
306 Ga0466964_0004938 3300044706 Bacteria 4929
307 Ga0466971_0047793 3300044719 Bacteria 1924
308 Ga0466970_0007375 3300044765 Bacteria 5510
309 Ga0466957_0070553 3300044842 Bacteria 2159
310 Ga0466957_0103787 3300044842 Bacteria 1795
311 Ga0466959_0000028 3300045049 Bacteria 114144
312 Ga0466959_0110876 3300045049 Bacteria 1958
313 Ga0466958_0000812 3300045836 Bacteria 13796
314 Ga0466958_0010086 3300045836 Bacteria 5280
315 Ga0466958_0019546 3300045836 Bacteria 3944
316 Ga0466967_0045408 3300045976 Bacteria 3817
317 Ga0466967_0182508 3300045976 Bacteria 1980
318 Ga0495629_0022247 3300046459 Bacteria 4521
319 Ga0495638_0195099 3300046460 Bacteria 1147
320 Ga0495650_0000096 3300046471 Bacteria 217464
321 Ga0495650_0118574 3300046471 Bacteria 976
322 Ga0495583_0000240 3300046506 Bacteria 90919
323 Ga0495583_0010719 3300046506 Bacteria 5319
324 Ga0495583_0113845 3300046506 Bacteria 1144
325 Ga0495648_0067695 3300046524 Bacteria 2087
326 Ga0495642_0110903 3300046528 Bacteria 1173
327 Ga0495587_0034219 3300046536 Bacteria 3065
328 Ga0495625_0001263 3300046660 Bacteria 31888
329 Ga0495625_0138261 3300046660 Bacteria 1645
330 Ga0495669_0014525 3300046684 Bacteria 3365
331 Ga0495670_0038610 3300046691 Bacteria 2381
332 Ga0495600_0018122 3300046809 Bacteria 4483
333 Ga0495677_0001999 3300047445 Bacteria 8142
334 Ga0495626_0103564 3300048091 Bacteria 1239
335 Ga0496101_0312403 3300048904 Unclassified 1232
336 Ga0496106_0052046 3300048909 Bacteria 3088
337 Ga0496107_0009673 3300048910 Bacteria 6685
338 Ga0496108_0438896 3300048911 Unclassified 1140
339 Ga0496109_0042128 3300048912 Bacteria 4135
340 Ga0496109_0231273 3300048912 Bacteria 1739
341 Ga0496110_0002528 3300048913 Bacteria 13744
342 Ga0496110_0013883 3300048913 Bacteria 6672
343 Ga0496111_0005700 3300048914 Bacteria 8025
344 Ga0496112_0027689 3300048915 Bacteria 5466
345 Ga0496113_0193399 3300048916 Bacteria 1615
346 Ga0496114_0038467 3300048917 Bacteria 3959
347 Ga0496120_0016455 3300048923 Bacteria 4834
348 Ga0496121_0128870 3300048924 Bacteria 1897
349 Ga0496125_0129573 3300048928 Bacteria 1779
350 Ga0501069_0024331 3300049585 Bacteria 3302
351 Ga0501070_0020872 3300049586 Bacteria 5495
352 Ga0501035_0277351 3300049822 Bacteria 1418
353 nmdc:mga0rr50_173556_c1 3300050513 Bacteria 1758
354 Ga0500643_003283 3300053087 Bacteria 7864
355 Ga0500647_0075125 3300053091 Bacteria 1622
356 Ga0500595_000212 3300053119 Bacteria 39585
357 Ga0500596_004169 3300053735 Bacteria 2672
358 Ga0466962_0000483 3300061719 Bacteria 17254
359 Ga0466962_0000942 3300061719 Bacteria 13184
360 2644352989 2643221663 Bacteria 3425771
361 Ga0466971_0022203
362 JGI24736J21556_1006457
363 JGI24741J21665_1008805
364 JGI24739J22299_10001557
365 JGI24739J22299_10011740
366 JGI24739J22299_10032100
367 JGI24739J22299_10042542
368 JGI24737J22298_10000812
369 JGI24737J22298_10003958
370 JGI24737J22298_10022481
371 JGI24735J21928_10005135
372 JGI24735J21928_10006366
373 JGI24738J21930_10001632
374 JGI24738J21930_10005750
375 JGI25157J39369_1012284
376 JGI25165J46597_1000127
377 rootL2_10159722
378 rootL2_10160224
379 Ga0065712_10068302
380 Ga0070658_10001074
381 Ga0070658_10017297
382 Ga0070658_10022723
383 Ga0070658_10039891
384 Ga0070658_10051555
385 Ga0070676_10005631
386 Ga0070676_10201718
387 Ga0070683_100001697
388 Ga0070670_100000383
389 Ga0070670_100049443
390 Ga0068869_100047914
391 Ga0070666_10025028
392 Ga0068868_100000053
393 Ga0070660_100020267
394 Ga0070660_100185165
395 Ga0070660_100568783
396 Ga0070661_100012106
397 Ga0070669_100086446
398 Ga0070675_100001468
399 Ga0070675_100006810
400 Ga0070671_100002180
401 Ga0070671_100016138
402 Ga0070671_100224576
403 Ga0070674_100097007
404 Ga0070673_100000010
405 Ga0070673_100002525
406 Ga0070659_100018461
407 Ga0070659_100027383
408 Ga0070659_100070280
409 Ga0070659_100302202
410 Ga0070667_100002028
411 Ga0070667_100010184
412 Ga0070667_100362780
413 Ga0070714_100065065
414 Ga0070713_100019468
415 Ga0070701_10212881
416 Ga0070663_100060402
417 Ga0070678_100021427
418 Ga0070678_100029138
419 Ga0070662_100001060
420 Ga0070662_100093922
421 Ga0070662_100189676
422 Ga0070662_100193135
423 Ga0068867_100000007
424 Ga0070684_100001906
425 Ga0068853_100005194
426 Ga0068853_100056600
427 Ga0070672_100001310
428 Ga0070672_100013451
429 Ga0070686_100001142
430 Ga0070665_100000103
431 Ga0070665_100000154
432 Ga0070665_100061956
433 Ga0068855_100000239
434 Ga0068855_100222017
435 Ga0070664_100002173
436 Ga0070664_100102645
437 Ga0070664_100220630
438 Ga0070664_100228394
439 Ga0068857_100004651
440 Ga0068857_100094544
441 Ga0068854_100003087
442 Ga0068856_100043480
443 Ga0068856_100174884
444 Ga0068852_100000965
445 Ga0068852_100010740
446 Ga0068852_100304231
447 Ga0068864_100016452
448 Ga0068851_10068543
449 Ga0068851_10086570
450 Ga0068863_100013642
451 Ga0068863_100124683
452 Ga0068863_100348269
453 Ga0068858_100698376
454 Ga0070717_10084807
455 Ga0075366_10105371
456 Ga0097621_100061222
457 Ga0068865_100000010
458 Ga0075435_100111939
459 Ga0105240_10127094
460 Ga0105240_10210685
461 Ga0105245_10000174
462 Ga0105245_10257112
463 Ga0105245_10730102
464 Ga0105243_10000054
465 Ga0105242_10000821
466 Ga0105248_10002052
467 Ga0105248_10006388
468 Ga0105248_10027330
469 Ga0105248_10037498
470 Ga0105237_10053547
471 Ga0105238_10017970
472 Ga0105249_10009100
473 Ga0105239_10020550
474 Ga0105246_10001706
475 Ga0105246_10058619
476 Ga0105246_10088122
477 Ga0157373_10050485
478 Ga0157371_10001856
479 Ga0157370_10000749
480 Ga0157370_10033937
481 Ga0157369_10005102
482 Ga0157369_10073551
483 Ga0157369_10530232
484 Ga0157374_10000468
485 Ga0157374_10016508
486 Ga0157378_10000494
487 Ga0163162_10070308
488 Ga0163162_10126782
489 Ga0157372_10214930
490 Ga0157372_10632360
491 Ga0157375_10000306
492 Ga0157375_10246923
493 Ga0163163_10059554
494 Ga0157377_10051614
495 Ga0157376_10000047
496 Ga0163161_10028134
497 Ga0163161_10060360
498 Ga0206356_11301174
499 Ga0213876_10004546
500 Ga0207427_103481
501 Ga0209026_1001909
502 Ga0209148_1000285
503 Ga0209233_1000120
504 Ga0209455_1000629
505 Ga0207680_10014425
506 Ga0207647_10003436
507 Ga0207647_10028106
508 Ga0207647_10069602
509 Ga0207645_10002621
510 Ga0207645_10113721
511 Ga0207705_10000066
512 Ga0207705_10013953
513 Ga0207705_10168821
514 Ga0207695_10192658
515 Ga0207657_10004877
516 Ga0207657_10067788
517 Ga0207657_10143435
518 Ga0207657_10410340
519 Ga0207649_10007221
520 Ga0207694_10011589
521 Ga0207650_10003046
522 Ga0207650_10060014
523 Ga0207659_10001634
524 Ga0207659_10004441
525 Ga0207700_10139105
526 Ga0207664_10055615
527 Ga0207644_10001342
528 Ga0207644_10021200
529 Ga0207644_10049763
530 Ga0207644_10077389
531 Ga0207690_10007224
532 Ga0207690_10056358
533 Ga0207690_10229902
534 Ga0207690_10299721
535 Ga0207690_10513083
536 Ga0207706_10001833
537 Ga0207706_10006990
538 Ga0207706_10074568
539 Ga0207706_10114084
540 Ga0207706_10117172
541 Ga0207706_10191354
542 Ga0207686_10000556
543 Ga0207709_10000050
544 Ga0207669_10037724
545 Ga0207669_10040959
546 Ga0207704_10000020
547 Ga0207691_10001067
548 Ga0207691_10086890
549 Ga0207711_10001981
550 Ga0207711_10006842
551 Ga0207711_10050008
552 Ga0207711_10067587
553 Ga0207689_10000268
554 Ga0207661_10019755
555 Ga0207679_10002166
556 Ga0207679_10079784
557 Ga0207667_10000007
558 Ga0207667_10321700
559 Ga0207651_10000005
560 Ga0207651_10011356
561 Ga0207640_10006411
562 Ga0207658_10002830
563 Ga0207658_10007504
564 Ga0207658_10318551
565 Ga0207677_10000094
566 Ga0207703_10625266
567 Ga0207639_10004705
568 Ga0207678_10003141
569 Ga0207678_10398397
570 Ga0207702_10010097
571 Ga0207702_10020574
572 Ga0207641_10008989
573 Ga0207641_10107874
574 Ga0207641_10145235
575 Ga0207648_10000017
576 Ga0207676_10077935
577 Ga0207674_10003309
578 Ga0207674_10016307
579 Ga0207674_10138564
580 Ga0207674_10289079
581 Ga0207683_10024365
582 Ga0207683_10081735
583 Ga0207698_10000140
584 Ga0207698_10209006
585 Ga0268266_10000002
586 Ga0268266_10000093
587 Ga0268266_10044060
588 Ga0268266_10295967
589 Ga0307513_10030141
590 Ga0307408_100061750
591 Ga0307405_10152890
592 Ga0307405_10406372
593 Ga0307413_10010595
594 Ga0307413_10097408
595 Ga0307410_10237743
596 Ga0307406_10445052
597 Ga0307412_10171958
598 Ga0307409_100130429
599 Ga0307409_100214913
600 Ga0307414_10365969
601 Ga0307411_10037951
602 Ga0307411_10291992
603 Ga0307415_100033806
604 Ga0307415_100246786
605 Ga0307415_100279010
606 Ga0307510_10000180
607 Ga0307510_10260908
608 Ga0373923_0035351
609 Ga0373933_0328411
610 Ga0395899_0002654
611 Ga0395899_0005592
612 Ga0395899_0026903
613 Ga0395899_0198648
614 Ga0395900_0011917
615 Ga0395900_0021076
616 Ga0395900_0024624
617 Ga0395900_0034300
618 Ga0395900_0067574
619 Ga0395900_0072931
620 Ga0395900_0105846
621 Ga0395900_0116694
622 Ga0395900_0249995
623 Ga0395900_0320490
624 Ga0395900_0351779
625 Ga0395898_0015661
626 Ga0395898_0050597
627 Ga0395898_0166070
628 Ga0395905_0000215
629 Ga0395905_0006900
630 Ga0395905_0012922
631 Ga0395905_0023694
632 Ga0395905_0032373
633 Ga0395905_0054691
634 Ga0395905_0055288
635 Ga0395905_0075198
636 Ga0395905_0075303
637 Ga0395905_0140097
638 Ga0395905_0153794
639 Ga0395905_0229391
640 Ga0395905_0907691
641 Ga0395901_0001112
642 Ga0395901_0015998
643 Ga0395901_0021237
644 Ga0395901_0041721
645 Ga0395901_0058819
646 Ga0395901_0096405
647 Ga0436365_0046729
648 Ga0439445_0002922
649 Ga0439448_0000909
650 Ga0439448_0008782
651 Ga0439448_0055061
652 Ga0439455_0000214
653 Ga0439455_0002021
654 Ga0439455_0017124
655 Ga0439458_0000595
656 Ga0439458_0002191
657 Ga0439458_0005586
658 Ga0466969_0003904
659 Ga0466972_0043708
660 Ga0466965_0037399
661 Ga0466966_0001106
662 Ga0466966_0066420
663 Ga0466961_0000182
664 Ga0466961_0008117
665 Ga0466961_0020396
666 Ga0466964_0004938
667 Ga0466971_0047793
668 Ga0466970_0007375
669 Ga0466957_0070553
670 Ga0466957_0103787
671 Ga0466959_0000028
672 Ga0466959_0110876
673 Ga0466958_0000812
674 Ga0466958_0010086
675 Ga0466958_0019546
676 Ga0466967_0045408
677 Ga0466967_0182508
678 Ga0495629_0022247
679 Ga0495638_0195099
680 Ga0495650_0000096
681 Ga0495650_0118574
682 Ga0495583_0000240
683 Ga0495583_0010719
684 Ga0495583_0113845
685 Ga0495648_0067695
686 Ga0495642_0110903
687 Ga0495587_0034219
688 Ga0495625_0001263
689 Ga0495625_0138261
690 Ga0495669_0014525
691 Ga0495670_0038610
692 Ga0495600_0018122
693 Ga0495677_0001999
694 Ga0495626_0103564
695 Ga0496101_0312403
696 Ga0496106_0052046
697 Ga0496107_0009673
698 Ga0496108_0438896
699 Ga0496109_0042128
700 Ga0496109_0231273
701 Ga0496110_0002528
702 Ga0496110_0013883
703 Ga0496111_0005700
704 Ga0496112_0027689
705 Ga0496113_0193399
706 Ga0496114_0038467
707 Ga0496120_0016455
708 Ga0496121_0128870
709 Ga0496125_0129573
710 Ga0501069_0024331
711 Ga0501070_0020872
712 Ga0501035_0277351
713 nmdc:mga0rr50_173556_c1
714 Ga0500643_003283
715 Ga0500647_0075125
716 Ga0500595_000212
717 Ga0500596_004169
718 Ga0466962_0000483
719 Ga0466962_0000942
720 2644352989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00722

Glyco_hydro_16

Glycosyl hydrolases family 16

88

295

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xqf-assembly1.cif.gz_A crystal structure of sclam e144s mutant, a non-specific endo-beta-1,3(4)-glucanase from family gh16, co-crystallized with 1,3-beta-d-cellotriosyl-glucose, presenting a 1,3-beta-d-cellobiosyl-glucose at active site 0.959 26 281
6xof-assembly1.cif.gz_A crystal structure of sclam, a non-specific endo-beta-1,3(4)-glucanase from family gh16 0.9573 19 283
6xqg-assembly1.cif.gz_A crystal structure of sclam e144s mutant, a non-specific endo-beta-1,3(4)-glucanase from family gh16, co-crystallized with 1,3-beta-d-cellobiosyl-cellobiose, presenting a 1,3-beta-d-cellobiosyl-glucose at active site 0.9561 26 281
6xqf-assembly1.cif.gz_A crystal structure of sclam e144s mutant, a non-specific endo-beta-1,3(4)-glucanase from family gh16, co-crystallized with 1,3-beta-d-cellotriosyl-glucose, presenting a 1,3-beta-d-cellobiosyl-glucose at active site 0.9481 26 281
6xqg-assembly1.cif.gz_A crystal structure of sclam e144s mutant, a non-specific endo-beta-1,3(4)-glucanase from family gh16, co-crystallized with 1,3-beta-d-cellobiosyl-cellobiose, presenting a 1,3-beta-d-cellobiosyl-glucose at active site 0.9449 26 281
ID Description Score Start End Superfamily
5wutB00 Mainly Beta;Sandwich;Jelly Rolls; 0.9324 39 281 2.60.120.200
5wutB00 Mainly Beta;Sandwich;Jelly Rolls; 0.9285 39 281 2.60.120.200
af_Q54VL7_42_274_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.9132 33 283 2.60.120.200
3ilnA00 Mainly Beta;Sandwich;Jelly Rolls; 0.9116 34 284 2.60.120.200
3ilnA00 Mainly Beta;Sandwich;Jelly Rolls; 0.908 34 284 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A6G7YTB7-F1-model_v4 Glycoside hydrolase family 16 protein 0.9652 32 284 GO:0004553
GO:0005975
AF-A0A0N1AUX0-F1-model_v4 Glycoside hydrolase 0.9627 33 283 GO:0004553
GO:0005975
AF-A0A4Q3QHM7-F1-model_v4 deleted 0.9622 114 281
AF-A0A6I4UWD9-F1-model_v4 Family 16 glycosylhydrolase 0.9616 31 283 GO:0004553
GO:0005975
AF-A0A6G7YTB7-F1-model_v4 Glycoside hydrolase family 16 protein 0.9614 32 284 GO:0004553
GO:0005975

Map