F421823

General Info

Members Datasets Scaffolds Average Seq Length
360 233 720 171

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10149756|Ga0081455_101497563
Length 185
Sequence MTARKVTTMTTTEARPGLVPNFDDEAEAGRKIAIICSKGNLDMAYPGLIIANSALGEGVETHLFFTFWGFDMIVKSRMNDLQFSPVGNTAMHPIGDAHIPQALTPLPGMTAMATHMLKKQIADLGVPEVPEFLDQIVAAGGHLWACRMSADMMKLTESDLRDDVEGIISAADFIELTNGAQLLFI

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
50 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
51 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
52 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
100 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
115 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
224 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
230 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
231 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
232 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
233 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 3.61
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.94
Nodule 0.28
Rhizoplane 9.17
Rhizosphere 79.44
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10149756 3300005937 Bacteria 1800
2 Ga0070658_10009082 3300005327 Bacteria 7996
3 Ga0070658_10075138 3300005327 Bacteria 2772
4 Ga0070658_10523878 3300005327 Bacteria 1025
5 Ga0070658_10600793 3300005327 Bacteria 953
6 Ga0070683_100150550 3300005329 Bacteria 2206
7 Ga0068869_100060306 3300005334 Bacteria 2780
8 Ga0070680_100029215 3300005336 Bacteria 4428
9 Ga0068868_100019087 3300005338 Bacteria 5134
10 Ga0068868_100691539 3300005338 Bacteria 912
11 Ga0070660_100075812 3300005339 Bacteria 2634
12 Ga0070660_100106574 3300005339 Bacteria 2226
13 Ga0070660_100380121 3300005339 Bacteria 1166
14 Ga0070660_100431592 3300005339 Bacteria 1092
15 Ga0070661_100635336 3300005344 Bacteria 865
16 Ga0070692_10387408 3300005345 Bacteria 879
17 Ga0070671_100871570 3300005355 Bacteria 786
18 Ga0070659_100001443 3300005366 Bacteria 17145
19 Ga0070667_100210307 3300005367 Bacteria 1729
20 Ga0070667_100631712 3300005367 Bacteria 988
21 Ga0070709_10096995 3300005434 Bacteria 1956
22 Ga0070714_100596048 3300005435 Bacteria 1061
23 Ga0070714_101521217 3300005435 Bacteria 654
24 Ga0070713_100030807 3300005436 Bacteria 4266
25 Ga0070713_100181219 3300005436 Bacteria 1893
26 Ga0070711_100104805 3300005439 Bacteria 2064
27 Ga0070663_100517969 3300005455 Bacteria 993
28 Ga0070681_10053244 3300005458 Bacteria 4033
29 Ga0070681_10425465 3300005458 Bacteria 1240
30 Ga0070681_10452753 3300005458 Bacteria 1196
31 Ga0070699_100856783 3300005518 Bacteria 832
32 Ga0070679_100005652 3300005530 Bacteria 11588
33 Ga0070684_101100070 3300005535 Bacteria 747
34 Ga0070672_100159254 3300005543 Bacteria 1872
35 Ga0070665_100003401 3300005548 Bacteria 17006
36 Ga0070665_100558655 3300005548 Bacteria 1157
37 Ga0070664_101085417 3300005564 Bacteria 754
38 Ga0068857_100288388 3300005577 Bacteria 1511
39 Ga0068856_100306830 3300005614 Bacteria 1605
40 Ga0070717_10027559 3300006028 Bacteria 4542
41 Ga0070717_11142773 3300006028 Bacteria 709
42 Ga0075365_10005199 3300006038 Bacteria 6999
43 Ga0075365_10278998 3300006038 Bacteria 1176
44 Ga0075365_10290266 3300006038 Bacteria 1151
45 Ga0075368_10002411 3300006042 Bacteria 6095
46 Ga0075363_100034873 3300006048 Bacteria 2629
47 Ga0075364_10039196 3300006051 Bacteria 3071
48 Ga0070712_100018256 3300006175 Bacteria 4553
49 Ga0075362_10029121 3300006177 Bacteria 2377
50 Ga0075367_10015879 3300006178 Bacteria 4102
51 Ga0075370_10013813 3300006353 Bacteria 4296
52 Ga0075428_100019317 3300006844 Bacteria 7542
53 Ga0075430_100006031 3300006846 Bacteria 10219
54 Ga0075431_100017681 3300006847 Bacteria 7249
55 Ga0075429_100011046 3300006880 Bacteria 7816
56 Ga0105245_10798049 3300009098 Bacteria 982
57 Ga0105245_11110660 3300009098 Bacteria 837
58 Ga0105245_11303586 3300009098 Bacteria 775
59 Ga0114129_10476115 3300009147 Bacteria 1634
60 Ga0105243_10236018 3300009148 Bacteria 1625
61 Ga0105242_10259989 3300009176 Bacteria 1568
62 Ga0105248_10175001 3300009177 Bacteria 2419
63 Ga0105248_10781826 3300009177 Bacteria 1077
64 Ga0105237_10270118 3300009545 Bacteria 1703
65 Ga0105237_11791149 3300009545 Bacteria 622
66 Ga0105238_11853958 3300009551 Bacteria 635
67 Ga0105239_10251190 3300010375 Bacteria 1986
68 Ga0105239_10512918 3300010375 Bacteria 1364
69 Ga0105239_11136972 3300010375 Bacteria 899
70 Ga0105239_11764539 3300010375 Bacteria 717
71 Ga0105246_11395547 3300011119 Bacteria 653
72 Ga0157328_1000834 3300012478 Bacteria 1205
73 Ga0157322_1005696 3300012490 Bacteria 865
74 Ga0157319_1000371 3300012497 Bacteria 2082
75 Ga0157339_1008299 3300012505 Bacteria 893
76 Ga0157370_10225706 3300013104 Bacteria 1734
77 Ga0157370_10831659 3300013104 Bacteria 840
78 Ga0157369_10000550 3300013105 Bacteria 49206
79 Ga0157369_10066401 3300013105 Bacteria 3881
80 Ga0157369_10262823 3300013105 Bacteria 1800
81 Ga0157369_10909412 3300013105 Bacteria 902
82 Ga0157374_10315489 3300013296 Bacteria 1548
83 Ga0157374_10433097 3300013296 Bacteria 1315
84 Ga0157378_10057477 3300013297 Bacteria 3467
85 Ga0163162_10529215 3300013306 Bacteria 1308
86 Ga0163162_10596831 3300013306 Bacteria 1231
87 Ga0157372_10234092 3300013307 Bacteria 2130
88 Ga0157372_12551599 3300013307 Bacteria 587
89 Ga0157375_10057605 3300013308 Bacteria 3841
90 Ga0163163_10079878 3300014325 Bacteria 3269
91 Ga0163163_10163028 3300014325 Bacteria 2275
92 Ga0163163_11166392 3300014325 Bacteria 833
93 Ga0163163_11781756 3300014325 Bacteria 676
94 Ga0157379_10309887 3300014968 Bacteria 1440
95 Ga0157376_11006592 3300014969 Bacteria 856
96 Ga0206356_11280563 3300020070 Bacteria 666
97 Ga0207647_10088955 3300025904 Bacteria 1843
98 Ga0207647_10113611 3300025904 Bacteria 1600
99 Ga0207647_10206081 3300025904 Bacteria 1137
100 Ga0207699_10103371 3300025906 Bacteria 1812
101 Ga0207705_10027475 3300025909 Bacteria 4058
102 Ga0207705_10065331 3300025909 Bacteria 2630
103 Ga0207705_10139043 3300025909 Bacteria 1812
104 Ga0207705_11008273 3300025909 Bacteria 643
105 Ga0207707_10405679 3300025912 Bacteria 1170
106 Ga0207707_10678828 3300025912 Bacteria 866
107 Ga0207671_10112917 3300025914 Bacteria 2069
108 Ga0207693_10033545 3300025915 Bacteria 4051
109 Ga0207663_10139685 3300025916 Bacteria 1686
110 Ga0207660_10171543 3300025917 Bacteria 1679
111 Ga0207657_10080158 3300025919 Bacteria 2745
112 Ga0207657_10114312 3300025919 Bacteria 2226
113 Ga0207657_10229364 3300025919 Bacteria 1485
114 Ga0207649_10484055 3300025920 Bacteria 939
115 Ga0207649_10502388 3300025920 Bacteria 922
116 Ga0207652_10019238 3300025921 Bacteria 5613
117 Ga0207700_10060834 3300025928 Bacteria 2861
118 Ga0207700_10442487 3300025928 Bacteria 1144
119 Ga0207664_10119560 3300025929 Bacteria 2203
120 Ga0207664_10181274 3300025929 Bacteria 1808
121 Ga0207690_10000226 3300025932 Bacteria 42329
122 Ga0207706_10080131 3300025933 Bacteria 2871
123 Ga0207709_10115018 3300025935 Bacteria 1806
124 Ga0207711_10842726 3300025941 Bacteria 853
125 Ga0207689_10209422 3300025942 Bacteria 1610
126 Ga0207661_10053558 3300025944 Bacteria 3229
127 Ga0207661_10116498 3300025944 Bacteria 2268
128 Ga0207679_10133290 3300025945 Bacteria 1996
129 Ga0207658_10282999 3300025986 Bacteria 1422
130 Ga0207677_10022341 3300026023 Bacteria 3887
131 Ga0207677_11316643 3300026023 Bacteria 664
132 Ga0207678_10481004 3300026067 Bacteria 1081
133 Ga0207702_10068685 3300026078 Bacteria 3045
134 Ga0207674_11561543 3300026116 Bacteria 629
135 Ga0209813_10010222 3300027866 Bacteria 2420
136 Ga0268266_10003700 3300028379 Bacteria 15076
137 Ga0268266_10765631 3300028379 Bacteria 932
138 Ga0265319_1052411 3300028563 Bacteria 1343
139 Ga0265336_10000891 3300028666 Bacteria 15282
140 Ga0307515_10039073 3300028794 Bacteria 7564
141 Ga0307515_10176183 3300028794 Bacteria 2108
142 Ga0265338_10121886 3300028800 Bacteria 2077
143 Ga0307512_10029077 3300030522 Bacteria 4835
144 Ga0307509_10046433 3300031507 Bacteria 4676
145 Ga0265313_10282744 3300031595 Bacteria 670
146 Ga0307508_10103327 3300031616 Bacteria 2446
147 Ga0307508_10122011 3300031616 Bacteria 2209
148 Ga0307514_10182969 3300031649 Bacteria 1348
149 Ga0316579_10005133 3300031691 Bacteria 5258
150 Ga0316576_10000524 3300031727 Bacteria 17972
151 Ga0316576_10000610 3300031727 Bacteria 17181
152 Ga0316576_10003622 3300031727 Bacteria 9108
153 Ga0316576_10067426 3300031727 Bacteria 2634
154 Ga0316576_10174971 3300031727 Bacteria 1619
155 Ga0316576_10797860 3300031727 Bacteria 680
156 Ga0316578_10003501 3300031728 Bacteria 7203
157 Ga0316578_10055040 3300031728 Bacteria 2334
158 Ga0316578_10381818 3300031728 Bacteria 836
159 Ga0307516_10006695 3300031730 Bacteria 13464
160 Ga0307516_10125642 3300031730 Bacteria 2350
161 Ga0307516_10240524 3300031730 Bacteria 1509
162 Ga0307405_10161695 3300031731 Bacteria 1587
163 Ga0316577_10564915 3300031733 Bacteria 647
164 Ga0307410_10112049 3300031852 Bacteria 1975
165 Ga0307410_10682366 3300031852 Bacteria 864
166 Ga0307406_10249173 3300031901 Bacteria 1337
167 Ga0307407_10078474 3300031903 Bacteria 1989
168 Ga0307409_100157052 3300031995 Bacteria 1983
169 Ga0307409_100232621 3300031995 Bacteria 1672
170 Ga0307409_101033415 3300031995 Bacteria 841
171 Ga0307416_100247013 3300032002 Bacteria 1734
172 Ga0307414_11456975 3300032004 Bacteria 637
173 Ga0307411_10334869 3300032005 Bacteria 1228
174 Ga0307415_100541373 3300032126 Bacteria 1026
175 Ga0316583_10001843 3300032133 Bacteria 7213
176 Ga0316593_10004411 3300032168 Bacteria 3611
177 Ga0316593_10049104 3300032168 Bacteria 1421
178 Ga0316593_10121895 3300032168 Bacteria 937
179 Ga0316592_1001227 3300033524 Bacteria 4046
180 Ga0316586_1000463 3300033527 Bacteria 3938
181 Ga0316588_1001040 3300033528 Bacteria 4361
182 Ga0316587_1000552 3300033529 Bacteria 3902
183 Ga0316596_1001543 3300033541 Bacteria 4687
184 Ga0316596_1003214 3300033541 Bacteria 3556
185 Ga0316596_1022563 3300033541 Bacteria 1609
186 Ga0316596_1029451 3300033541 Bacteria 1421
187 Ga0316596_1035116 3300033541 Bacteria 1310
188 Ga0373953_0194125 3300035117 Bacteria 877
189 Ga0373957_0165463 3300035120 Bacteria 912
190 Ga0373962_0001717 3300035242 Bacteria 5205
191 Ga0316574_0012584 3300035398 Bacteria 4844
192 Ga0316574_0050105 3300035398 Bacteria 2598
193 Ga0316574_0050523 3300035398 Bacteria 2588
194 Ga0373947_0387327 3300035725 Bacteria 942
195 Ga0373947_0800731 3300035725 Bacteria 643
196 Ga0316582_0201008 3300036647 Bacteria 1360
197 Ga0316582_0256074 3300036647 Bacteria 1200
198 Ga0316582_0270613 3300036647 Bacteria 1165
199 Ga0316584_0002335 3300036712 Bacteria 11962
200 Ga0316584_0017112 3300036712 Bacteria 5206
201 Ga0316584_0074634 3300036712 Bacteria 2542
202 Ga0316584_0238218 3300036712 Bacteria 1332
203 Ga0373925_0420599 3300037068 Bacteria 1092
204 Ga0395899_0002118 3300037312 Bacteria 16312
205 Ga0395899_0216946 3300037312 Bacteria 1327
206 Ga0395900_0102875 3300037418 Bacteria 2934
207 Ga0395898_0072705 3300037466 Bacteria 3322
208 Ga0395905_0067903 3300037471 Bacteria 3340
209 Ga0316581_0000947 3300037588 Bacteria 6178
210 Ga0395901_0514771 3300038443 Bacteria 1216
211 Ga0400485_09519 3300038735 Bacteria 8270
212 Ga0439448_0078298 3300042005 Bacteria 1108
213 Ga0439454_035260 3300042011 Bacteria 801
214 Ga0439460_0040174 3300042461 Bacteria 1370
215 Ga0451577_0141139 3300042876 Bacteria 2165
216 Ga0451577_0848139 3300042876 Bacteria 824
217 Ga0466969_0087865 3300044656 Bacteria 1476
218 Ga0466966_0041686 3300044684 Bacteria 2949
219 Ga0466966_0274595 3300044684 Bacteria 1014
220 Ga0466966_0469754 3300044684 Bacteria 756
221 Ga0466961_0029413 3300044693 Bacteria 3532
222 Ga0466961_0473264 3300044693 Bacteria 757
223 Ga0466961_0543212 3300044693 Bacteria 700
224 Ga0466959_0011693 3300045049 Bacteria 6314
225 Ga0466967_0140470 3300045976 Bacteria 2249
226 Ga0495629_0191119 3300046459 Bacteria 1417
227 Ga0495629_0516681 3300046459 Bacteria 804
228 Ga0495641_0083348 3300046461 Bacteria 1432
229 Ga0495651_0158230 3300046462 Bacteria 1626
230 Ga0495653_0315867 3300046463 Bacteria 1014
231 Ga0495653_0328023 3300046463 Bacteria 990
232 Ga0495582_0048822 3300046473 Bacteria 2331
233 Ga0495582_0105275 3300046473 Bacteria 1582
234 Ga0495639_0187867 3300046475 Bacteria 1008
235 Ga0495664_0379301 3300046477 Bacteria 850
236 Ga0495664_0480277 3300046477 Bacteria 743
237 Ga0495608_0069134 3300046511 Bacteria 2308
238 Ga0495608_0102083 3300046511 Bacteria 1849
239 Ga0495618_0071049 3300046514 Bacteria 2214
240 Ga0495632_0100562 3300046519 Bacteria 1363
241 Ga0495665_0064988 3300046531 Bacteria 1926
242 Ga0495640_0128083 3300046533 Bacteria 1645
243 Ga0495640_0279087 3300046533 Bacteria 1041
244 Ga0495586_0274075 3300046535 Unclassified 965
245 Ga0495587_0219628 3300046536 Bacteria 1072
246 Ga0495635_0806461 3300046663 Bacteria 605
247 Ga0495588_0287814 3300046674 Bacteria 866
248 Ga0495657_0058362 3300046675 Bacteria 2563
249 Ga0495657_0122841 3300046675 Bacteria 1634
250 Ga0495657_0567381 3300046675 Bacteria 658
251 Ga0495646_0314395 3300046680 Bacteria 826
252 Ga0495658_0135186 3300046683 Bacteria 1504
253 Ga0495669_0004011 3300046684 Bacteria 6056
254 Ga0495600_0380364 3300046809 Bacteria 881
255 Ga0495581_0103348 3300047315 Bacteria 1656
256 Ga0495674_0864614 3300047319 Bacteria 700
257 Ga0495676_0581023 3300047321 Bacteria 731
258 Ga0495680_0605321 3300047322 Bacteria 733
259 Ga0495680_0711679 3300047322 Bacteria 662
260 Ga0495680_0748806 3300047322 Bacteria 642
261 Ga0495593_0086869 3300047673 Bacteria 1613
262 Ga0496100_0213061 3300048903 Bacteria 1414
263 Ga0496101_0081088 3300048904 Bacteria 2399
264 Ga0496101_0415108 3300048904 Bacteria 1061
265 Ga0496102_0596887 3300048905 Bacteria 1027
266 Ga0496104_0076109 3300048907 Bacteria 3196
267 Ga0496104_0413350 3300048907 Bacteria 1261
268 Ga0496104_0586750 3300048907 Bacteria 1025
269 Ga0496104_0627675 3300048907 Bacteria 984
270 Ga0496105_0112308 3300048908 Bacteria 2249
271 Ga0496105_0292819 3300048908 Bacteria 1310
272 Ga0496105_0368389 3300048908 Bacteria 1145
273 Ga0496105_0458877 3300048908 Bacteria 1005
274 Ga0496106_0797461 3300048909 Bacteria 749
275 Ga0496108_0000199 3300048911 Bacteria 55365
276 Ga0496108_0004531 3300048911 Bacteria 11186
277 Ga0496108_0258293 3300048911 Bacteria 1516
278 Ga0496108_0263817 3300048911 Bacteria 1499
279 Ga0496108_0349558 3300048911 Bacteria 1290
280 Ga0496109_0025451 3300048912 Bacteria 5274
281 Ga0496109_0120785 3300048912 Bacteria 2441
282 Ga0496110_0000688 3300048913 Bacteria 23289
283 Ga0496110_0012411 3300048913 Bacteria 7005
284 Ga0496110_0056219 3300048913 Bacteria 3463
285 Ga0496110_0481690 3300048913 Bacteria 1130
286 Ga0496111_0003132 3300048914 Bacteria 10177
287 Ga0496111_0064362 3300048914 Bacteria 2660
288 Ga0496113_0065690 3300048916 Bacteria 2746
289 Ga0496113_0073015 3300048916 Bacteria 2613
290 Ga0496113_0756266 3300048916 Bacteria 774
291 Ga0496114_0015994 3300048917 Bacteria 6038
292 Ga0496114_0187398 3300048917 Bacteria 1809
293 Ga0496114_0375414 3300048917 Bacteria 1259
294 Ga0496115_0084695 3300048918 Bacteria 2585
295 Ga0496123_0336674 3300048926 Bacteria 707
296 Ga0496126_0000048 3300048929 Bacteria 317977
297 Ga0496126_0547624 3300048929 Bacteria 919
298 Ga0501031_0061113 3300049568 Bacteria 2455
299 Ga0501031_0080673 3300049568 Bacteria 2120
300 Ga0501033_0358615 3300049570 Bacteria 1020
301 Ga0501036_0599276 3300049572 Bacteria 914
302 Ga0501036_1675875 3300049572 Bacteria 513
303 Ga0501038_0541529 3300049574 Bacteria 886
304 Ga0501039_0520050 3300049575 Bacteria 934
305 Ga0501041_0305803 3300049577 Bacteria 1002
306 Ga0501047_0404529 3300049581 Bacteria 1198
307 Ga0501048_0284704 3300049582 Bacteria 1175
308 Ga0501067_0008749 3300049583 Bacteria 5609
309 Ga0501067_0026695 3300049583 Bacteria 3198
310 Ga0501067_0243231 3300049583 Bacteria 1001
311 Ga0501069_0042899 3300049585 Bacteria 2503
312 Ga0501069_0087094 3300049585 Bacteria 1764
313 Ga0501070_0018151 3300049586 Bacteria 5902
314 Ga0501070_0029746 3300049586 Bacteria 4578
315 Ga0501070_0061746 3300049586 Bacteria 3105
316 Ga0501070_0601475 3300049586 Bacteria 876
317 Ga0501072_0066295 3300049588 Bacteria 2848
318 Ga0501073_0003113 3300049589 Bacteria 12428
319 Ga0501074_0002303 3300049590 Bacteria 13294
320 Ga0501074_0372608 3300049590 Bacteria 1013
321 Ga0501077_0189261 3300049593 Bacteria 1307
322 Ga0501080_0009733 3300049742 Bacteria 8779
323 Ga0501081_0520842 3300049743 Bacteria 887
324 Ga0501081_0779740 3300049743 Bacteria 719
325 Ga0501083_0055531 3300049744 Bacteria 2655
326 Ga0501044_0588425 3300049823 Bacteria 1007
327 Ga0501045_0312031 3300049824 Bacteria 1170
328 Ga0501045_0421441 3300049824 Bacteria 993
329 nmdc:mga03683_121831_c1 3300050489 Bacteria 1160
330 nmdc:mga03n38_20501_c1 3300050490 Bacteria 2646
331 nmdc:mga00v17_19046_c1 3300050491 Bacteria 1783
332 nmdc:mga00v17_72874_c1 3300050491 Bacteria 2132
333 nmdc:mga06z11_20285_c1 3300050494 Bacteria 3071
334 nmdc:mga04h51_3522_c1 3300050495 Bacteria 3808
335 nmdc:mga07m45_7267_c1 3300050496 Bacteria 4714
336 nmdc:mga05p37_392771_c1 3300050507 Bacteria 1622
337 nmdc:mga09592_1293_c1 3300050508 Bacteria 20104
338 nmdc:mga0qj67_781_c1 3300050509 Bacteria 21675
339 nmdc:mga06r32_16466_c1 3300050510 Bacteria 6738
340 Ga0495601_0438767 3300053077 Bacteria 845
341 Ga0495601_0761633 3300053077 Bacteria 616
342 Ga0495595_0030167 3300053084 Bacteria 2431
343 Ga0495595_0147966 3300053084 Bacteria 1155
344 Ga0495595_0491980 3300053084 Bacteria 625
345 Ga0495619_0020359 3300053085 Bacteria 4224
346 Ga0500644_0200422 3300053088 Bacteria 825
347 Ga0500646_0163325 3300053090 Bacteria 745
348 Ga0500641_0013657 3300053096 Bacteria 2985
349 Ga0500556_0276388 3300053104 Bacteria 659
350 Ga0500569_202447 3300053109 Bacteria 675
351 Ga0500594_0002922 3300053118 Bacteria 3731
352 Ga0500652_021257 3300053131 Bacteria 2442
353 Ga0500611_047968 3300053727 Bacteria 967
354 Ga0501084_0335313 3300054114 Bacteria 1277
355 Ga0501082_0923486 3300060353 Bacteria 763
356 2515496802 2515154088 Bacteria 5526283
357 2515758884 2515154137 Bacteria 5711575
358 2516090863 2515154203 Bacteria 5458536
359 2808875747 2808606365 Bacteria 4301966
360 8054610810 8054609563 Bacteria 5170090
361 Ga0081455_10149756
362 Ga0070658_10009082
363 Ga0070658_10075138
364 Ga0070658_10523878
365 Ga0070658_10600793
366 Ga0070683_100150550
367 Ga0068869_100060306
368 Ga0070680_100029215
369 Ga0068868_100019087
370 Ga0068868_100691539
371 Ga0070660_100075812
372 Ga0070660_100106574
373 Ga0070660_100380121
374 Ga0070660_100431592
375 Ga0070661_100635336
376 Ga0070692_10387408
377 Ga0070671_100871570
378 Ga0070659_100001443
379 Ga0070667_100210307
380 Ga0070667_100631712
381 Ga0070709_10096995
382 Ga0070714_100596048
383 Ga0070714_101521217
384 Ga0070713_100030807
385 Ga0070713_100181219
386 Ga0070711_100104805
387 Ga0070663_100517969
388 Ga0070681_10053244
389 Ga0070681_10425465
390 Ga0070681_10452753
391 Ga0070699_100856783
392 Ga0070679_100005652
393 Ga0070684_101100070
394 Ga0070672_100159254
395 Ga0070665_100003401
396 Ga0070665_100558655
397 Ga0070664_101085417
398 Ga0068857_100288388
399 Ga0068856_100306830
400 Ga0070717_10027559
401 Ga0070717_11142773
402 Ga0075365_10005199
403 Ga0075365_10278998
404 Ga0075365_10290266
405 Ga0075368_10002411
406 Ga0075363_100034873
407 Ga0075364_10039196
408 Ga0070712_100018256
409 Ga0075362_10029121
410 Ga0075367_10015879
411 Ga0075370_10013813
412 Ga0075428_100019317
413 Ga0075430_100006031
414 Ga0075431_100017681
415 Ga0075429_100011046
416 Ga0105245_10798049
417 Ga0105245_11110660
418 Ga0105245_11303586
419 Ga0114129_10476115
420 Ga0105243_10236018
421 Ga0105242_10259989
422 Ga0105248_10175001
423 Ga0105248_10781826
424 Ga0105237_10270118
425 Ga0105237_11791149
426 Ga0105238_11853958
427 Ga0105239_10251190
428 Ga0105239_10512918
429 Ga0105239_11136972
430 Ga0105239_11764539
431 Ga0105246_11395547
432 Ga0157328_1000834
433 Ga0157322_1005696
434 Ga0157319_1000371
435 Ga0157339_1008299
436 Ga0157370_10225706
437 Ga0157370_10831659
438 Ga0157369_10000550
439 Ga0157369_10066401
440 Ga0157369_10262823
441 Ga0157369_10909412
442 Ga0157374_10315489
443 Ga0157374_10433097
444 Ga0157378_10057477
445 Ga0163162_10529215
446 Ga0163162_10596831
447 Ga0157372_10234092
448 Ga0157372_12551599
449 Ga0157375_10057605
450 Ga0163163_10079878
451 Ga0163163_10163028
452 Ga0163163_11166392
453 Ga0163163_11781756
454 Ga0157379_10309887
455 Ga0157376_11006592
456 Ga0206356_11280563
457 Ga0207647_10088955
458 Ga0207647_10113611
459 Ga0207647_10206081
460 Ga0207699_10103371
461 Ga0207705_10027475
462 Ga0207705_10065331
463 Ga0207705_10139043
464 Ga0207705_11008273
465 Ga0207707_10405679
466 Ga0207707_10678828
467 Ga0207671_10112917
468 Ga0207693_10033545
469 Ga0207663_10139685
470 Ga0207660_10171543
471 Ga0207657_10080158
472 Ga0207657_10114312
473 Ga0207657_10229364
474 Ga0207649_10484055
475 Ga0207649_10502388
476 Ga0207652_10019238
477 Ga0207700_10060834
478 Ga0207700_10442487
479 Ga0207664_10119560
480 Ga0207664_10181274
481 Ga0207690_10000226
482 Ga0207706_10080131
483 Ga0207709_10115018
484 Ga0207711_10842726
485 Ga0207689_10209422
486 Ga0207661_10053558
487 Ga0207661_10116498
488 Ga0207679_10133290
489 Ga0207658_10282999
490 Ga0207677_10022341
491 Ga0207677_11316643
492 Ga0207678_10481004
493 Ga0207702_10068685
494 Ga0207674_11561543
495 Ga0209813_10010222
496 Ga0268266_10003700
497 Ga0268266_10765631
498 Ga0265319_1052411
499 Ga0265336_10000891
500 Ga0307515_10039073
501 Ga0307515_10176183
502 Ga0265338_10121886
503 Ga0307512_10029077
504 Ga0307509_10046433
505 Ga0265313_10282744
506 Ga0307508_10103327
507 Ga0307508_10122011
508 Ga0307514_10182969
509 Ga0316579_10005133
510 Ga0316576_10000524
511 Ga0316576_10000610
512 Ga0316576_10003622
513 Ga0316576_10067426
514 Ga0316576_10174971
515 Ga0316576_10797860
516 Ga0316578_10003501
517 Ga0316578_10055040
518 Ga0316578_10381818
519 Ga0307516_10006695
520 Ga0307516_10125642
521 Ga0307516_10240524
522 Ga0307405_10161695
523 Ga0316577_10564915
524 Ga0307410_10112049
525 Ga0307410_10682366
526 Ga0307406_10249173
527 Ga0307407_10078474
528 Ga0307409_100157052
529 Ga0307409_100232621
530 Ga0307409_101033415
531 Ga0307416_100247013
532 Ga0307414_11456975
533 Ga0307411_10334869
534 Ga0307415_100541373
535 Ga0316583_10001843
536 Ga0316593_10004411
537 Ga0316593_10049104
538 Ga0316593_10121895
539 Ga0316592_1001227
540 Ga0316586_1000463
541 Ga0316588_1001040
542 Ga0316587_1000552
543 Ga0316596_1001543
544 Ga0316596_1003214
545 Ga0316596_1022563
546 Ga0316596_1029451
547 Ga0316596_1035116
548 Ga0373953_0194125
549 Ga0373957_0165463
550 Ga0373962_0001717
551 Ga0316574_0012584
552 Ga0316574_0050105
553 Ga0316574_0050523
554 Ga0373947_0387327
555 Ga0373947_0800731
556 Ga0316582_0201008
557 Ga0316582_0256074
558 Ga0316582_0270613
559 Ga0316584_0002335
560 Ga0316584_0017112
561 Ga0316584_0074634
562 Ga0316584_0238218
563 Ga0373925_0420599
564 Ga0395899_0002118
565 Ga0395899_0216946
566 Ga0395900_0102875
567 Ga0395898_0072705
568 Ga0395905_0067903
569 Ga0316581_0000947
570 Ga0395901_0514771
571 Ga0400485_09519
572 Ga0439448_0078298
573 Ga0439454_035260
574 Ga0439460_0040174
575 Ga0451577_0141139
576 Ga0451577_0848139
577 Ga0466969_0087865
578 Ga0466966_0041686
579 Ga0466966_0274595
580 Ga0466966_0469754
581 Ga0466961_0029413
582 Ga0466961_0473264
583 Ga0466961_0543212
584 Ga0466959_0011693
585 Ga0466967_0140470
586 Ga0495629_0191119
587 Ga0495629_0516681
588 Ga0495641_0083348
589 Ga0495651_0158230
590 Ga0495653_0315867
591 Ga0495653_0328023
592 Ga0495582_0048822
593 Ga0495582_0105275
594 Ga0495639_0187867
595 Ga0495664_0379301
596 Ga0495664_0480277
597 Ga0495608_0069134
598 Ga0495608_0102083
599 Ga0495618_0071049
600 Ga0495632_0100562
601 Ga0495665_0064988
602 Ga0495640_0128083
603 Ga0495640_0279087
604 Ga0495586_0274075
605 Ga0495587_0219628
606 Ga0495635_0806461
607 Ga0495588_0287814
608 Ga0495657_0058362
609 Ga0495657_0122841
610 Ga0495657_0567381
611 Ga0495646_0314395
612 Ga0495658_0135186
613 Ga0495669_0004011
614 Ga0495600_0380364
615 Ga0495581_0103348
616 Ga0495674_0864614
617 Ga0495676_0581023
618 Ga0495680_0605321
619 Ga0495680_0711679
620 Ga0495680_0748806
621 Ga0495593_0086869
622 Ga0496100_0213061
623 Ga0496101_0081088
624 Ga0496101_0415108
625 Ga0496102_0596887
626 Ga0496104_0076109
627 Ga0496104_0413350
628 Ga0496104_0586750
629 Ga0496104_0627675
630 Ga0496105_0112308
631 Ga0496105_0292819
632 Ga0496105_0368389
633 Ga0496105_0458877
634 Ga0496106_0797461
635 Ga0496108_0000199
636 Ga0496108_0004531
637 Ga0496108_0258293
638 Ga0496108_0263817
639 Ga0496108_0349558
640 Ga0496109_0025451
641 Ga0496109_0120785
642 Ga0496110_0000688
643 Ga0496110_0012411
644 Ga0496110_0056219
645 Ga0496110_0481690
646 Ga0496111_0003132
647 Ga0496111_0064362
648 Ga0496113_0065690
649 Ga0496113_0073015
650 Ga0496113_0756266
651 Ga0496114_0015994
652 Ga0496114_0187398
653 Ga0496114_0375414
654 Ga0496115_0084695
655 Ga0496123_0336674
656 Ga0496126_0000048
657 Ga0496126_0547624
658 Ga0501031_0061113
659 Ga0501031_0080673
660 Ga0501033_0358615
661 Ga0501036_0599276
662 Ga0501036_1675875
663 Ga0501038_0541529
664 Ga0501039_0520050
665 Ga0501041_0305803
666 Ga0501047_0404529
667 Ga0501048_0284704
668 Ga0501067_0008749
669 Ga0501067_0026695
670 Ga0501067_0243231
671 Ga0501069_0042899
672 Ga0501069_0087094
673 Ga0501070_0018151
674 Ga0501070_0029746
675 Ga0501070_0061746
676 Ga0501070_0601475
677 Ga0501072_0066295
678 Ga0501073_0003113
679 Ga0501074_0002303
680 Ga0501074_0372608
681 Ga0501077_0189261
682 Ga0501080_0009733
683 Ga0501081_0520842
684 Ga0501081_0779740
685 Ga0501083_0055531
686 Ga0501044_0588425
687 Ga0501045_0312031
688 Ga0501045_0421441
689 nmdc:mga03683_121831_c1
690 nmdc:mga03n38_20501_c1
691 nmdc:mga00v17_19046_c1
692 nmdc:mga00v17_72874_c1
693 nmdc:mga06z11_20285_c1
694 nmdc:mga04h51_3522_c1
695 nmdc:mga07m45_7267_c1
696 nmdc:mga05p37_392771_c1
697 nmdc:mga09592_1293_c1
698 nmdc:mga0qj67_781_c1
699 nmdc:mga06r32_16466_c1
700 Ga0495601_0438767
701 Ga0495601_0761633
702 Ga0495595_0030167
703 Ga0495595_0147966
704 Ga0495595_0491980
705 Ga0495619_0020359
706 Ga0500644_0200422
707 Ga0500646_0163325
708 Ga0500641_0013657
709 Ga0500556_0276388
710 Ga0500569_202447
711 Ga0500594_0002922
712 Ga0500652_021257
713 Ga0500611_047968
714 Ga0501084_0335313
715 Ga0501082_0923486
716 2515496802
717 2515758884
718 2516090863
719 2808875747
720 8054610810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13686

DrsE_2

DsrE/DsrF/DrsH-like family

28

184

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l7l-assembly2.cif.gz_E crystal structure of ribonucleotide reductase r1 subunit, rrm1 in complex with 5-chloro-2-(n-((1s,2r)-2-(2,3-dihydro-1h-inden-4-yl)-1-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)propyl)sulfamoyl)benzamide 0.8545 20 54
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.8522 19 176
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.8452 19 176
5d1y-assembly1.cif.gz_A low resolution crystal structure of human ribonucleotide reductase alpha6 hexamer in complex with datp 0.8297 23 56
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8232 20 176
ID Description Score Start End Superfamily
af_Q9GYR7_20_278_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8802 22 57 3.40.50.2000
af_Q22180_1_276_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8683 18 54 3.40.50.2000
af_Q9TXZ5_1_281_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8648 20 57 3.40.50.2000
af_Q18081_1_278_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8629 18 56 3.40.50.2000
af_O16914_1_277_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8516 18 57 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A3M2DK97-F1-model_v4 Peroxiredoxin family protein 0.9808 20 176
AF-A0A7Y5WCA7-F1-model_v4 DsrE/DsrF/DrsH-like family protein 0.9797 20 176
AF-A0A7Y0PG17-F1-model_v4 Peroxiredoxin family protein 0.9758 25 176
AF-A0A839JAL0-F1-model_v4 DsrE/DsrF/DrsH-like family protein 0.9702 34 176
AF-A0A2N2MRG5-F1-model_v4 Peroxiredoxin family protein 0.9674 53 176

Map