F421916

General Info

Members Datasets Scaffolds Average Seq Length
360 198 346 247

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10032966|Ga0307414_100329663
Length 260
Sequence VSRFALTLEFDGGPFFGLQRQGHGPSVQEAVERAVREVTGETVTMHSAGRTDSGVHALAMVSHVDIAKPIAPFRLMEALNAKLRPDPIAVIACEEKPGDWHARFSCIGRRYQYRIRNRRAPLTLERGRAWLVTRPLDAEAMHRAAQALVGRHDFTTFRSAHCQAQDPVKTLDRLDVRRAEELGGDLLLIEAAARSFLHHQVRSMVGTLALVGLGQWSEGQVAAALAAKERAALGLNAPPEGLYFVEAVYDPPLQGEVAGA

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
3 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
4 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
5 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
6 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
7 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
8 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
9 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
10 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
11 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
12 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
13 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
14 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
112 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
187 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
190 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
191 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
194 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
195 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 0
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 1.39
Bulb 0
Endosphere 7.22
Nodule 0
Rhizoplane 6.67
Rhizosphere 75.83
Stem 0
Stem Tuber 0
Unclassified 8.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000138 3300001904 Bacteria 12596
2 JGI24741J21665_1001479 3300001915 Bacteria 6703
3 JGI24740J21852_10006372 3300001979 Bacteria 4894
4 JGI24740J21852_10010351 3300001979 Bacteria 3601
5 JGI24740J21852_10013551 3300001979 Bacteria 3037
6 JGI24739J22299_10007225 3300001989 Bacteria 4177
7 JGI24739J22299_10009438 3300001989 Bacteria 3635
8 JGI24739J22299_10009524 3300001989 Bacteria 3618
9 JGI24735J21928_10000644 3300002067 Bacteria 12307
10 JGI24735J21928_10005739 3300002067 Bacteria 4104
11 JGI24735J21928_10033847 3300002067 Bacteria 1508
12 JGI24738J21930_10000915 3300002075 Bacteria 8493
13 JGI24738J21930_10001216 3300002075 Bacteria 7228
14 JGI24738J21930_10004560 3300002075 Bacteria 3383
15 rootH1_10085885 3300003316 Bacteria 1545
16 Ga0065704_10009711 3300005289 Bacteria 3283
17 Ga0065704_10167610 3300005289 Bacteria 1312
18 Ga0065707_10026699 3300005295 Bacteria 1166
19 Ga0070658_10352075 3300005327 Bacteria 1260
20 Ga0070666_10008340 3300005335 Bacteria 6427
21 Ga0070660_100182440 3300005339 Bacteria 1698
22 Ga0070660_100484782 3300005339 Bacteria 1028
23 Ga0070661_100027773 3300005344 Bacteria 4077
24 Ga0070661_100039768 3300005344 Bacteria 3427
25 Ga0070661_100095028 3300005344 Bacteria 2210
26 Ga0070668_100000099 3300005347 Bacteria 52778
27 Ga0070668_100056411 3300005347 Bacteria 3034
28 Ga0070669_100075689 3300005353 Bacteria 2497
29 Ga0070671_100039990 3300005355 Bacteria 3893
30 Ga0070671_100222828 3300005355 Bacteria 1600
31 Ga0070674_100041060 3300005356 Bacteria 3132
32 Ga0070659_100133137 3300005366 Bacteria 2020
33 Ga0070659_100434792 3300005366 Bacteria 1111
34 Ga0070667_100000038 3300005367 Bacteria 171914
35 Ga0070667_100370000 3300005367 Bacteria 1300
36 Ga0070663_100001752 3300005455 Bacteria 12072
37 Ga0070663_100173867 3300005455 Bacteria 1666
38 Ga0070662_100026039 3300005457 Bacteria 4047
39 Ga0070662_100040636 3300005457 Bacteria 3313
40 Ga0070662_100120192 3300005457 Bacteria 2013
41 Ga0070662_100184541 3300005457 Bacteria 1646
42 Ga0070662_100216780 3300005457 Bacteria 1525
43 Ga0068853_100000230 3300005539 Bacteria 39593
44 Ga0068853_100002373 3300005539 Bacteria 14072
45 Ga0068853_100097855 3300005539 Bacteria 2591
46 Ga0068853_100152545 3300005539 Bacteria 2080
47 Ga0068853_100293044 3300005539 Bacteria 1502
48 Ga0070672_100044719 3300005543 Bacteria 3422
49 Ga0070665_100026049 3300005548 Bacteria 5889
50 Ga0068855_100141296 3300005563 Bacteria 2744
51 Ga0068857_100024942 3300005577 Bacteria 5266
52 Ga0068857_100048655 3300005577 Bacteria 3763
53 Ga0068857_100051703 3300005577 Bacteria 3646
54 Ga0068857_100073771 3300005577 Bacteria 3041
55 Ga0068857_100174387 3300005577 Bacteria 1955
56 Ga0068857_100337301 3300005577 Bacteria 1394
57 Ga0068854_100006628 3300005578 Bacteria 7374
58 Ga0068854_100073414 3300005578 Bacteria 2507
59 Ga0068856_100028579 3300005614 Bacteria 5445
60 Ga0068856_100558981 3300005614 Bacteria 1165
61 Ga0068852_100074779 3300005616 Bacteria 2985
62 Ga0068852_100119216 3300005616 Bacteria 2412
63 Ga0068852_100244708 3300005616 Bacteria 1716
64 Ga0068852_100413983 3300005616 Bacteria 1328
65 Ga0068852_100509378 3300005616 Bacteria 1199
66 Ga0068861_100459105 3300005719 Bacteria 1143
67 Ga0068863_100000255 3300005841 Bacteria 55911
68 Ga0068860_100049956 3300005843 Bacteria 3983
69 Ga0075368_10000134 3300006042 Bacteria 19630
70 Ga0075367_10001817 3300006178 Bacteria 9398
71 Ga0075366_10202397 3300006195 Bacteria 1208
72 Ga0105240_10062505 3300009093 Bacteria 4636
73 Ga0105240_10142245 3300009093 Bacteria 2867
74 Ga0105240_10655886 3300009093 Bacteria 1150
75 Ga0105240_10859292 3300009093 Bacteria 979
76 Ga0105241_10003710 3300009174 Bacteria 11344
77 Ga0105241_10526220 3300009174 Bacteria 1058
78 Ga0105237_10057301 3300009545 Bacteria 3900
79 Ga0105237_10317253 3300009545 Bacteria 1562
80 Ga0105238_10314716 3300009551 Bacteria 1551
81 Ga0105249_10025940 3300009553 Bacteria 5278
82 Ga0105148_100414 3300009978 Bacteria 4312
83 Ga0105239_10108215 3300010375 Bacteria 3080
84 Ga0105239_10543784 3300010375 Bacteria 1322
85 Ga0157373_10140042 3300013100 Bacteria 1701
86 Ga0157371_10263281 3300013102 Bacteria 1243
87 Ga0157370_10001856 3300013104 Bacteria 26045
88 Ga0157370_10057631 3300013104 Bacteria 3693
89 Ga0157369_10149816 3300013105 Bacteria 2466
90 Ga0157369_10491355 3300013105 Bacteria 1270
91 Ga0157369_10924954 3300013105 Bacteria 894
92 Ga0157369_11002842 3300013105 Bacteria 855
93 Ga0163162_10039928 3300013306 Bacteria 4691
94 Ga0157372_10032282 3300013307 Bacteria 5740
95 Ga0157372_10090364 3300013307 Bacteria 3481
96 Ga0157372_10123785 3300013307 Bacteria 2972
97 Ga0157380_10000086 3300014326 Bacteria 51604
98 Ga0163161_10008263 3300017792 Bacteria 7200
99 Ga0213874_10003979 3300021377 Bacteria 3328
100 Ga0213875_10000401 3300021388 Bacteria 38122
101 Ga0209147_100452 3300025229 Bacteria 25788
102 Ga0207656_10117934 3300025321 Bacteria 1233
103 Ga0207680_10005487 3300025903 Bacteria 6064
104 Ga0207647_10000192 3300025904 Bacteria 49640
105 Ga0207647_10002429 3300025904 Bacteria 14133
106 Ga0207647_10007383 3300025904 Bacteria 7948
107 Ga0207647_10093663 3300025904 Bacteria 1790
108 Ga0207654_10022885 3300025911 Bacteria 3340
109 Ga0207654_10157818 3300025911 Bacteria 1463
110 Ga0207695_10012713 3300025913 Bacteria 10079
111 Ga0207695_10124849 3300025913 Bacteria 2538
112 Ga0207695_10225107 3300025913 Bacteria 1782
113 Ga0207671_10000479 3300025914 Bacteria 54184
114 Ga0207671_10020643 3300025914 Bacteria 5010
115 Ga0207657_10003878 3300025919 Bacteria 15869
116 Ga0207657_10023256 3300025919 Bacteria 5774
117 Ga0207649_10166068 3300025920 Bacteria 1533
118 Ga0207681_10007249 3300025923 Bacteria 6798
119 Ga0207694_10014827 3300025924 Bacteria 5877
120 Ga0207694_10111527 3300025924 Bacteria 2176
121 Ga0207694_10165651 3300025924 Bacteria 1787
122 Ga0207694_10226329 3300025924 Bacteria 1526
123 Ga0207644_10126741 3300025931 Bacteria 1949
124 Ga0207706_10003402 3300025933 Bacteria 15197
125 Ga0207706_10009534 3300025933 Bacteria 8915
126 Ga0207706_10023320 3300025933 Bacteria 5558
127 Ga0207706_10027933 3300025933 Bacteria 5043
128 Ga0207706_10045624 3300025933 Bacteria 3882
129 Ga0207706_10060996 3300025933 Bacteria 3321
130 Ga0207706_10120092 3300025933 Bacteria 2311
131 Ga0207691_10075147 3300025940 Bacteria 3047
132 Ga0207667_10052109 3300025949 Bacteria 4312
133 Ga0207667_10416987 3300025949 Bacteria 1366
134 Ga0207712_10012890 3300025961 Bacteria 5350
135 Ga0207668_10000420 3300025972 Bacteria 26815
136 Ga0207668_10280420 3300025972 Bacteria 1366
137 Ga0207640_10014222 3300025981 Bacteria 4576
138 Ga0207640_10023676 3300025981 Bacteria 3694
139 Ga0207640_10661916 3300025981 Bacteria 891
140 Ga0207658_10000029 3300025986 Bacteria 171928
141 Ga0207658_10313394 3300025986 Bacteria 1356
142 Ga0207639_10003124 3300026041 Bacteria 11134
143 Ga0207639_10008528 3300026041 Bacteria 7032
144 Ga0207639_10020019 3300026041 Bacteria 4784
145 Ga0207639_10127162 3300026041 Bacteria 2104
146 Ga0207678_10006156 3300026067 Bacteria 10673
147 Ga0207678_10018100 3300026067 Bacteria 6188
148 Ga0207678_10150836 3300026067 Bacteria 1985
149 Ga0207678_10549514 3300026067 Bacteria 1010
150 Ga0207702_10005614 3300026078 Bacteria 10947
151 Ga0207702_10007410 3300026078 Bacteria 9366
152 Ga0207641_10000343 3300026088 Bacteria 56041
153 Ga0207641_10000580 3300026088 Bacteria 40301
154 Ga0207674_10011479 3300026116 Bacteria 9952
155 Ga0207674_10031213 3300026116 Bacteria 5599
156 Ga0207674_10049158 3300026116 Bacteria 4314
157 Ga0207674_10076713 3300026116 Bacteria 3349
158 Ga0207674_10083946 3300026116 Bacteria 3184
159 Ga0207674_10093926 3300026116 Bacteria 2987
160 Ga0207698_10001453 3300026142 Bacteria 13782
161 Ga0207698_10027628 3300026142 Bacteria 4031
162 Ga0207698_10040072 3300026142 Bacteria 3476
163 Ga0207698_10190741 3300026142 Bacteria 1825
164 Ga0207698_10258984 3300026142 Bacteria 1597
165 Ga0209813_10000026 3300027866 Bacteria 71626
166 Ga0268266_10012074 3300028379 Bacteria 7475
167 Ga0268264_10025247 3300028381 Bacteria 4854
168 Ga0265328_10007704 3300031239 Bacteria 4477
169 Ga0307408_100083388 3300031548 Bacteria 2395
170 Ga0307408_100276527 3300031548 Bacteria 1396
171 Ga0307405_10022636 3300031731 Bacteria 3556
172 Ga0307413_10015854 3300031824 Bacteria 3874
173 Ga0307410_10013845 3300031852 Bacteria 4722
174 Ga0307410_10218222 3300031852 Bacteria 1466
175 Ga0307406_10171678 3300031901 Bacteria 1570
176 Ga0307406_10209982 3300031901 Bacteria 1439
177 Ga0307407_10113581 3300031903 Bacteria 1705
178 Ga0307412_10039057 3300031911 Bacteria 3061
179 Ga0307412_10119277 3300031911 Bacteria 1896
180 Ga0307412_10174029 3300031911 Bacteria 1612
181 Ga0307412_10289573 3300031911 Bacteria 1289
182 Ga0307412_10420753 3300031911 Bacteria 1093
183 Ga0307409_100152528 3300031995 Bacteria 2008
184 Ga0307409_100296432 3300031995 Bacteria 1502
185 Ga0307409_100609081 3300031995 Bacteria 1080
186 Ga0307416_100035887 3300032002 Bacteria 3793
187 Ga0307416_100889808 3300032002 Bacteria 990
188 Ga0307414_10000936 3300032004 Bacteria 14906
189 Ga0307414_10032966 3300032004 Bacteria 3417
190 Ga0307414_10241685 3300032004 Bacteria 1495
191 Ga0307415_100012288 3300032126 Bacteria 4944
192 Ga0395905_0167545 3300037471 Bacteria 2064
193 Ga0395905_0294156 3300037471 Bacteria 1511
194 Ga0436364_0380874 3300037853 Bacteria 90281
195 Ga0395901_0148077 3300038443 Bacteria 2467
196 Ga0395901_0565210 3300038443 Bacteria 1151
197 Ga0439448_0000458 3300042005 Bacteria 9415
198 Ga0439448_0006784 3300042005 Bacteria 3300
199 Ga0439448_0074991 3300042005 Bacteria 1130
200 Ga0439448_0118297 3300042005 Bacteria 908
201 Ga0439455_0000272 3300042012 Bacteria 6323
202 Ga0439455_0001684 3300042012 Bacteria 3804
203 Ga0439458_0000004 3300042157 Bacteria 32502
204 Ga0439458_0000749 3300042157 Bacteria 8305
205 Ga0439458_0006244 3300042157 Bacteria 2659
206 Ga0466965_0049829 3300044683 Bacteria 2076
207 Ga0466961_0145149 3300044693 Bacteria 1484
208 Ga0466963_0000856 3300044694 Bacteria 15370
209 Ga0466964_0027352 3300044706 Bacteria 2239
210 Ga0466971_0017093 3300044719 Bacteria 3205
211 Ga0466968_0048632 3300044735 Bacteria 1805
212 Ga0466970_0018389 3300044765 Bacteria 3617
213 Ga0466959_0119993 3300045049 Bacteria 1870
214 Ga0466958_0000484 3300045836 Bacteria 16666
215 Ga0466967_0184985 3300045976 Bacteria 1967
216 Ga0466967_0296227 3300045976 Bacteria 1555
217 Ga0495617_011259 3300046452 Bacteria 3053
218 Ga0495627_000114 3300046453 Bacteria 100085
219 Ga0495627_008863 3300046453 Bacteria 3729
220 Ga0495638_0000016 3300046460 Bacteria 396505
221 Ga0495638_0183220 3300046460 Bacteria 1193
222 Ga0495638_0260959 3300046460 Bacteria 950
223 Ga0495650_0006895 3300046471 Bacteria 6967
224 Ga0495650_0052378 3300046471 Bacteria 1676
225 Ga0495584_0016538 3300046491 Bacteria 3761
226 Ga0495583_0000094 3300046506 Bacteria 153549
227 Ga0495583_0000111 3300046506 Bacteria 138300
228 Ga0495606_0032322 3300046507 Bacteria 3627
229 Ga0495610_0000068 3300046512 Bacteria 122949
230 Ga0495616_0000187 3300046513 Bacteria 51726
231 Ga0495632_0000007 3300046519 Bacteria 343246
232 Ga0495632_0000132 3300046519 Bacteria 75720
233 Ga0495637_0001444 3300046520 Bacteria 13998
234 Ga0495643_0000005 3300046522 Bacteria 443135
235 Ga0495648_0000013 3300046524 Bacteria 289090
236 Ga0495648_0005335 3300046524 Bacteria 10713
237 Ga0495648_0190686 3300046524 Bacteria 1034
238 Ga0495663_0000005 3300046525 Bacteria 342265
239 Ga0495633_0000550 3300046558 Bacteria 36970
240 Ga0495633_0003251 3300046558 Bacteria 10950
241 Ga0495633_0082944 3300046558 Bacteria 1491
242 Ga0495668_0006493 3300046616 Bacteria 7651
243 Ga0495668_0210621 3300046616 Bacteria 1064
244 Ga0495625_0072587 3300046660 Bacteria 2413
245 Ga0495671_0000007 3300046692 Bacteria 443069
246 Ga0495671_0000018 3300046692 Bacteria 291470
247 Ga0495671_0218955 3300046692 Bacteria 922
248 Ga0495673_0000029 3300047469 Bacteria 471019
249 Ga0495673_0012017 3300047469 Bacteria 4619
250 Ga0495681_0000055 3300047470 Bacteria 104502
251 Ga0495681_0021318 3300047470 Bacteria 3495
252 Ga0495681_0099997 3300047470 Bacteria 1269
253 Ga0495686_0000149 3300047472 Bacteria 135332
254 Ga0495686_0050359 3300047472 Bacteria 2617
255 Ga0495686_0142444 3300047472 Bacteria 1413
256 Ga0496101_0018241 3300048904 Bacteria 4769
257 Ga0496102_0007238 3300048905 Bacteria 9471
258 Ga0496103_0000910 3300048906 Bacteria 21253
259 Ga0496103_0041975 3300048906 Bacteria 2813
260 Ga0496104_0000040 3300048907 Bacteria 162886
261 Ga0496104_0008894 3300048907 Bacteria 8925
262 Ga0496104_0032375 3300048907 Bacteria 4865
263 Ga0496104_0114614 3300048907 Bacteria 2585
264 Ga0496105_0000082 3300048908 Bacteria 69786
265 Ga0496105_0011434 3300048908 Bacteria 7013
266 Ga0496105_0027207 3300048908 Bacteria 4669
267 Ga0496105_0096239 3300048908 Bacteria 2445
268 Ga0496107_0061366 3300048910 Bacteria 2722
269 Ga0496108_0001477 3300048911 Bacteria 18569
270 Ga0496109_0084645 3300048912 Bacteria 2926
271 Ga0496109_0110248 3300048912 Bacteria 2559
272 Ga0496110_0033544 3300048913 Bacteria 4441
273 Ga0496110_0132503 3300048913 Bacteria 2251
274 Ga0496111_0064126 3300048914 Bacteria 2665
275 Ga0496112_0018129 3300048915 Bacteria 6624
276 Ga0496112_0413626 3300048915 Bacteria 1288
277 Ga0496113_0012570 3300048916 Bacteria 5694
278 Ga0496113_0113495 3300048916 Bacteria 2112
279 Ga0496115_0088700 3300048918 Bacteria 2525
280 Ga0496116_0031777 3300048919 Bacteria 3773
281 Ga0496117_0011777 3300048920 Bacteria 7794
282 Ga0496117_0019957 3300048920 Bacteria 5482
283 Ga0496117_0030151 3300048920 Bacteria 4168
284 Ga0496117_0203353 3300048920 Bacteria 1117
285 Ga0496118_0007759 3300048921 Bacteria 11267
286 Ga0496118_0027889 3300048921 Bacteria 4769
287 Ga0496118_0049734 3300048921 Bacteria 3225
288 Ga0496118_0072503 3300048921 Bacteria 2473
289 Ga0496118_0164823 3300048921 Bacteria 1364
290 Ga0496119_0007465 3300048922 Bacteria 9836
291 Ga0496119_0069287 3300048922 Bacteria 2073
292 Ga0496119_0118723 3300048922 Bacteria 1457
293 Ga0496121_0000587 3300048924 Bacteria 68273
294 Ga0496121_0003164 3300048924 Bacteria 23728
295 Ga0496121_0133380 3300048924 Bacteria 1854
296 Ga0496121_0265070 3300048924 Bacteria 1184
297 Ga0496122_0040350 3300048925 Bacteria 3711
298 Ga0496123_0039220 3300048926 Bacteria 3316
299 Ga0496124_0016615 3300048927 Bacteria 6985
300 Ga0496124_0046079 3300048927 Bacteria 3736
301 Ga0496125_0032182 3300048928 Bacteria 4662
302 Ga0496125_0106050 3300048928 Bacteria 2052
303 Ga0496126_0009794 3300048929 Bacteria 10146
304 Ga0496126_0014807 3300048929 Bacteria 7868
305 Ga0496126_0115490 3300048929 Bacteria 2334
306 Ga0495678_048322 3300049459 Bacteria 1660
307 Ga0495682_0005039 3300049460 Bacteria 5550
308 Ga0501034_0055344 3300049571 Bacteria 3992
309 Ga0501036_0304397 3300049572 Bacteria 1333
310 Ga0501038_0013511 3300049574 Bacteria 7442
311 Ga0501047_0187912 3300049581 Bacteria 1930
312 Ga0501047_0375997 3300049581 Bacteria 1255
313 Ga0501069_0075050 3300049585 Bacteria 1898
314 Ga0501070_0293423 3300049586 Bacteria 1325
315 Ga0501073_0062187 3300049589 Bacteria 2604
316 Ga0501074_0028048 3300049590 Bacteria 4081
317 Ga0501223_000002 3300049663 Bacteria 154573
318 Ga0501225_0000716 3300049705 Bacteria 10432
319 Ga0501079_0514645 3300049741 Bacteria 941
320 Ga0501083_0012177 3300049744 Bacteria 6022
321 Ga0501083_0031911 3300049744 Bacteria 3613
322 Ga0501035_0075708 3300049822 Bacteria 2977
323 nmdc:mga0k408_203989_c1 3300050493 Bacteria 1180
324 nmdc:mga06z11_19_c1 3300050494 Bacteria 76090
325 nmdc:mga04h51_14_c1 3300050495 Bacteria 77981
326 Ga0500643_000488 3300053087 Bacteria 28843
327 Ga0500643_002844 3300053087 Bacteria 8629
328 Ga0500643_007079 3300053087 Bacteria 4592
329 Ga0500643_010700 3300053087 Bacteria 3395
330 Ga0500555_000403 3300053103 Bacteria 18009
331 Ga0500556_0000013 3300053104 Bacteria 243797
332 Ga0500562_004364 3300053108 Bacteria 3581
333 Ga0500562_022818 3300053108 Bacteria 1632
334 Ga0500607_001592 3300053121 Bacteria 20060
335 Ga0500608_062435 3300053122 Bacteria 1779
336 Ga0500642_0000002 3300053130 Bacteria 795093
337 Ga0500559_0000841 3300053136 Bacteria 19866
338 Ga0500559_0045593 3300053136 Bacteria 1920
339 Ga0500604_0004870 3300053151 Bacteria 3559
340 Ga0500624_000042 3300053157 Bacteria 90289
341 Ga0500627_0002094 3300053158 Bacteria 5791
342 Ga0500645_000105 3300053730 Bacteria 67078
343 Ga0500661_000036 3300055283 Bacteria 19851
344 Ga0501082_0077662 3300060353 Bacteria 2863
345 Ga0501082_0473439 3300060353 Bacteria 1095
346 Ga0501082_0786564 3300060353 Bacteria 832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0132503 Ga0496110_0132503_238_966 228
2 3300005327 Ga0070658_10352075 Ga0070658_103520752 230
3 3300005366 Ga0070659_100133137 Ga0070659_1001331372 230
4 3300005457 Ga0070662_100184541 Ga0070662_1001845412 230
5 3300013306 Ga0163162_10039928 Ga0163162_100399281 230
6 3300021388 Ga0213875_10000401 Ga0213875_1000040126 230
7 3300037853 Ga0436364_0380874 Ga0436364_0380874_86357_87052 230
8 3300046460 Ga0495638_0183220 Ga0495638_0183220_309_1001 230
9 3300046506 Ga0495583_0000111 Ga0495583_0000111_118023_118715 230
10 3300046692 Ga0495671_0218955 Ga0495671_0218955_133_825 230
11 3300048912 Ga0496109_0110248 Ga0496109_0110248_858_1553 230
12 3300049460 Ga0495682_0005039 Ga0495682_0005039_4773_5465 230
13 3300053103 Ga0500555_000403 Ga0500555_000403_14636_15328 230
14 3300060353 Ga0501082_0473439 Ga0501082_0473439_381_1073 230
15 3300048928 Ga0496125_0106050 Ga0496125_0106050_278_1024 235
16 iso_pu_bacteria 2512564014 2512643760 241
17 iso_pu_bacteria 2808606401 2809064280 241
18 iso_pu_bacteria 2808606404 2809080248 241
19 iso_pu_bacteria 2808606405 2809084612 241
20 iso_pu_bacteria 2830075706 2830077722 241
21 iso_pu_bacteria 2880518877 2880522152 241
22 iso_pu_bacteria 2928027323 2928027616 241
23 iso_pu_bacteria 2946787523 2946788035 241
24 iso_pu_bacteria 2984555340 2984558090 241
25 iso_pu_bacteria 2984564862 2984567542 241
26 iso_pu_bacteria 2990265787 2990269162 241
27 iso_pu_bacteria 2993356040 2993358595 241
28 iso_pu_bacteria 2993693658 2993694867 241
29 3300001904 JGI24736J21556_1000138 JGI24736J21556_10001383 245
30 3300001915 JGI24741J21665_1001479 JGI24741J21665_10014795 245
31 3300001979 JGI24740J21852_10006372 JGI24740J21852_100063725 245
32 3300001979 JGI24740J21852_10010351 JGI24740J21852_100103513 245
33 3300001979 JGI24740J21852_10013551 JGI24740J21852_100135512 245
34 3300001989 JGI24739J22299_10007225 JGI24739J22299_100072255 245
35 3300001989 JGI24739J22299_10009438 JGI24739J22299_100094383 245
36 3300001989 JGI24739J22299_10009524 JGI24739J22299_100095243 245
37 3300002067 JGI24735J21928_10000644 JGI24735J21928_100006443 245
38 3300002067 JGI24735J21928_10005739 JGI24735J21928_100057395 245
39 3300002067 JGI24735J21928_10033847 JGI24735J21928_100338472 245
40 3300002075 JGI24738J21930_10000915 JGI24738J21930_100009152 245
41 3300002075 JGI24738J21930_10001216 JGI24738J21930_100012168 245
42 3300002075 JGI24738J21930_10004560 JGI24738J21930_100045604 245
43 3300003316 rootH1_10085885 rootH1_100858851 245
44 3300005289 Ga0065704_10009711 Ga0065704_100097114 245
45 3300005289 Ga0065704_10167610 Ga0065704_101676102 245
46 3300005295 Ga0065707_10026699 Ga0065707_100266992 245
47 3300005335 Ga0070666_10008340 Ga0070666_100083404 245
48 3300005339 Ga0070660_100182440 Ga0070660_1001824402 245
49 3300005339 Ga0070660_100484782 Ga0070660_1004847821 245
50 3300005344 Ga0070661_100027773 Ga0070661_1000277732 245
51 3300005344 Ga0070661_100039768 Ga0070661_1000397683 245
52 3300005344 Ga0070661_100095028 Ga0070661_1000950281 245
53 3300005347 Ga0070668_100000099 Ga0070668_10000009943 245
54 3300005347 Ga0070668_100056411 Ga0070668_1000564112 245
55 3300005353 Ga0070669_100075689 Ga0070669_1000756891 245
56 3300005355 Ga0070671_100039990 Ga0070671_1000399905 245
57 3300005355 Ga0070671_100222828 Ga0070671_1002228282 245
58 3300005356 Ga0070674_100041060 Ga0070674_1000410605 245
59 3300005366 Ga0070659_100434792 Ga0070659_1004347922 245
60 3300005367 Ga0070667_100000038 Ga0070667_100000038170 245
61 3300005367 Ga0070667_100370000 Ga0070667_1003700001 245
62 3300005455 Ga0070663_100001752 Ga0070663_1000017528 245
63 3300005455 Ga0070663_100173867 Ga0070663_1001738672 245
64 3300005457 Ga0070662_100026039 Ga0070662_1000260394 245
65 3300005457 Ga0070662_100040636 Ga0070662_1000406362 245
66 3300005457 Ga0070662_100120192 Ga0070662_1001201922 245
67 3300005457 Ga0070662_100216780 Ga0070662_1002167802 245
68 3300005539 Ga0068853_100000230 Ga0068853_10000023034 245
69 3300005539 Ga0068853_100002373 Ga0068853_1000023735 245
70 3300005539 Ga0068853_100097855 Ga0068853_1000978552 245
71 3300005539 Ga0068853_100152545 Ga0068853_1001525452 245
72 3300005539 Ga0068853_100293044 Ga0068853_1002930441 245
73 3300005543 Ga0070672_100044719 Ga0070672_1000447193 245
74 3300005548 Ga0070665_100026049 Ga0070665_1000260495 245
75 3300005563 Ga0068855_100141296 Ga0068855_1001412962 245
76 3300005577 Ga0068857_100024942 Ga0068857_1000249425 245
77 3300005577 Ga0068857_100048655 Ga0068857_1000486554 245
78 3300005577 Ga0068857_100051703 Ga0068857_1000517033 245
79 3300005577 Ga0068857_100073771 Ga0068857_1000737712 245
80 3300005577 Ga0068857_100174387 Ga0068857_1001743872 245
81 3300005577 Ga0068857_100337301 Ga0068857_1003373011 245
82 3300005578 Ga0068854_100006628 Ga0068854_1000066289 245
83 3300005578 Ga0068854_100073414 Ga0068854_1000734141 245
84 3300005614 Ga0068856_100028579 Ga0068856_1000285797 245
85 3300005614 Ga0068856_100558981 Ga0068856_1005589812 245
86 3300005616 Ga0068852_100074779 Ga0068852_1000747792 245
87 3300005616 Ga0068852_100119216 Ga0068852_1001192163 245
88 3300005616 Ga0068852_100244708 Ga0068852_1002447082 245
89 3300005616 Ga0068852_100413983 Ga0068852_1004139832 245
90 3300005616 Ga0068852_100509378 Ga0068852_1005093782 245
91 3300005719 Ga0068861_100459105 Ga0068861_1004591052 245
92 3300005841 Ga0068863_100000255 Ga0068863_10000025545 245
93 3300005843 Ga0068860_100049956 Ga0068860_1000499565 245
94 3300006042 Ga0075368_10000134 Ga0075368_100001348 245
95 3300006178 Ga0075367_10001817 Ga0075367_100018179 245
96 3300006195 Ga0075366_10202397 Ga0075366_102023972 245
97 3300009093 Ga0105240_10062505 Ga0105240_100625053 245
98 3300009093 Ga0105240_10142245 Ga0105240_101422452 245
99 3300009093 Ga0105240_10655886 Ga0105240_106558862 245
100 3300009093 Ga0105240_10859292 Ga0105240_108592922 245
101 3300009174 Ga0105241_10003710 Ga0105241_100037109 245
102 3300009174 Ga0105241_10526220 Ga0105241_105262202 245
103 3300009545 Ga0105237_10057301 Ga0105237_100573013 245
104 3300009545 Ga0105237_10317253 Ga0105237_103172531 245
105 3300009551 Ga0105238_10314716 Ga0105238_103147162 245
106 3300009553 Ga0105249_10025940 Ga0105249_100259402 245
107 3300009978 Ga0105148_100414 Ga0105148_1004141 245
108 3300010375 Ga0105239_10108215 Ga0105239_101082152 245
109 3300010375 Ga0105239_10543784 Ga0105239_105437842 245
110 3300013100 Ga0157373_10140042 Ga0157373_101400422 245
111 3300013102 Ga0157371_10263281 Ga0157371_102632812 245
112 3300013104 Ga0157370_10001856 Ga0157370_1000185623 245
113 3300013104 Ga0157370_10057631 Ga0157370_100576314 245
114 3300013105 Ga0157369_10149816 Ga0157369_101498164 245
115 3300013105 Ga0157369_10491355 Ga0157369_104913552 245
116 3300013105 Ga0157369_10924954 Ga0157369_109249542 245
117 3300013105 Ga0157369_11002842 Ga0157369_110028421 245
118 3300013307 Ga0157372_10032282 Ga0157372_100322826 245
119 3300013307 Ga0157372_10090364 Ga0157372_100903644 245
120 3300013307 Ga0157372_10123785 Ga0157372_101237854 245
121 3300014326 Ga0157380_10000086 Ga0157380_1000008635 245
122 3300017792 Ga0163161_10008263 Ga0163161_100082636 245
123 3300021377 Ga0213874_10003979 Ga0213874_100039792 245
124 3300025229 Ga0209147_100452 Ga0209147_1004522 245
125 3300025321 Ga0207656_10117934 Ga0207656_101179342 245
126 3300025903 Ga0207680_10005487 Ga0207680_100054874 245
127 3300025904 Ga0207647_10000192 Ga0207647_1000019219 245
128 3300025904 Ga0207647_10002429 Ga0207647_1000242913 245
129 3300025904 Ga0207647_10007383 Ga0207647_100073832 245
130 3300025904 Ga0207647_10093663 Ga0207647_100936631 245
131 3300025911 Ga0207654_10022885 Ga0207654_100228852 245
132 3300025911 Ga0207654_10157818 Ga0207654_101578182 245
133 3300025913 Ga0207695_10012713 Ga0207695_100127138 245
134 3300025913 Ga0207695_10124849 Ga0207695_101248494 245
135 3300025913 Ga0207695_10225107 Ga0207695_102251072 245
136 3300025914 Ga0207671_10000479 Ga0207671_100004798 245
137 3300025914 Ga0207671_10020643 Ga0207671_100206434 245
138 3300025919 Ga0207657_10003878 Ga0207657_1000387814 245
139 3300025919 Ga0207657_10023256 Ga0207657_100232562 245
140 3300025920 Ga0207649_10166068 Ga0207649_101660682 245
141 3300025923 Ga0207681_10007249 Ga0207681_100072491 245
142 3300025924 Ga0207694_10014827 Ga0207694_100148276 245
143 3300025924 Ga0207694_10111527 Ga0207694_101115273 245
144 3300025924 Ga0207694_10165651 Ga0207694_101656512 245
145 3300025924 Ga0207694_10226329 Ga0207694_102263292 245
146 3300025931 Ga0207644_10126741 Ga0207644_101267412 245
147 3300025933 Ga0207706_10003402 Ga0207706_100034024 245
148 3300025933 Ga0207706_10009534 Ga0207706_100095343 245
149 3300025933 Ga0207706_10023320 Ga0207706_100233207 245
150 3300025933 Ga0207706_10027933 Ga0207706_100279332 245
151 3300025933 Ga0207706_10045624 Ga0207706_100456242 245
152 3300025933 Ga0207706_10060996 Ga0207706_100609963 245
153 3300025933 Ga0207706_10120092 Ga0207706_101200922 245
154 3300025940 Ga0207691_10075147 Ga0207691_100751473 245
155 3300025949 Ga0207667_10052109 Ga0207667_100521092 245
156 3300025949 Ga0207667_10416987 Ga0207667_104169872 245
157 3300025961 Ga0207712_10012890 Ga0207712_100128902 245
158 3300025972 Ga0207668_10000420 Ga0207668_100004204 245
159 3300025972 Ga0207668_10280420 Ga0207668_102804202 245
160 3300025981 Ga0207640_10014222 Ga0207640_100142222 245
161 3300025981 Ga0207640_10023676 Ga0207640_100236765 245
162 3300025981 Ga0207640_10661916 Ga0207640_106619162 245
163 3300025986 Ga0207658_10000029 Ga0207658_10000029168 245
164 3300025986 Ga0207658_10313394 Ga0207658_103133942 245
165 3300026041 Ga0207639_10003124 Ga0207639_1000312410 245
166 3300026041 Ga0207639_10008528 Ga0207639_100085285 245
167 3300026041 Ga0207639_10020019 Ga0207639_100200192 245
168 3300026041 Ga0207639_10127162 Ga0207639_101271623 245
169 3300026067 Ga0207678_10006156 Ga0207678_100061565 245
170 3300026067 Ga0207678_10018100 Ga0207678_100181003 245
171 3300026067 Ga0207678_10150836 Ga0207678_101508362 245
172 3300026067 Ga0207678_10549514 Ga0207678_105495141 245
173 3300026078 Ga0207702_10005614 Ga0207702_100056147 245
174 3300026078 Ga0207702_10007410 Ga0207702_100074109 245
175 3300026088 Ga0207641_10000343 Ga0207641_1000034344 245
176 3300026088 Ga0207641_10000580 Ga0207641_1000058023 245
177 3300026116 Ga0207674_10011479 Ga0207674_1001147912 245
178 3300026116 Ga0207674_10031213 Ga0207674_100312136 245
179 3300026116 Ga0207674_10049158 Ga0207674_100491585 245
180 3300026116 Ga0207674_10076713 Ga0207674_100767134 245
181 3300026116 Ga0207674_10083946 Ga0207674_100839462 245
182 3300026116 Ga0207674_10093926 Ga0207674_100939262 245
183 3300026142 Ga0207698_10001453 Ga0207698_1000145311 245
184 3300026142 Ga0207698_10027628 Ga0207698_100276283 245
185 3300026142 Ga0207698_10040072 Ga0207698_100400722 245
186 3300026142 Ga0207698_10190741 Ga0207698_101907412 245
187 3300026142 Ga0207698_10258984 Ga0207698_102589842 245
188 3300027866 Ga0209813_10000026 Ga0209813_1000002649 245
189 3300028379 Ga0268266_10012074 Ga0268266_100120744 245
190 3300028381 Ga0268264_10025247 Ga0268264_100252474 245
191 3300031239 Ga0265328_10007704 Ga0265328_100077042 245
192 3300031548 Ga0307408_100083388 Ga0307408_1000833882 245
193 3300031548 Ga0307408_100276527 Ga0307408_1002765272 245
194 3300031731 Ga0307405_10022636 Ga0307405_100226363 245
195 3300031824 Ga0307413_10015854 Ga0307413_100158543 245
196 3300031852 Ga0307410_10013845 Ga0307410_100138454 245
197 3300031852 Ga0307410_10218222 Ga0307410_102182222 245
198 3300031901 Ga0307406_10171678 Ga0307406_101716782 245
199 3300031901 Ga0307406_10209982 Ga0307406_102099822 245
200 3300031903 Ga0307407_10113581 Ga0307407_101135812 245
201 3300031911 Ga0307412_10039057 Ga0307412_100390572 245
202 3300031911 Ga0307412_10119277 Ga0307412_101192772 245
203 3300031911 Ga0307412_10174029 Ga0307412_101740292 245
204 3300031911 Ga0307412_10289573 Ga0307412_102895732 245
205 3300031911 Ga0307412_10420753 Ga0307412_104207531 245
206 3300031995 Ga0307409_100152528 Ga0307409_1001525282 245
207 3300031995 Ga0307409_100296432 Ga0307409_1002964321 245
208 3300031995 Ga0307409_100609081 Ga0307409_1006090811 245
209 3300032002 Ga0307416_100035887 Ga0307416_1000358873 245
210 3300032002 Ga0307416_100889808 Ga0307416_1008898082 245
211 3300032004 Ga0307414_10000936 Ga0307414_100009363 245
212 3300032004 Ga0307414_10032966 Ga0307414_100329663 245
213 3300032004 Ga0307414_10241685 Ga0307414_102416852 245
214 3300032126 Ga0307415_100012288 Ga0307415_1000122883 245
215 3300037471 Ga0395905_0167545 Ga0395905_0167545_539_1279 245
216 3300037471 Ga0395905_0294156 Ga0395905_0294156_298_1035 245
217 3300038443 Ga0395901_0148077 Ga0395901_0148077_1459_2202 245
218 3300038443 Ga0395901_0565210 Ga0395901_0565210_99_839 245
219 3300042005 Ga0439448_0000458 Ga0439448_0000458_6477_7217 245
220 3300042005 Ga0439448_0006784 Ga0439448_0006784_1493_2233 245
221 3300042005 Ga0439448_0074991 Ga0439448_0074991_349_1089 245
222 3300042005 Ga0439448_0118297 Ga0439448_0118297_64_801 245
223 3300042012 Ga0439455_0000272 Ga0439455_0000272_2302_3042 245
224 3300042012 Ga0439455_0001684 Ga0439455_0001684_2940_3680 245
225 3300042157 Ga0439458_0000004 Ga0439458_0000004_27118_27858 245
226 3300042157 Ga0439458_0000749 Ga0439458_0000749_4871_5611 245
227 3300042157 Ga0439458_0006244 Ga0439458_0006244_1522_2262 245
228 3300044683 Ga0466965_0049829 Ga0466965_0049829_535_1272 245
229 3300044693 Ga0466961_0145149 Ga0466961_0145149_683_1420 245
230 3300044694 Ga0466963_0000856 Ga0466963_0000856_2267_3004 245
231 3300044706 Ga0466964_0027352 Ga0466964_0027352_937_1674 245
232 3300044719 Ga0466971_0017093 Ga0466971_0017093_439_1176 245
233 3300044735 Ga0466968_0048632 Ga0466968_0048632_572_1309 245
234 3300044765 Ga0466970_0018389 Ga0466970_0018389_2714_3451 245
235 3300045049 Ga0466959_0119993 Ga0466959_0119993_266_1003 245
236 3300045836 Ga0466958_0000484 Ga0466958_0000484_5086_5823 245
237 3300045976 Ga0466967_0184985 Ga0466967_0184985_240_977 245
238 3300045976 Ga0466967_0296227 Ga0466967_0296227_57_794 245
239 3300046452 Ga0495617_011259 Ga0495617_011259_2145_2900 245
240 3300046453 Ga0495627_000114 Ga0495627_000114_54050_54805 245
241 3300046453 Ga0495627_008863 Ga0495627_008863_1332_2087 245
242 3300046460 Ga0495638_0000016 Ga0495638_0000016_350049_350795 245
243 3300046460 Ga0495638_0260959 Ga0495638_0260959_42_800 245
244 3300046471 Ga0495650_0006895 Ga0495650_0006895_1279_2040 245
245 3300046471 Ga0495650_0052378 Ga0495650_0052378_134_874 245
246 3300046491 Ga0495584_0016538 Ga0495584_0016538_1844_2605 245
247 3300046506 Ga0495583_0000094 Ga0495583_0000094_105600_106346 245
248 3300046507 Ga0495606_0032322 Ga0495606_0032322_767_1504 245
249 3300046512 Ga0495610_0000068 Ga0495610_0000068_90724_91479 245
250 3300046513 Ga0495616_0000187 Ga0495616_0000187_32513_33253 245
251 3300046519 Ga0495632_0000007 Ga0495632_0000007_40751_41512 245
252 3300046519 Ga0495632_0000132 Ga0495632_0000132_45292_46038 245
253 3300046520 Ga0495637_0001444 Ga0495637_0001444_1986_2747 245
254 3300046522 Ga0495643_0000005 Ga0495643_0000005_125909_126670 245
255 3300046524 Ga0495648_0000013 Ga0495648_0000013_45711_46457 245
256 3300046524 Ga0495648_0005335 Ga0495648_0005335_6871_7626 245
257 3300046524 Ga0495648_0190686 Ga0495648_0190686_187_948 245
258 3300046525 Ga0495663_0000005 Ga0495663_0000005_39770_40531 245
259 3300046558 Ga0495633_0000550 Ga0495633_0000550_14398_15159 245
260 3300046558 Ga0495633_0003251 Ga0495633_0003251_4669_5430 245
261 3300046558 Ga0495633_0082944 Ga0495633_0082944_218_979 245
262 3300046616 Ga0495668_0006493 Ga0495668_0006493_3504_4244 245
263 3300046616 Ga0495668_0210621 Ga0495668_0210621_314_1054 245
264 3300046660 Ga0495625_0072587 Ga0495625_0072587_29_769 245
265 3300046692 Ga0495671_0000007 Ga0495671_0000007_125909_126670 245
266 3300046692 Ga0495671_0000018 Ga0495671_0000018_47200_47946 245
267 3300047469 Ga0495673_0000029 Ga0495673_0000029_411480_412226 245
268 3300047469 Ga0495673_0012017 Ga0495673_0012017_859_1596 245
269 3300047470 Ga0495681_0000055 Ga0495681_0000055_52267_53022 245
270 3300047470 Ga0495681_0021318 Ga0495681_0021318_720_1481 245
271 3300047470 Ga0495681_0099997 Ga0495681_0099997_125_880 245
272 3300047472 Ga0495686_0000149 Ga0495686_0000149_17681_18418 245
273 3300047472 Ga0495686_0050359 Ga0495686_0050359_1202_1957 245
274 3300047472 Ga0495686_0142444 Ga0495686_0142444_444_1181 245
275 3300048904 Ga0496101_0018241 Ga0496101_0018241_3253_3990 245
276 3300048905 Ga0496102_0007238 Ga0496102_0007238_7817_8554 245
277 3300048906 Ga0496103_0000910 Ga0496103_0000910_16208_16945 245
278 3300048906 Ga0496103_0041975 Ga0496103_0041975_654_1391 245
279 3300048907 Ga0496104_0000040 Ga0496104_0000040_67057_67794 245
280 3300048907 Ga0496104_0008894 Ga0496104_0008894_6838_7575 245
281 3300048907 Ga0496104_0032375 Ga0496104_0032375_1761_2498 245
282 3300048907 Ga0496104_0114614 Ga0496104_0114614_1250_1987 245
283 3300048908 Ga0496105_0000082 Ga0496105_0000082_11927_12664 245
284 3300048908 Ga0496105_0011434 Ga0496105_0011434_5962_6699 245
285 3300048908 Ga0496105_0027207 Ga0496105_0027207_3145_3882 245
286 3300048908 Ga0496105_0096239 Ga0496105_0096239_1634_2371 245
287 3300048910 Ga0496107_0061366 Ga0496107_0061366_1969_2706 245
288 3300048911 Ga0496108_0001477 Ga0496108_0001477_3592_4335 245
289 3300048912 Ga0496109_0084645 Ga0496109_0084645_887_1666 245
290 3300048913 Ga0496110_0033544 Ga0496110_0033544_2278_3015 245
291 3300048914 Ga0496111_0064126 Ga0496111_0064126_1374_2111 245
292 3300048915 Ga0496112_0018129 Ga0496112_0018129_3480_4217 245
293 3300048915 Ga0496112_0413626 Ga0496112_0413626_273_1052 245
294 3300048916 Ga0496113_0012570 Ga0496113_0012570_1878_2615 245
295 3300048916 Ga0496113_0113495 Ga0496113_0113495_539_1318 245
296 3300048918 Ga0496115_0088700 Ga0496115_0088700_495_1232 245
297 3300048919 Ga0496116_0031777 Ga0496116_0031777_1859_2611 245
298 3300048920 Ga0496117_0011777 Ga0496117_0011777_1123_1875 245
299 3300048920 Ga0496117_0019957 Ga0496117_0019957_920_1657 245
300 3300048920 Ga0496117_0030151 Ga0496117_0030151_2524_3261 245
301 3300048920 Ga0496117_0203353 Ga0496117_0203353_244_981 245
302 3300048921 Ga0496118_0007759 Ga0496118_0007759_1224_1961 245
303 3300048921 Ga0496118_0027889 Ga0496118_0027889_3156_3893 245
304 3300048921 Ga0496118_0049734 Ga0496118_0049734_1897_2634 245
305 3300048921 Ga0496118_0072503 Ga0496118_0072503_966_1718 245
306 3300048921 Ga0496118_0164823 Ga0496118_0164823_383_1141 245
307 3300048922 Ga0496119_0007465 Ga0496119_0007465_7703_8440 245
308 3300048922 Ga0496119_0069287 Ga0496119_0069287_476_1213 245
309 3300048922 Ga0496119_0118723 Ga0496119_0118723_319_1071 245
310 3300048924 Ga0496121_0000587 Ga0496121_0000587_2327_3070 245
311 3300048924 Ga0496121_0003164 Ga0496121_0003164_645_1394 245
312 3300048924 Ga0496121_0133380 Ga0496121_0133380_424_1170 245
313 3300048924 Ga0496121_0265070 Ga0496121_0265070_253_1011 245
314 3300048925 Ga0496122_0040350 Ga0496122_0040350_579_1337 245
315 3300048926 Ga0496123_0039220 Ga0496123_0039220_167_925 245
316 3300048927 Ga0496124_0016615 Ga0496124_0016615_5314_6072 245
317 3300048927 Ga0496124_0046079 Ga0496124_0046079_2913_3665 245
318 3300048928 Ga0496125_0032182 Ga0496125_0032182_1068_1847 245
319 3300048929 Ga0496126_0009794 Ga0496126_0009794_193_942 245
320 3300048929 Ga0496126_0014807 Ga0496126_0014807_2682_3440 245
321 3300048929 Ga0496126_0115490 Ga0496126_0115490_242_1000 245
322 3300049459 Ga0495678_048322 Ga0495678_048322_838_1593 245
323 3300049571 Ga0501034_0055344 Ga0501034_0055344_112_849 245
324 3300049572 Ga0501036_0304397 Ga0501036_0304397_529_1266 245
325 3300049574 Ga0501038_0013511 Ga0501038_0013511_4970_5713 245
326 3300049581 Ga0501047_0187912 Ga0501047_0187912_420_1157 245
327 3300049581 Ga0501047_0375997 Ga0501047_0375997_485_1222 245
328 3300049585 Ga0501069_0075050 Ga0501069_0075050_1100_1837 245
329 3300049586 Ga0501070_0293423 Ga0501070_0293423_163_900 245
330 3300049589 Ga0501073_0062187 Ga0501073_0062187_619_1356 245
331 3300049590 Ga0501074_0028048 Ga0501074_0028048_103_840 245
332 3300049663 Ga0501223_000002 Ga0501223_000002_137373_138119 245
333 3300049705 Ga0501225_0000716 Ga0501225_0000716_8772_9518 245
334 3300049741 Ga0501079_0514645 Ga0501079_0514645_144_881 245
335 3300049744 Ga0501083_0012177 Ga0501083_0012177_1811_2548 245
336 3300049744 Ga0501083_0031911 Ga0501083_0031911_2806_3543 245
337 3300049822 Ga0501035_0075708 Ga0501035_0075708_1982_2719 245
338 3300050493 nmdc:mga0k408_203989_c1 nmdc:mga0k408_203989_c1_168_908 245
339 3300050494 nmdc:mga06z11_19_c1 nmdc:mga06z11_19_c1_61529_62287 245
340 3300050495 nmdc:mga04h51_14_c1 nmdc:mga04h51_14_c1_23736_24494 245
341 3300053087 Ga0500643_000488 Ga0500643_000488_4558_5304 245
342 3300053087 Ga0500643_002844 Ga0500643_002844_4680_5444 245
343 3300053087 Ga0500643_007079 Ga0500643_007079_1145_1885 245
344 3300053087 Ga0500643_010700 Ga0500643_010700_466_1215 245
345 3300053104 Ga0500556_0000013 Ga0500556_0000013_64159_64899 245
346 3300053108 Ga0500562_004364 Ga0500562_004364_2803_3558 245
347 3300053108 Ga0500562_022818 Ga0500562_022818_392_1132 245
348 3300053121 Ga0500607_001592 Ga0500607_001592_8166_8915 245
349 3300053122 Ga0500608_062435 Ga0500608_062435_543_1283 245
350 3300053130 Ga0500642_0000002 Ga0500642_0000002_292515_293255 245
351 3300053136 Ga0500559_0000841 Ga0500559_0000841_16259_17005 245
352 3300053136 Ga0500559_0045593 Ga0500559_0045593_722_1462 245
353 3300053151 Ga0500604_0004870 Ga0500604_0004870_2769_3509 245
354 3300053157 Ga0500624_000042 Ga0500624_000042_55704_56468 245
355 3300053158 Ga0500627_0002094 Ga0500627_0002094_2492_3232 245
356 3300053730 Ga0500645_000105 Ga0500645_000105_31509_32249 245
357 3300055283 Ga0500661_000036 Ga0500661_000036_15324_16070 245
358 3300060353 Ga0501082_0077662 Ga0501082_0077662_345_1082 245
359 3300060353 Ga0501082_0786564 Ga0501082_0786564_37_774 245
360 iso_pu_bacteria 2919709256 2919712201 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

144

250

0.99

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

7

105

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9554 2 245
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9528 2 245
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9441 2 245
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9227 2 245
6sgb-assembly1.cif.gz_FB mt-ssu assemblosome of trypanosoma brucei 0.9 2 245
ID Description Score Start End Superfamily
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9586 2 105 3.30.70.580
af_Q2FW37_1_104_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9556 3 106 3.30.70.580
af_Q2QWH9_69_188_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9427 2 104 3.30.70.580
af_Q54RR6_2_123_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9403 1 104 3.30.70.580
af_Q2FW37_1_104_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.938 3 106 3.30.70.580
ID Description Score Start End GO Terms
AF-A0A2N3DTC3-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9989 1 109 GO:0003723
GO:0031119
GO:0160147
AF-A0A382NJ58-F1-model_v4 Pseudouridine synthase I TruA alpha/beta domain-containing protein 0.9824 3 130 GO:0003723
GO:0009982
GO:0031119
AF-A0A3D5ZPF6-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9824 3 105 GO:0003723
GO:0031119
GO:0160147
AF-A0A2N8FN91-F1-model_v4 deleted 0.9817 14 134
AF-A0A7T3QVS8-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9811 26 150 GO:0003723
GO:0009982
GO:0031119
GO:0140098

Feature Viewer

pLDDT pTM Quality
89.66 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map