F421710

General Info

Members Datasets Scaffolds Average Seq Length
359 233 324 310

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221637|2644208444
Length 359
Sequence PTGTAGRCFGSSSAPATKPAPSLDGSSVSEKDKDPRPSRLLKMRGQRKASMSGKLEQTIWDCAVIGGGPAGLTAAIYLARYHLSVTVFDDNTSRAAMIPISHNHAGFPDGISGPELLARMRAQAQRYGASIRGRKITGVQKDHGLFTLQCDRGTSFARTVLMATGVLNHRPSMLPAAHDEAVARGLLRYCPVCDGFEVSDKPVGVLGSGTKGFSEAKFLRSYTRDVTLLAPDGEHQLADAEQRDLEGLGVKVEDGPVISIALGADTITVATAARSFAFASLYPALGSDIRSDLAKSAGARVSDEGCIDVDSHQRTSVPGFYAAGDVVIGLDQISHAMGQAGVAATSIRNDLCEIEALVR

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
3 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
4 2643221557 Ensifer sp. Root558 Isolate Unclassified
5 2643221585 Pelomonas sp. Root662 Isolate Unclassified
6 2643221610 Ensifer sp. Root74 Isolate Unclassified
7 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
8 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
9 2643221656 Pelomonas sp. Root405 Isolate Unclassified
10 2643221668 Ensifer sp. Root423 Isolate Unclassified
11 2643221675 Ensifer sp. Root1298 Isolate Unclassified
12 2643221680 Ensifer sp. Root1312 Isolate Unclassified
13 2643221718 Rhizobium sp. Root268 Isolate Unclassified
14 2643221726 Ensifer sp. Root954 Isolate Unclassified
15 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
16 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
17 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
18 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
19 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
20 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
21 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
22 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
23 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
24 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
25 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
26 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
27 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
28 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
29 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
30 3004167301 Mesorhizobium loti 582 Isolate Unclassified
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
149 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
216 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
217 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
220 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
229 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
230 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
231 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
232 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
233 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.69
Metatranscriptomes 0.28
Isolates 10.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 13.65
Nodule 2.79
Rhizoplane 4.18
Rhizosphere 62.67
Stem 0
Stem Tuber 0
Unclassified 16.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10006742 3300001989 Bacteria 4323
2 JGI24737J22298_10000749 3300001990 Bacteria 11478
3 JGI24735J21928_10005387 3300002067 Bacteria 4247
4 JGI24735J21928_10007776 3300002067 Bacteria 3485
5 JGI24738J21930_10000786 3300002075 Bacteria 9083
6 JGI25153J46596_10009212 3300003215 Bacteria 4621
7 rootH1_10061593 3300003316 Unclassified 1510
8 rootH1_10061593 3300003323 Bacteria 7356
9 rootL2_10076295 3300003322 Bacteria 2230
10 JGI25160J50197_1002471 3300003354 Bacteria 8592
11 Ga0055526_1001395 3300003771 Bacteria 17166
12 Ga0055524_1000327 3300003775 Bacteria 44413
13 Ga0055528_1001431 3300003790 Bacteria 14595
14 Ga0055530_10018784 3300003791 Bacteria 2117
15 Ga0055543_1000272 3300004625 Bacteria 38422
16 Ga0065165_1002770 3300005262 Bacteria 13883
17 Ga0065704_10017009 3300005289 Bacteria 2238
18 Ga0065704_10080865 3300005289 Bacteria 3864
19 Ga0065707_10151436 3300005295 Bacteria 1654
20 Ga0070658_10057190 3300005327 Bacteria 3172
21 Ga0070683_100023679 3300005329 Bacteria 5496
22 Ga0070670_100052867 3300005331 Bacteria 3488
23 Ga0070666_10040729 3300005335 Bacteria 3102
24 Ga0070666_10226288 3300005335 Bacteria 1320
25 Ga0070668_100001604 3300005347 Bacteria 16375
26 Ga0070668_100024999 3300005347 Bacteria 4527
27 Ga0070668_100047536 3300005347 Bacteria 3299
28 Ga0070669_100001548 3300005353 Bacteria 16630
29 Ga0070669_100012339 3300005353 Bacteria 6062
30 Ga0070669_100286358 3300005353 Bacteria 1321
31 Ga0070671_100006450 3300005355 Bacteria 9378
32 Ga0070671_100038818 3300005355 Bacteria 3952
33 Ga0070671_100244481 3300005355 Bacteria 1523
34 Ga0070671_100447476 3300005355 Bacteria 1108
35 Ga0070674_100001174 3300005356 Bacteria 13763
36 Ga0070674_100001202 3300005356 Bacteria 13574
37 Ga0070659_100006482 3300005366 Bacteria 8448
38 Ga0070667_100000103 3300005367 Bacteria 107232
39 Ga0070667_100135205 3300005367 Bacteria 2155
40 Ga0070678_100004037 3300005456 Bacteria 8264
41 Ga0070662_100002280 3300005457 Bacteria 11772
42 Ga0070662_100011375 3300005457 Bacteria 5874
43 Ga0070662_100236049 3300005457 Bacteria 1465
44 Ga0070684_100010867 3300005535 Bacteria 7234
45 Ga0068853_100011722 3300005539 Bacteria 7123
46 Ga0070672_100010754 3300005543 Bacteria 6359
47 Ga0070665_100000271 3300005548 Bacteria 84713
48 Ga0070665_100000535 3300005548 Bacteria 53560
49 Ga0068855_100024228 3300005563 Bacteria 7265
50 Ga0068855_100068920 3300005563 Bacteria 4117
51 Ga0068855_100099002 3300005563 Bacteria 3358
52 Ga0068855_100648409 3300005563 Bacteria 1134
53 Ga0070664_100003949 3300005564 Bacteria 11947
54 Ga0070664_100106521 3300005564 Bacteria 2442
55 Ga0068859_100011913 3300005617 Bacteria 8738
56 Ga0068863_100001271 3300005841 Bacteria 25161
57 Ga0068863_100021657 3300005841 Bacteria 6131
58 Ga0068863_100139774 3300005841 Bacteria 2314
59 Ga0068858_100000840 3300005842 Bacteria 31805
60 Ga0068858_100038664 3300005842 Bacteria 4426
61 Ga0068860_100006651 3300005843 Bacteria 11609
62 Ga0068860_100020145 3300005843 Bacteria 6463
63 Ga0068860_100026685 3300005843 Bacteria 5567
64 Ga0068862_100000201 3300005844 Bacteria 66112
65 Ga0075362_10001908 3300006177 Bacteria 6850
66 Ga0075362_10028028 3300006177 Bacteria 2416
67 Ga0075367_10215463 3300006178 Bacteria 1201
68 Ga0075366_10001073 3300006195 Bacteria 13437
69 Ga0075366_10171076 3300006195 Bacteria 1318
70 Ga0075370_10008696 3300006353 Bacteria 5235
71 Ga0097620_100011913 3300006931 Bacteria 8738
72 Ga0097620_100132251 3300006931 Bacteria 2567
73 Ga0105251_10001400 3300009011 Bacteria 20799
74 Ga0105240_10003711 3300009093 Bacteria 23604
75 Ga0105240_10087388 3300009093 Bacteria 3818
76 Ga0105240_10351292 3300009093 Bacteria 1673
77 Ga0105247_10049549 3300009101 Bacteria 2583
78 Ga0105243_10000608 3300009148 Bacteria 35675
79 Ga0105248_10193518 3300009177 Bacteria 2291
80 Ga0105238_10240674 3300009551 Bacteria 1787
81 Ga0105238_10363834 3300009551 Bacteria 1436
82 Ga0105249_10000350 3300009553 Bacteria 46331
83 Ga0105148_100328 3300009978 Bacteria 5963
84 Ga0105239_10000507 3300010375 Bacteria 56420
85 Ga0105239_10057669 3300010375 Bacteria 4260
86 Ga0105246_10001156 3300011119 Bacteria 15320
87 Ga0105246_10018420 3300011119 Bacteria 4450
88 Ga0157373_10001250 3300013100 Bacteria 19427
89 Ga0157371_10136378 3300013102 Bacteria 1748
90 Ga0157371_10174352 3300013102 Bacteria 1537
91 Ga0157371_10273482 3300013102 Bacteria 1219
92 Ga0157370_10000377 3300013104 Bacteria 56059
93 Ga0157369_10116939 3300013105 Bacteria 2830
94 Ga0157369_10169348 3300013105 Bacteria 2302
95 Ga0157372_10027348 3300013307 Bacteria 6210
96 Ga0157372_10110053 3300013307 Bacteria 3155
97 Ga0183363_1004 3300015690 Bacteria 416766
98 Ga0163161_10039573 3300017792 Bacteria 3385
99 Ga0209674_103381 3300025226 Bacteria 2956
100 Ga0209563_100024 3300025230 Bacteria 601155
101 Ga0209673_1000162 3300025273 Bacteria 139078
102 Ga0209025_1059471 3300025294 Bacteria 1442
103 Ga0209564_1000234 3300025295 Bacteria 121532
104 Ga0209758_1004490 3300025297 Bacteria 11586
105 Ga0209050_1000685 3300025298 Bacteria 50959
106 Ga0209256_1000992 3300025299 Bacteria 33792
107 Ga0207426_1000299 3300025302 Bacteria 97846
108 Ga0209051_1005014 3300025303 Bacteria 7891
109 Ga0207656_10009353 3300025321 Bacteria 3638
110 Ga0207656_10168050 3300025321 Bacteria 1047
111 Ga0207713_1006899 3300025735 Bacteria 6823
112 Ga0207680_10028238 3300025903 Bacteria 3136
113 Ga0207647_10023325 3300025904 Bacteria 4092
114 Ga0207647_10031922 3300025904 Bacteria 3387
115 Ga0207695_10003576 3300025913 Bacteria 21756
116 Ga0207695_10064416 3300025913 Bacteria 3774
117 Ga0207695_10240102 3300025913 Bacteria 1713
118 Ga0207681_10000372 3300025923 Bacteria 31712
119 Ga0207681_10000733 3300025923 Bacteria 21478
120 Ga0207681_10001715 3300025923 Bacteria 14082
121 Ga0207681_10107305 3300025923 Bacteria 2025
122 Ga0207694_10004600 3300025924 Bacteria 10742
123 Ga0207694_10101969 3300025924 Bacteria 2275
124 Ga0207659_10034403 3300025926 Bacteria 3494
125 Ga0207644_10001229 3300025931 Bacteria 16504
126 Ga0207644_10026942 3300025931 Bacteria 3968
127 Ga0207690_10036261 3300025932 Bacteria 3192
128 Ga0207690_10076062 3300025932 Bacteria 2330
129 Ga0207706_10002879 3300025933 Bacteria 16670
130 Ga0207706_10024656 3300025933 Bacteria 5391
131 Ga0207706_10031544 3300025933 Bacteria 4720
132 Ga0207706_10114549 3300025933 Bacteria 2372
133 Ga0207709_10000109 3300025935 Bacteria 128086
134 Ga0207669_10000048 3300025937 Bacteria 60914
135 Ga0207669_10000504 3300025937 Bacteria 17074
136 Ga0207691_10063959 3300025940 Bacteria 3335
137 Ga0207711_10285531 3300025941 Bacteria 1520
138 Ga0207679_10020883 3300025945 Bacteria 4429
139 Ga0207667_10146387 3300025949 Bacteria 2432
140 Ga0207667_10161436 3300025949 Bacteria 2305
141 Ga0207667_10455981 3300025949 Bacteria 1299
142 Ga0207712_10000299 3300025961 Bacteria 46419
143 Ga0207668_10000231 3300025972 Bacteria 37525
144 Ga0207668_10031827 3300025972 Bacteria 3479
145 Ga0207640_10367763 3300025981 Bacteria 1161
146 Ga0207658_10000080 3300025986 Bacteria 107226
147 Ga0207703_10000683 3300026035 Bacteria 33658
148 Ga0207703_10041593 3300026035 Bacteria 3683
149 Ga0207639_10017876 3300026041 Bacteria 5029
150 Ga0207639_10034825 3300026041 Bacteria 3724
151 Ga0207678_10040485 3300026067 Bacteria 4042
152 Ga0207641_10001720 3300026088 Bacteria 21176
153 Ga0207641_10005778 3300026088 Bacteria 10506
154 Ga0207641_10009155 3300026088 Bacteria 8176
155 Ga0207648_10045417 3300026089 Bacteria 3853
156 Ga0207674_10015267 3300026116 Bacteria 8445
157 Ga0207683_10000370 3300026121 Bacteria 41260
158 Ga0207683_10087932 3300026121 Bacteria 2764
159 Ga0207698_10248907 3300026142 Bacteria 1625
160 Ga0268266_10000002 3300028379 Bacteria 3059047
161 Ga0268265_10000219 3300028380 Bacteria 66148
162 Ga0268265_10033613 3300028380 Bacteria 3730
163 Ga0268265_10489236 3300028380 Bacteria 1157
164 Ga0268264_10000906 3300028381 Bacteria 31144
165 Ga0268264_10002784 3300028381 Bacteria 15262
166 Ga0268264_10005270 3300028381 Bacteria 10949
167 Ga0268264_10028896 3300028381 Bacteria 4539
168 Ga0307408_100000134 3300031548 Bacteria 82703
169 Ga0307405_10000391 3300031731 Bacteria 16410
170 Ga0307405_10000993 3300031731 Bacteria 11415
171 Ga0307413_10012833 3300031824 Bacteria 4185
172 Ga0307413_10096009 3300031824 Bacteria 1945
173 Ga0307410_10004396 3300031852 Bacteria 7281
174 Ga0307406_10001698 3300031901 Bacteria 12096
175 Ga0307406_10023766 3300031901 Bacteria 3652
176 Ga0307407_10097289 3300031903 Bacteria 1819
177 Ga0307412_10000888 3300031911 Bacteria 17194
178 Ga0307412_10326469 3300031911 Bacteria 1223
179 Ga0307409_100001207 3300031995 Bacteria 12420
180 Ga0307409_100305206 3300031995 Bacteria 1483
181 Ga0307416_100001285 3300032002 Bacteria 13530
182 Ga0307414_10005924 3300032004 Bacteria 6768
183 Ga0307411_10000284 3300032005 Bacteria 16894
184 Ga0373937_0245486 3300036401 Bacteria 1687
185 Ga0395905_0001224 3300037471 Bacteria 31977
186 Ga0395905_0001284 3300037471 Bacteria 30999
187 Ga0395905_0003882 3300037471 Bacteria 15774
188 Ga0436364_0349903 3300037853 Bacteria 9099
189 Ga0237819_00743 3300038705 Bacteria 10484
190 Ga0237816_01166 3300039145 Bacteria 2161
191 Ga0495617_055127 3300046452 Bacteria 1319
192 Ga0495627_005346 3300046453 Bacteria 5194
193 Ga0495650_0101197 3300046471 Unclassified 1082
194 Ga0495584_0022431 3300046491 Bacteria 3204
195 Ga0495583_0000516 3300046506 Bacteria 55187
196 Ga0495583_0001280 3300046506 Bacteria 26281
197 Ga0495583_0010353 3300046506 Bacteria 5445
198 Ga0495606_0000416 3300046507 Bacteria 71329
199 Ga0495606_0037399 3300046507 Bacteria 3297
200 Ga0495606_0062703 3300046507 Bacteria 2372
201 Ga0495610_0001035 3300046512 Bacteria 25555
202 Ga0495610_0001755 3300046512 Bacteria 18981
203 Ga0495610_0003604 3300046512 Bacteria 11962
204 Ga0495610_0004635 3300046512 Bacteria 10057
205 Ga0495616_0000018 3300046513 Bacteria 167281
206 Ga0495631_0003526 3300046518 Bacteria 8553
207 Ga0495643_0001616 3300046522 Bacteria 19958
208 Ga0495643_0005298 3300046522 Bacteria 8756
209 Ga0495648_0046994 3300046524 Bacteria 2671
210 Ga0495663_0000612 3300046525 Bacteria 12415
211 Ga0495642_0104233 3300046528 Bacteria 1209
212 Ga0495597_0061570 3300046542 Bacteria 1634
213 Ga0495622_0001635 3300046557 Bacteria 11069
214 Ga0495633_0001055 3300046558 Bacteria 22426
215 Ga0495633_0007864 3300046558 Bacteria 6085
216 Ga0495633_0080892 3300046558 Bacteria 1511
217 Ga0495668_0000098 3300046616 Bacteria 138553
218 Ga0495668_0002727 3300046616 Bacteria 14151
219 Ga0495668_0011874 3300046616 Bacteria 5191
220 Ga0495611_0024137 3300046648 Bacteria 2644
221 Ga0495611_0030315 3300046648 Bacteria 2377
222 Ga0495625_0020475 3300046660 Bacteria 5106
223 Ga0495625_0131730 3300046660 Bacteria 1693
224 Ga0495613_0231589 3300046689 Bacteria 1294
225 Ga0495670_0013534 3300046691 Bacteria 4012
226 Ga0495671_0000023 3300046692 Bacteria 252939
227 Ga0495649_0050296 3300046694 Bacteria 2262
228 Ga0495600_0003463 3300046809 Bacteria 9282
229 Ga0495683_0000444 3300047323 Bacteria 32710
230 Ga0495677_0001655 3300047445 Bacteria 8952
231 Ga0495673_0000054 3300047469 Bacteria 252207
232 Ga0495681_0000036 3300047470 Bacteria 124207
233 Ga0495681_0003687 3300047470 Bacteria 10637
234 Ga0495681_0017419 3300047470 Bacteria 3989
235 Ga0495686_0000394 3300047472 Bacteria 69332
236 Ga0495686_0000726 3300047472 Bacteria 44120
237 Ga0495686_0001864 3300047472 Bacteria 21160
238 Ga0495686_0003210 3300047472 Bacteria 14396
239 Ga0495686_0041248 3300047472 Bacteria 2939
240 Ga0495615_0000022 3300048090 Bacteria 51294
241 Ga0495626_0002972 3300048091 Bacteria 11246
242 Ga0496101_0077815 3300048904 Bacteria 2445
243 Ga0496102_0000092 3300048905 Bacteria 125879
244 Ga0496102_0190762 3300048905 Bacteria 1931
245 Ga0496103_0000101 3300048906 Bacteria 93679
246 Ga0496103_0053994 3300048906 Bacteria 2491
247 Ga0496104_0001870 3300048907 Bacteria 18226
248 Ga0496105_0006584 3300048908 Bacteria 8941
249 Ga0496106_0434460 3300048909 Bacteria 1055
250 Ga0496107_0069542 3300048910 Bacteria 2555
251 Ga0496110_0019834 3300048913 Bacteria 5667
252 Ga0496110_0143966 3300048913 Bacteria 2155
253 Ga0496110_0152835 3300048913 Bacteria 2090
254 Ga0496111_0050960 3300048914 Bacteria 2988
255 Ga0496115_0000038 3300048918 Bacteria 125104
256 Ga0496116_0000153 3300048919 Bacteria 141137
257 Ga0496116_0000627 3300048919 Bacteria 46393
258 Ga0496116_0020616 3300048919 Bacteria 5001
259 Ga0496117_0000173 3300048920 Bacteria 133415
260 Ga0496117_0022383 3300048920 Bacteria 5070
261 Ga0496117_0068258 3300048920 Bacteria 2401
262 Ga0496117_0073047 3300048920 Bacteria 2290
263 Ga0496118_0000131 3300048921 Bacteria 133116
264 Ga0496118_0008833 3300048921 Bacteria 10313
265 Ga0496118_0011364 3300048921 Bacteria 8702
266 Ga0496119_0013507 3300048922 Bacteria 6496
267 Ga0496119_0016914 3300048922 Bacteria 5519
268 Ga0496120_0003324 3300048923 Bacteria 14777
269 Ga0496121_0000209 3300048924 Bacteria 129740
270 Ga0496121_0000529 3300048924 Bacteria 72533
271 Ga0496121_0000980 3300048924 Bacteria 51090
272 Ga0496121_0001411 3300048924 Bacteria 40702
273 Ga0496121_0010691 3300048924 Bacteria 10301
274 Ga0496122_0000094 3300048925 Bacteria 202047
275 Ga0496122_0012871 3300048925 Bacteria 8269
276 Ga0496123_0000626 3300048926 Bacteria 59189
277 Ga0496123_0038843 3300048926 Bacteria 3339
278 Ga0496124_0000166 3300048927 Bacteria 133634
279 Ga0496124_0000316 3300048927 Bacteria 89321
280 Ga0496124_0000554 3300048927 Bacteria 63220
281 Ga0496124_0001950 3300048927 Bacteria 28176
282 Ga0496124_0062339 3300048927 Bacteria 3121
283 Ga0496125_0000285 3300048928 Bacteria 100029
284 Ga0496125_0000390 3300048928 Bacteria 81748
285 Ga0496125_0018823 3300048928 Bacteria 6540
286 Ga0496125_0019161 3300048928 Bacteria 6467
287 Ga0496125_0185490 3300048928 Bacteria 1380
288 Ga0496126_0000222 3300048929 Bacteria 123936
289 Ga0496126_0000517 3300048929 Bacteria 75042
290 Ga0496126_0001248 3300048929 Bacteria 41296
291 Ga0496126_0022851 3300048929 Bacteria 6072
292 Ga0501340_000304 3300049556 Bacteria 1983
293 Ga0501033_0080520 3300049570 Bacteria 2390
294 Ga0501034_0178856 3300049571 Bacteria 2087
295 Ga0501043_0372363 3300049579 Bacteria 1082
296 Ga0501225_0005718 3300049705 Bacteria 3643
297 Ga0501225_0044209 3300049705 Bacteria 1231
298 Ga0501035_0144371 3300049822 Bacteria 2068
299 nmdc:mga03683_121146_c1 3300050489 Bacteria 1163
300 nmdc:mga03683_23373_c1 3300050489 Bacteria 2407
301 nmdc:mga0yw44_19537_c1 3300050492 Bacteria 3738
302 nmdc:mga0k408_14173_c1 3300050493 Bacteria 4387
303 nmdc:mga0k408_16981_c1 3300050493 Bacteria 4046
304 nmdc:mga06z11_172026_c1 3300050494 Bacteria 1244
305 nmdc:mga07m45_3760_c1 3300050496 Bacteria 7342
306 nmdc:mga09592_193636_c1 3300050508 Bacteria 1760
307 nmdc:mga0sz30_30986_c1 3300050516 Bacteria 2211
308 Ga0500643_000001 3300053087 Bacteria 1440111
309 Ga0500643_014387 3300053087 Bacteria 2754
310 Ga0500647_0058302 3300053091 Bacteria 1857
311 Ga0500562_032557 3300053108 Bacteria 1376
312 Ga0500595_006237 3300053119 Bacteria 5086
313 Ga0500607_001332 3300053121 Bacteria 22504
314 Ga0500642_0155833 3300053130 Bacteria 1071
315 Ga0500658_0017770 3300053134 Bacteria 2659
316 Ga0500559_0044172 3300053136 Unclassified 1948
317 Ga0500577_0014973 3300053142 Bacteria 2412
318 Ga0500604_0002980 3300053151 Bacteria 4551
319 Ga0500604_0060578 3300053151 Bacteria 1188
320 Ga0500604_0084334 3300053151 Unclassified 1030
321 Ga0500616_0004563 3300053153 Bacteria 9804
322 Ga0500627_0000681 3300053158 Bacteria 9023
323 Ga0500636_0003647 3300053177 Bacteria 8689
324 Ga0500609_006792 3300053731 Bacteria 1554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053151 Ga0500604_0060578 Ga0500604_0060578_114_923 267
2 3300046471 Ga0495650_0101197 Ga0495650_0101197_220_1047 275
3 3300046513 Ga0495616_0000018 Ga0495616_0000018_86431_87258 275
4 3300053151 Ga0500604_0002980 Ga0500604_0002980_1038_1865 275
5 3300053158 Ga0500627_0000681 Ga0500627_0000681_7223_8050 275
6 3300005327 Ga0070658_10057190 Ga0070658_100571902 284
7 3300047472 Ga0495686_0000726 Ga0495686_0000726_19625_20491 288
8 3300025226 Ga0209674_103381 Ga0209674_1033814 292
9 iso_pu_bacteria 2643221585 2643933977 292
10 iso_pu_bacteria 2643221656 2644315464 292
11 iso_pu_bacteria 2511231221 2512034882 293
12 iso_pu_bacteria 2885429604 2885429735 296
13 iso_pu_bacteria 2643221622 2644128880 297
14 iso_pu_bacteria 2791355048 2792463213 297
15 iso_pu_bacteria 2843744320 2843748199 297
16 iso_pu_bacteria 2882806704 2882808381 297
17 3300003322 rootL2_10076295 rootL2_100762952 299
18 3300049556 Ga0501340_000304 Ga0501340_000304_210_1196 299
19 3300049822 Ga0501035_0144371 Ga0501035_0144371_24_929 299
20 3300005329 Ga0070683_100023679 Ga0070683_1000236794 300
21 3300005535 Ga0070684_100010867 Ga0070684_1000108677 300
22 3300005548 Ga0070665_100000535 Ga0070665_10000053516 300
23 3300005563 Ga0068855_100099002 Ga0068855_1000990023 300
24 3300005564 Ga0070664_100106521 Ga0070664_1001065213 300
25 3300025932 Ga0207690_10036261 Ga0207690_100362613 300
26 3300025932 Ga0207690_10076062 Ga0207690_100760623 300
27 3300025945 Ga0207679_10020883 Ga0207679_100208834 300
28 3300025949 Ga0207667_10455981 Ga0207667_104559811 300
29 3300025981 Ga0207640_10367763 Ga0207640_103677631 300
30 3300026041 Ga0207639_10034825 Ga0207639_100348254 300
31 3300026067 Ga0207678_10040485 Ga0207678_100404854 300
32 3300028379 Ga0268266_10000002 Ga0268266_100000022360 300
33 3300031731 Ga0307405_10000391 Ga0307405_1000039117 300
34 3300031911 Ga0307412_10326469 Ga0307412_103264691 300
35 3300048924 Ga0496121_0000529 Ga0496121_0000529_65319_66224 300
36 3300049571 Ga0501034_0178856 Ga0501034_0178856_75_995 300
37 3300053087 Ga0500643_000001 Ga0500643_000001_1131591_1132499 300
38 3300053108 Ga0500562_032557 Ga0500562_032557_51_959 300
39 3300053134 Ga0500658_0017770 Ga0500658_0017770_1390_2295 300
40 3300053153 Ga0500616_0004563 Ga0500616_0004563_6164_7072 300
41 iso_pu_bacteria 2643221557 2643807768 300
42 iso_pu_bacteria 2643221610 2644068206 300
43 iso_pu_bacteria 2643221668 2644381556 300
44 iso_pu_bacteria 2643221675 2644419138 300
45 iso_pu_bacteria 2643221680 2644452477 300
46 iso_pu_bacteria 2643221726 2644690587 300
47 iso_pu_bacteria 2848297114 2848299438 300
48 iso_pu_bacteria 2848992105 2848998698 300
49 iso_pu_bacteria 2895880812 2895882652 300
50 iso_pu_bacteria 650716007 650741505 300
51 3300005355 Ga0070671_100447476 Ga0070671_1004474761 301
52 iso_pu_bacteria 2509276021 2509385913 301
53 iso_pu_bacteria 2738541333 2739034552 302
54 iso_pu_bacteria 2802429636 2806069902 302
55 iso_pu_bacteria 2936367885 2936371022 302
56 iso_pu_bacteria 2936375103 2936375729 302
57 iso_pu_bacteria 8005376324 8005380398 302
58 iso_pu_bacteria 8005563573 8005565178 302
59 iso_pu_bacteria 8005563573 8005565228 302
60 iso_pu_bacteria 8024479707 8024484743 302
61 3300005563 Ga0068855_100648409 Ga0068855_1006484091 303
62 3300025949 Ga0207667_10161436 Ga0207667_101614363 303
63 3300050508 nmdc:mga09592_193636_c1 nmdc:mga09592_193636_c1_280_1455 303
64 3300005841 Ga0068863_100021657 Ga0068863_1000216572 304
65 3300005843 Ga0068860_100006651 Ga0068860_10000665113 304
66 3300005844 Ga0068862_100000201 Ga0068862_10000020163 304
67 3300006178 Ga0075367_10215463 Ga0075367_102154632 304
68 3300006931 Ga0097620_100132251 Ga0097620_1001322513 304
69 3300009101 Ga0105247_10049549 Ga0105247_100495492 304
70 3300009553 Ga0105249_10000350 Ga0105249_1000035044 304
71 3300013100 Ga0157373_10001250 Ga0157373_100012502 304
72 3300013102 Ga0157371_10174352 Ga0157371_101743523 304
73 3300013102 Ga0157371_10273482 Ga0157371_102734822 304
74 3300015690 Ga0183363_1004 Ga0183363_1004162 304
75 3300025961 Ga0207712_10000299 Ga0207712_1000029943 304
76 3300026088 Ga0207641_10005778 Ga0207641_100057787 304
77 3300028380 Ga0268265_10000219 Ga0268265_100002199 304
78 3300028381 Ga0268264_10000906 Ga0268264_1000090628 304
79 3300031824 Ga0307413_10012833 Ga0307413_100128331 304
80 3300031824 Ga0307413_10096009 Ga0307413_100960092 304
81 3300031901 Ga0307406_10023766 Ga0307406_100237664 304
82 3300031995 Ga0307409_100305206 Ga0307409_1003052062 304
83 3300046512 Ga0495610_0001755 Ga0495610_0001755_309_1238 304
84 3300046512 Ga0495610_0004635 Ga0495610_0004635_3690_4604 304
85 3300046616 Ga0495668_0002727 Ga0495668_0002727_12441_13355 304
86 3300048090 Ga0495615_0000022 Ga0495615_0000022_29586_30500 304
87 3300049705 Ga0501225_0044209 Ga0501225_0044209_14_928 304
88 3300050494 nmdc:mga06z11_172026_c1 nmdc:mga06z11_172026_c1_85_999 304
89 3300053136 Ga0500559_0044172 Ga0500559_0044172_192_1133 304
90 3300053142 Ga0500577_0014973 Ga0500577_0014973_1232_2155 304
91 3300053151 Ga0500604_0084334 Ga0500604_0084334_61_975 304
92 iso_pu_bacteria 2958122699 2958127014 304
93 iso_pu_bacteria 2977872689 2977875152 304
94 iso_pu_bacteria 2993693658 2993695915 304
95 iso_pu_bacteria 3004167301 3004169934 304
96 3300005353 Ga0070669_100001548 Ga0070669_10000154819 305
97 3300005356 Ga0070674_100001174 Ga0070674_1000011748 305
98 3300005356 Ga0070674_100001202 Ga0070674_1000012025 305
99 3300005456 Ga0070678_100004037 Ga0070678_1000040372 305
100 3300005457 Ga0070662_100236049 Ga0070662_1002360491 305
101 3300005543 Ga0070672_100010754 Ga0070672_1000107544 305
102 3300006195 Ga0075366_10171076 Ga0075366_101710762 305
103 3300009093 Ga0105240_10003711 Ga0105240_1000371119 305
104 3300009148 Ga0105243_10000608 Ga0105243_1000060814 305
105 3300010375 Ga0105239_10000507 Ga0105239_1000050743 305
106 3300011119 Ga0105246_10018420 Ga0105246_100184203 305
107 3300025230 Ga0209563_100024 Ga0209563_100024323 305
108 3300025913 Ga0207695_10003576 Ga0207695_1000357615 305
109 3300025923 Ga0207681_10000372 Ga0207681_1000037218 305
110 3300025923 Ga0207681_10001715 Ga0207681_1000171512 305
111 3300025926 Ga0207659_10034403 Ga0207659_100344033 305
112 3300025933 Ga0207706_10114549 Ga0207706_101145492 305
113 3300025935 Ga0207709_10000109 Ga0207709_1000010930 305
114 3300025937 Ga0207669_10000048 Ga0207669_100000488 305
115 3300025937 Ga0207669_10000504 Ga0207669_100005048 305
116 3300025940 Ga0207691_10063959 Ga0207691_100639592 305
117 3300026089 Ga0207648_10045417 Ga0207648_100454174 305
118 3300026121 Ga0207683_10000370 Ga0207683_1000037034 305
119 3300026121 Ga0207683_10087932 Ga0207683_100879322 305
120 3300028381 Ga0268264_10005270 Ga0268264_1000527010 305
121 3300046491 Ga0495584_0022431 Ga0495584_0022431_1495_2415 305
122 3300046506 Ga0495583_0001280 Ga0495583_0001280_12116_13036 305
123 3300046506 Ga0495583_0010353 Ga0495583_0010353_1746_2666 305
124 3300046507 Ga0495606_0000416 Ga0495606_0000416_22998_23918 305
125 3300046507 Ga0495606_0037399 Ga0495606_0037399_2206_3126 305
126 3300046518 Ga0495631_0003526 Ga0495631_0003526_114_1034 305
127 3300046522 Ga0495643_0001616 Ga0495643_0001616_8518_9438 305
128 3300046522 Ga0495643_0005298 Ga0495643_0005298_5478_6398 305
129 3300046525 Ga0495663_0000612 Ga0495663_0000612_7718_8638 305
130 3300046528 Ga0495642_0104233 Ga0495642_0104233_129_1049 305
131 3300046542 Ga0495597_0061570 Ga0495597_0061570_296_1216 305
132 3300046557 Ga0495622_0001635 Ga0495622_0001635_7057_7977 305
133 3300046558 Ga0495633_0001055 Ga0495633_0001055_3708_4628 305
134 3300046558 Ga0495633_0080892 Ga0495633_0080892_414_1334 305
135 3300046616 Ga0495668_0000098 Ga0495668_0000098_54700_55620 305
136 3300046616 Ga0495668_0011874 Ga0495668_0011874_821_1741 305
137 3300046648 Ga0495611_0024137 Ga0495611_0024137_278_1198 305
138 3300046648 Ga0495611_0030315 Ga0495611_0030315_1180_2100 305
139 3300046660 Ga0495625_0020475 Ga0495625_0020475_668_1588 305
140 3300046660 Ga0495625_0131730 Ga0495625_0131730_118_1038 305
141 3300046689 Ga0495613_0231589 Ga0495613_0231589_273_1193 305
142 3300046691 Ga0495670_0013534 Ga0495670_0013534_2930_3850 305
143 3300046694 Ga0495649_0050296 Ga0495649_0050296_106_1026 305
144 3300046809 Ga0495600_0003463 Ga0495600_0003463_7835_8755 305
145 3300047323 Ga0495683_0000444 Ga0495683_0000444_24292_25212 305
146 3300047445 Ga0495677_0001655 Ga0495677_0001655_7292_8212 305
147 3300047470 Ga0495681_0003687 Ga0495681_0003687_5396_6316 305
148 3300047470 Ga0495681_0017419 Ga0495681_0017419_2176_3096 305
149 3300048904 Ga0496101_0077815 Ga0496101_0077815_95_1015 305
150 3300048905 Ga0496102_0000092 Ga0496102_0000092_65154_66074 305
151 3300048905 Ga0496102_0190762 Ga0496102_0190762_960_1877 305
152 3300048906 Ga0496103_0000101 Ga0496103_0000101_63269_64189 305
153 3300048907 Ga0496104_0001870 Ga0496104_0001870_7365_8285 305
154 3300048908 Ga0496105_0006584 Ga0496105_0006584_4498_5418 305
155 3300048909 Ga0496106_0434460 Ga0496106_0434460_23_943 305
156 3300048910 Ga0496107_0069542 Ga0496107_0069542_596_1513 305
157 3300048913 Ga0496110_0019834 Ga0496110_0019834_143_1060 305
158 3300048913 Ga0496110_0152835 Ga0496110_0152835_112_1032 305
159 3300048914 Ga0496111_0050960 Ga0496111_0050960_415_1335 305
160 3300048918 Ga0496115_0000038 Ga0496115_0000038_61138_62058 305
161 3300048919 Ga0496116_0000627 Ga0496116_0000627_29479_30399 305
162 3300048920 Ga0496117_0000173 Ga0496117_0000173_69222_70142 305
163 3300048921 Ga0496118_0000131 Ga0496118_0000131_63107_64027 305
164 3300048922 Ga0496119_0016914 Ga0496119_0016914_3468_4388 305
165 3300048923 Ga0496120_0003324 Ga0496120_0003324_9603_10523 305
166 3300048924 Ga0496121_0000209 Ga0496121_0000209_63085_64005 305
167 3300048925 Ga0496122_0012871 Ga0496122_0012871_3883_4803 305
168 3300048926 Ga0496123_0038843 Ga0496123_0038843_1554_2474 305
169 3300048927 Ga0496124_0000166 Ga0496124_0000166_63275_64195 305
170 3300048928 Ga0496125_0000390 Ga0496125_0000390_56586_57506 305
171 3300048929 Ga0496126_0000222 Ga0496126_0000222_59912_60832 305
172 3300053087 Ga0500643_014387 Ga0500643_014387_72_992 305
173 3300053091 Ga0500647_0058302 Ga0500647_0058302_359_1279 305
174 3300053119 Ga0500595_006237 Ga0500595_006237_1023_1943 305
175 3300053130 Ga0500642_0155833 Ga0500642_0155833_107_1027 305
176 3300053177 Ga0500636_0003647 Ga0500636_0003647_5403_6323 305
177 3300053731 Ga0500609_006792 Ga0500609_006792_477_1397 305
178 3300003215 JGI25153J46596_10009212 JGI25153J46596_100092123 306
179 3300003354 JGI25160J50197_1002471 JGI25160J50197_10024712 306
180 3300003771 Ga0055526_1001395 Ga0055526_100139514 306
181 3300003775 Ga0055524_1000327 Ga0055524_100032744 306
182 3300003790 Ga0055528_1001431 Ga0055528_100143114 306
183 3300004625 Ga0055543_1000272 Ga0055543_100027221 306
184 3300005262 Ga0065165_1002770 Ga0065165_100277012 306
185 3300005457 Ga0070662_100002280 Ga0070662_1000022804 306
186 3300005563 Ga0068855_100024228 Ga0068855_1000242283 306
187 3300006177 Ga0075362_10001908 Ga0075362_100019089 306
188 3300006353 Ga0075370_10008696 Ga0075370_100086965 306
189 3300011119 Ga0105246_10001156 Ga0105246_100011565 306
190 3300025273 Ga0209673_1000162 Ga0209673_1000162122 306
191 3300025294 Ga0209025_1059471 Ga0209025_10594711 306
192 3300025295 Ga0209564_1000234 Ga0209564_100023499 306
193 3300025297 Ga0209758_1004490 Ga0209758_10044909 306
194 3300025299 Ga0209256_1000992 Ga0209256_100099212 306
195 3300025302 Ga0207426_1000299 Ga0207426_100029948 306
196 3300025303 Ga0209051_1005014 Ga0209051_10050144 306
197 3300025933 Ga0207706_10002879 Ga0207706_1000287914 306
198 3300037471 Ga0395905_0001284 Ga0395905_0001284_1136_2092 306
199 3300037471 Ga0395905_0003882 Ga0395905_0003882_5727_6686 306
200 3300037853 Ga0436364_0349903 Ga0436364_0349903_2218_3141 306
201 3300046507 Ga0495606_0062703 Ga0495606_0062703_1198_2118 306
202 3300046512 Ga0495610_0003604 Ga0495610_0003604_6238_7158 306
203 3300047472 Ga0495686_0000394 Ga0495686_0000394_11480_12400 306
204 3300048091 Ga0495626_0002972 Ga0495626_0002972_4846_5766 306
205 3300049570 Ga0501033_0080520 Ga0501033_0080520_615_1541 306
206 3300049579 Ga0501043_0372363 Ga0501043_0372363_43_969 306
207 3300050489 nmdc:mga03683_121146_c1 nmdc:mga03683_121146_c1_144_1079 306
208 3300050492 nmdc:mga0yw44_19537_c1 nmdc:mga0yw44_19537_c1_106_1041 306
209 3300050493 nmdc:mga0k408_16981_c1 nmdc:mga0k408_16981_c1_1454_2389 306
210 3300050496 nmdc:mga07m45_3760_c1 nmdc:mga07m45_3760_c1_2595_3530 306
211 3300050516 nmdc:mga0sz30_30986_c1 nmdc:mga0sz30_30986_c1_158_1093 306
212 3300003316 rootH1_10061593 rootH1_100615932 307
213 3300037471 Ga0395905_0001224 Ga0395905_0001224_3002_3940 307
214 3300046452 Ga0495617_055127 Ga0495617_055127_133_1092 307
215 3300046453 Ga0495627_005346 Ga0495627_005346_1291_2250 307
216 3300046512 Ga0495610_0001035 Ga0495610_0001035_13223_14182 307
217 3300046524 Ga0495648_0046994 Ga0495648_0046994_966_1925 307
218 3300047470 Ga0495681_0000036 Ga0495681_0000036_53515_54474 307
219 3300047472 Ga0495686_0001864 Ga0495686_0001864_11674_12633 307
220 3300048924 Ga0496121_0000980 Ga0496121_0000980_25617_26576 307
221 3300048928 Ga0496125_0019161 Ga0496125_0019161_5294_6253 307
222 3300003791 Ga0055530_10018784 Ga0055530_100187842 308
223 3300005335 Ga0070666_10040729 Ga0070666_100407292 308
224 3300005347 Ga0070668_100001604 Ga0070668_1000016041 308
225 3300005347 Ga0070668_100024999 Ga0070668_1000249994 308
226 3300005353 Ga0070669_100286358 Ga0070669_1002863581 308
227 3300005367 Ga0070667_100000103 Ga0070667_10000010341 308
228 3300005841 Ga0068863_100001271 Ga0068863_10000127119 308
229 3300005843 Ga0068860_100020145 Ga0068860_10002014511 308
230 3300006195 Ga0075366_10001073 Ga0075366_100010738 308
231 3300009551 Ga0105238_10363834 Ga0105238_103638343 308
232 3300013307 Ga0157372_10027348 Ga0157372_100273486 308
233 3300013307 Ga0157372_10110053 Ga0157372_101100534 308
234 3300017792 Ga0163161_10039573 Ga0163161_100395733 308
235 3300025298 Ga0209050_1000685 Ga0209050_100068529 308
236 3300025903 Ga0207680_10028238 Ga0207680_100282381 308
237 3300025972 Ga0207668_10000231 Ga0207668_1000023134 308
238 3300025986 Ga0207658_10000080 Ga0207658_1000008065 308
239 3300026088 Ga0207641_10001720 Ga0207641_100017201 308
240 3300028380 Ga0268265_10489236 Ga0268265_104892362 308
241 3300028381 Ga0268264_10028896 Ga0268264_100288962 308
242 3300036401 Ga0373937_0245486 Ga0373937_0245486_299_1246 308
243 3300046506 Ga0495583_0000516 Ga0495583_0000516_36071_37015 308
244 3300046558 Ga0495633_0007864 Ga0495633_0007864_1452_2396 308
245 3300046692 Ga0495671_0000023 Ga0495671_0000023_124589_125533 308
246 3300047469 Ga0495673_0000054 Ga0495673_0000054_124574_125518 308
247 3300048919 Ga0496116_0000153 Ga0496116_0000153_33818_34762 308
248 3300048920 Ga0496117_0068258 Ga0496117_0068258_1049_1993 308
249 3300048921 Ga0496118_0008833 Ga0496118_0008833_3990_4934 308
250 3300048924 Ga0496121_0001411 Ga0496121_0001411_4053_4997 308
251 3300048925 Ga0496122_0000094 Ga0496122_0000094_33818_34762 308
252 3300048926 Ga0496123_0000626 Ga0496123_0000626_24429_25373 308
253 3300048927 Ga0496124_0000316 Ga0496124_0000316_34065_35009 308
254 3300048927 Ga0496124_0000554 Ga0496124_0000554_15692_16636 308
255 3300048927 Ga0496124_0001950 Ga0496124_0001950_20404_21348 308
256 3300048928 Ga0496125_0000285 Ga0496125_0000285_72784_73728 308
257 3300048928 Ga0496125_0185490 Ga0496125_0185490_285_1229 308
258 3300048929 Ga0496126_0000517 Ga0496126_0000517_25630_26574 308
259 3300049705 Ga0501225_0005718 Ga0501225_0005718_157_1083 308
260 3300050493 nmdc:mga0k408_14173_c1 nmdc:mga0k408_14173_c1_3239_4177 308
261 3300053121 Ga0500607_001332 Ga0500607_001332_9220_10149 308
262 iso_pu_bacteria 2599185236 2599723195 308
263 iso_pu_bacteria 2643221637 2644208444 308
264 iso_pu_bacteria 2643221718 2644651696 308
265 iso_pu_bacteria 2818991438 2819554483 308
266 iso_pu_bacteria 8054302542 8054303160 308
267 3300047472 Ga0495686_0003210 Ga0495686_0003210_4230_5180 309
268 3300047472 Ga0495686_0041248 Ga0495686_0041248_111_1079 309
269 3300048920 Ga0496117_0073047 Ga0496117_0073047_143_1099 309
270 3300048921 Ga0496118_0011364 Ga0496118_0011364_844_1800 309
271 3300048927 Ga0496124_0062339 Ga0496124_0062339_1269_2225 309
272 3300005289 Ga0065704_10017009 Ga0065704_100170092 310
273 3300005289 Ga0065704_10080865 Ga0065704_100808653 310
274 3300005331 Ga0070670_100052867 Ga0070670_1000528672 310
275 3300005335 Ga0070666_10226288 Ga0070666_102262882 310
276 3300005347 Ga0070668_100047536 Ga0070668_1000475362 310
277 3300005353 Ga0070669_100012339 Ga0070669_1000123395 310
278 3300005355 Ga0070671_100006450 Ga0070671_1000064503 310
279 3300005355 Ga0070671_100038818 Ga0070671_1000388182 310
280 3300005355 Ga0070671_100244481 Ga0070671_1002444812 310
281 3300005367 Ga0070667_100135205 Ga0070667_1001352052 310
282 3300005548 Ga0070665_100000271 Ga0070665_10000027150 310
283 3300005617 Ga0068859_100011913 Ga0068859_1000119134 310
284 3300005841 Ga0068863_100139774 Ga0068863_1001397742 310
285 3300005842 Ga0068858_100000840 Ga0068858_10000084013 310
286 3300005842 Ga0068858_100038664 Ga0068858_1000386643 310
287 3300005843 Ga0068860_100026685 Ga0068860_1000266855 310
288 3300006177 Ga0075362_10028028 Ga0075362_100280282 310
289 3300006931 Ga0097620_100011913 Ga0097620_1000119134 310
290 3300009011 Ga0105251_10001400 Ga0105251_100014003 310
291 3300009177 Ga0105248_10193518 Ga0105248_101935182 310
292 3300025735 Ga0207713_1006899 Ga0207713_10068994 310
293 3300025923 Ga0207681_10000733 Ga0207681_1000073318 310
294 3300025923 Ga0207681_10107305 Ga0207681_101073051 310
295 3300025931 Ga0207644_10001229 Ga0207644_100012299 310
296 3300025931 Ga0207644_10026942 Ga0207644_100269422 310
297 3300025933 Ga0207706_10024656 Ga0207706_100246564 310
298 3300025941 Ga0207711_10285531 Ga0207711_102855312 310
299 3300025972 Ga0207668_10031827 Ga0207668_100318273 310
300 3300026035 Ga0207703_10000683 Ga0207703_1000068316 310
301 3300026035 Ga0207703_10041593 Ga0207703_100415935 310
302 3300026088 Ga0207641_10009155 Ga0207641_100091553 310
303 3300028380 Ga0268265_10033613 Ga0268265_100336133 310
304 3300028381 Ga0268264_10002784 Ga0268264_100027846 310
305 3300048906 Ga0496103_0053994 Ga0496103_0053994_285_1223 310
306 3300048913 Ga0496110_0143966 Ga0496110_0143966_1050_2006 310
307 3300048919 Ga0496116_0020616 Ga0496116_0020616_1873_2811 310
308 3300048920 Ga0496117_0022383 Ga0496117_0022383_1575_2513 310
309 3300048922 Ga0496119_0013507 Ga0496119_0013507_4929_5867 310
310 3300048924 Ga0496121_0010691 Ga0496121_0010691_6551_7489 310
311 3300048928 Ga0496125_0018823 Ga0496125_0018823_932_1870 310
312 3300048929 Ga0496126_0001248 Ga0496126_0001248_10594_11550 310
313 3300048929 Ga0496126_0022851 Ga0496126_0022851_4756_5694 310
314 3300050489 nmdc:mga03683_23373_c1 nmdc:mga03683_23373_c1_358_1317 310
315 3300001990 JGI24737J22298_10000749 JGI24737J22298_100007496 312
316 3300002067 JGI24735J21928_10005387 JGI24735J21928_100053872 312
317 3300002075 JGI24738J21930_10000786 JGI24738J21930_1000078610 312
318 3300005366 Ga0070659_100006482 Ga0070659_1000064823 312
319 3300005457 Ga0070662_100011375 Ga0070662_1000113756 312
320 3300005539 Ga0068853_100011722 Ga0068853_1000117228 312
321 3300005564 Ga0070664_100003949 Ga0070664_1000039498 312
322 3300009093 Ga0105240_10351292 Ga0105240_103512922 312
323 3300013102 Ga0157371_10136378 Ga0157371_101363782 312
324 3300013105 Ga0157369_10169348 Ga0157369_101693483 312
325 3300025321 Ga0207656_10168050 Ga0207656_101680501 312
326 3300025904 Ga0207647_10023325 Ga0207647_100233253 312
327 3300025913 Ga0207695_10240102 Ga0207695_102401022 312
328 3300025924 Ga0207694_10004600 Ga0207694_100046006 312
329 3300025933 Ga0207706_10031544 Ga0207706_100315442 312
330 3300026041 Ga0207639_10017876 Ga0207639_100178763 312
331 3300026116 Ga0207674_10015267 Ga0207674_100152675 312
332 3300005295 Ga0065707_10151436 Ga0065707_101514362 313
333 3300009978 Ga0105148_100328 Ga0105148_1003282 313
334 3300001989 JGI24739J22299_10006742 JGI24739J22299_100067424 314
335 3300002067 JGI24735J21928_10007776 JGI24735J21928_100077763 314
336 3300005563 Ga0068855_100068920 Ga0068855_1000689205 314
337 3300009093 Ga0105240_10087388 Ga0105240_100873882 314
338 3300009551 Ga0105238_10240674 Ga0105238_102406742 314
339 3300010375 Ga0105239_10057669 Ga0105239_100576692 314
340 3300013104 Ga0157370_10000377 Ga0157370_1000037713 314
341 3300013105 Ga0157369_10116939 Ga0157369_101169392 314
342 3300025321 Ga0207656_10009353 Ga0207656_100093534 314
343 3300025904 Ga0207647_10031922 Ga0207647_100319224 314
344 3300025913 Ga0207695_10064416 Ga0207695_100644162 314
345 3300025924 Ga0207694_10101969 Ga0207694_101019693 314
346 3300025949 Ga0207667_10146387 Ga0207667_101463872 314
347 3300026142 Ga0207698_10248907 Ga0207698_102489072 314
348 3300031548 Ga0307408_100000134 Ga0307408_10000013462 314
349 3300031731 Ga0307405_10000993 Ga0307405_100009932 314
350 3300031852 Ga0307410_10004396 Ga0307410_100043963 314
351 3300031901 Ga0307406_10001698 Ga0307406_100016987 314
352 3300031903 Ga0307407_10097289 Ga0307407_100972891 314
353 3300031911 Ga0307412_10000888 Ga0307412_100008889 314
354 3300031995 Ga0307409_100001207 Ga0307409_1000012076 314
355 3300032002 Ga0307416_100001285 Ga0307416_10000128513 314
356 3300032004 Ga0307414_10005924 Ga0307414_100059244 314
357 3300032005 Ga0307411_10000284 Ga0307411_1000028411 314
358 3300038705 Ga0237819_00743 Ga0237819_00743_8123_9148 314
359 3300039145 Ga0237816_01166 Ga0237816_01166_651_1610 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

64

96

0.94

PF01134

GIDA

Glucose inhibited division protein A

61

139

0.87

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

60

340

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lsk-assembly1.cif.gz_C pyranose 2-oxidase t169s acetate complex 0.9366 8 40
3bg7-assembly2.cif.gz_G pyranose 2-oxidase from trametes multicolor, l537g mutant 0.8989 5 40
2q7v-assembly1.cif.gz_B crystal structure of deinococcus radiodurans thioredoxin reductase 0.896 6 302
4gcm-assembly1.cif.gz_A crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. aureus mu50 at 1.80 a resolution 0.8943 9 302
7aaw-assembly1.cif.gz_B thioredoxin reductase from bacillus cereus 0.8933 6 305
ID Description Score Start End Superfamily
af_Q2G041_6_109_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9435 10 109 3.50.50.60
af_Q39243_53_161_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9435 12 112 3.50.50.60
af_Q58931_2_109_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9265 9 114 3.50.50.60
2cvjA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9177 10 302 3.50.50.60
5uthA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9053 6 302 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0F9DBM0-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9715 9 109 GO:0016491
AF-A0A838JNV1-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9681 6 83 GO:0016491
AF-A0A2M8QJM5-F1-model_v4 Thioredoxin reductase 0.9663 9 301 GO:0016491
AF-A0A350KWK3-F1-model_v4 deleted 0.9635 6 255
AF-A0A7G9SDJ3-F1-model_v4 Thioredoxin reductase 0.9601 6 313 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.62 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map