F421522

General Info

Members Datasets Scaffolds Average Seq Length
359 209 343 261

Family's Representative Sequence

Representative Sequence 3300009765|Ga0123341_1000634|Ga0123341_100063421
Length 284
Sequence MHLPFAHGIHSELLEGRSPLSTVDIAARTGREQDFQSIVRLEKVGKFFGAVEALRDIDIAIGRNEIVGLIGDNGAGKSTLIKVMSGVLAPTSGRIFIRDREVDLSEFSVRMAHDLLIETVYQDRSLADKQPLWRNFFVGRQITNRFGFIDIKKEKEIAAEILKNTIGLRGVGITVDSTVSNLSGGERQGIAIGRAMHYNADLIVLDEPTAALGVAEVRKVIDFVKRIKESGRACIYIEHNLAHVHEVADRLVILDRGAVVAELAPKDMSVTDLTKYLIDLQHKT

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
6 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
10 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
11 2643221629 Devosia sp. Root105 Isolate Unclassified
12 2643221662 Devosia sp. Root413D1 Isolate Unclassified
13 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
14 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
15 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
16 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
137 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
138 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.26
Metatranscriptomes 0.28
Isolates 4.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 1.95
Rhizoplane 1.95
Rhizosphere 86.91
Stem 0
Stem Tuber 0
Unclassified 7.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_228711 2162886012 Bacteria 1317
2 Ga0055529_1010835 3300003763 Bacteria 1180
3 Ga0070658_10051217 3300005327 Bacteria 3346
4 Ga0070683_100590032 3300005329 Bacteria 1063
5 Ga0068869_100035190 3300005334 Bacteria 3548
6 Ga0070680_100548146 3300005336 Bacteria 991
7 Ga0070660_100027343 3300005339 Bacteria 4256
8 Ga0070660_100040695 3300005339 Bacteria 3539
9 Ga0070661_100000849 3300005344 Bacteria 21917
10 Ga0070661_100007868 3300005344 Bacteria 7359
11 Ga0070675_100503864 3300005354 Bacteria 1091
12 Ga0070659_100146741 3300005366 Bacteria 1922
13 Ga0070713_100005976 3300005436 Bacteria 8373
14 Ga0070713_100209238 3300005436 Bacteria 1765
15 Ga0070710_10101399 3300005437 Bacteria 1715
16 Ga0070701_10060179 3300005438 Bacteria 1999
17 Ga0070711_100547496 3300005439 Bacteria 960
18 Ga0070700_100188977 3300005441 Bacteria 1439
19 Ga0070708_100024734 3300005445 Bacteria 5128
20 Ga0070663_100054141 3300005455 Bacteria 2867
21 Ga0070663_100088478 3300005455 Bacteria 2290
22 Ga0070663_100131691 3300005455 Bacteria 1900
23 Ga0070678_100163444 3300005456 Bacteria 1806
24 Ga0070681_10278341 3300005458 Bacteria 1584
25 Ga0070706_100000272 3300005467 Bacteria 62848
26 Ga0070706_100000903 3300005467 Bacteria 32487
27 Ga0070706_100064701 3300005467 Bacteria 3380
28 Ga0070706_100269611 3300005467 Bacteria 1589
29 Ga0070707_100122743 3300005468 Unclassified 2522
30 Ga0070698_100006057 3300005471 Bacteria 13172
31 Ga0070699_100003511 3300005518 Bacteria 13858
32 Ga0070699_100316190 3300005518 Unclassified 1403
33 Ga0070684_100198861 3300005535 Bacteria 1825
34 Ga0070697_100016767 3300005536 Bacteria 5762
35 Ga0068853_100002143 3300005539 Bacteria 14696
36 Ga0068853_100278903 3300005539 Bacteria 1540
37 Ga0070695_100561251 3300005545 Bacteria 891
38 Ga0070696_100298423 3300005546 Bacteria 1233
39 Ga0070693_100051526 3300005547 Bacteria 2357
40 Ga0070693_100120695 3300005547 Bacteria 1625
41 Ga0070665_100179538 3300005548 Bacteria 2118
42 Ga0070704_100301456 3300005549 Unclassified 1335
43 Ga0068855_100022428 3300005563 Bacteria 7569
44 Ga0068855_100053747 3300005563 Bacteria 4737
45 Ga0068855_100060373 3300005563 Bacteria 4434
46 Ga0068857_100181339 3300005577 Bacteria 1916
47 Ga0068854_100007729 3300005578 Bacteria 6873
48 Ga0068854_100251026 3300005578 Bacteria 1412
49 Ga0068856_100049013 3300005614 Bacteria 4163
50 Ga0068856_100265993 3300005614 Bacteria 1730
51 Ga0068852_100004407 3300005616 Bacteria 9949
52 Ga0068866_10394885 3300005718 Bacteria 890
53 Ga0068851_10000213 3300005834 Bacteria 27780
54 Ga0068858_100259111 3300005842 Bacteria 1653
55 Ga0068860_100605933 3300005843 Bacteria 1101
56 Ga0081455_10036781 3300005937 Bacteria 4354
57 Ga0070717_10095645 3300006028 Unclassified 2515
58 Ga0070716_100153065 3300006173 Bacteria 1486
59 Ga0070712_100075365 3300006175 Bacteria 2426
60 Ga0070712_100105008 3300006175 Bacteria 2097
61 Ga0075366_10108196 3300006195 Bacteria 1672
62 Ga0075430_100008579 3300006846 Bacteria 8623
63 Ga0075430_100088010 3300006846 Bacteria 2599
64 Ga0075431_100048481 3300006847 Bacteria 4381
65 Ga0075431_100416857 3300006847 Bacteria 1342
66 Ga0075434_100144768 3300006871 Bacteria 2397
67 Ga0075434_100476902 3300006871 Bacteria 1269
68 Ga0075429_100046207 3300006880 Bacteria 3789
69 Ga0075429_100187393 3300006880 Bacteria 1813
70 Ga0075435_100160590 3300007076 Bacteria 1893
71 Ga0099794_10065824 3300007265 Bacteria 1768
72 Ga0099795_10103957 3300007788 Unclassified 1118
73 Ga0105240_10105758 3300009093 Bacteria 3415
74 Ga0105240_10182014 3300009093 Bacteria 2479
75 Ga0105240_10273192 3300009093 Bacteria 1945
76 Ga0105240_10628280 3300009093 Bacteria 1179
77 Ga0114129_10000821 3300009147 Bacteria 40021
78 Ga0114129_10589776 3300009147 Bacteria 1441
79 Ga0105241_10027452 3300009174 Bacteria 4240
80 Ga0105248_10573045 3300009177 Bacteria 1274
81 Ga0105237_10030285 3300009545 Bacteria 5498
82 Ga0105237_10034479 3300009545 Bacteria 5124
83 Ga0105238_10006301 3300009551 Bacteria 11794
84 Ga0105238_10072894 3300009551 Bacteria 3429
85 Ga0105249_10156683 3300009553 Bacteria 2197
86 Ga0105249_10666414 3300009553 Bacteria 1099
87 Ga0123341_1000634 3300009765 Bacteria 22789
88 Ga0099796_10088234 3300010159 Bacteria 1149
89 Ga0105239_10011077 3300010375 Bacteria 10067
90 Ga0105239_10057522 3300010375 Bacteria 4265
91 Ga0157371_10021730 3300013102 Bacteria 4708
92 Ga0157369_10255567 3300013105 Bacteria 1828
93 Ga0163162_10171150 3300013306 Bacteria 2296
94 Ga0163162_10568746 3300013306 Bacteria 1261
95 Ga0182008_10133645 3300014497 Bacteria 1238
96 Ga0182005_1006495 3300015265 Bacteria 3566
97 Ga0213872_10001802 3300021361 Bacteria 13320
98 Ga0213872_10027554 3300021361 Bacteria 2608
99 Ga0213872_10041628 3300021361 Bacteria 2096
100 Ga0213872_10130488 3300021361 Bacteria 1107
101 Ga0213872_10137109 3300021361 Bacteria 1075
102 Ga0213872_10161325 3300021361 Bacteria 975
103 Ga0213874_10034817 3300021377 Bacteria 1476
104 Ga0213874_10036566 3300021377 Bacteria 1448
105 Ga0213874_10057474 3300021377 Bacteria 1210
106 Ga0213876_10007613 3300021384 Bacteria 5879
107 Ga0213875_10040544 3300021388 Bacteria 2192
108 Ga0213871_10001680 3300021441 Bacteria 3818
109 Ga0213871_10001812 3300021441 Bacteria 3737
110 Ga0213871_10025564 3300021441 Bacteria 1504
111 Ga0209148_1000810 3300025254 Bacteria 22663
112 Ga0209455_1000640 3300025272 Bacteria 21474
113 Ga0207656_10000501 3300025321 Bacteria 12900
114 Ga0207692_10313847 3300025898 Unclassified 957
115 Ga0207699_10191190 3300025906 Unclassified 1381
116 Ga0207705_10035430 3300025909 Bacteria 3570
117 Ga0207684_10000328 3300025910 Bacteria 66708
118 Ga0207684_10001498 3300025910 Bacteria 25082
119 Ga0207684_10033980 3300025910 Unclassified 4336
120 Ga0207684_10221902 3300025910 Unclassified 1631
121 Ga0207695_10250258 3300025913 Bacteria 1671
122 Ga0207671_10017903 3300025914 Bacteria 5449
123 Ga0207693_10235970 3300025915 Bacteria 1436
124 Ga0207657_10003868 3300025919 Bacteria 15893
125 Ga0207657_10033068 3300025919 Bacteria 4666
126 Ga0207649_10002031 3300025920 Bacteria 11514
127 Ga0207649_10128643 3300025920 Bacteria 1717
128 Ga0207646_10013334 3300025922 Bacteria 7863
129 Ga0207646_10049310 3300025922 Bacteria 3772
130 Ga0207646_10360397 3300025922 Bacteria 1314
131 Ga0207694_10241465 3300025924 Bacteria 1476
132 Ga0207700_10157665 3300025928 Bacteria 1882
133 Ga0207700_10182023 3300025928 Bacteria 1760
134 Ga0207690_10032680 3300025932 Bacteria 3340
135 Ga0207690_10052586 3300025932 Bacteria 2729
136 Ga0207690_10101583 3300025932 Bacteria 2055
137 Ga0207709_10664304 3300025935 Bacteria 831
138 Ga0207665_10010157 3300025939 Bacteria 6179
139 Ga0207679_10635843 3300025945 Bacteria 964
140 Ga0207667_10007039 3300025949 Bacteria 13590
141 Ga0207667_10009811 3300025949 Bacteria 11252
142 Ga0207667_10759861 3300025949 Bacteria 968
143 Ga0207640_10017972 3300025981 Bacteria 4146
144 Ga0207703_10232613 3300026035 Bacteria 1653
145 Ga0207639_10020968 3300026041 Bacteria 4687
146 Ga0207639_10798885 3300026041 Bacteria 879
147 Ga0207678_10030448 3300026067 Bacteria 4711
148 Ga0207678_10054946 3300026067 Bacteria 3429
149 Ga0207708_10293129 3300026075 Bacteria 1321
150 Ga0207702_10032533 3300026078 Bacteria 4352
151 Ga0207683_10125106 3300026121 Bacteria 2310
152 Ga0207698_10005255 3300026142 Bacteria 7967
153 Ga0268266_10173418 3300028379 Bacteria 1959
154 Ga0268264_10628006 3300028381 Bacteria 1061
155 Ga0265326_10061728 3300028558 Bacteria 1060
156 Ga0265334_10004147 3300028573 Bacteria 6495
157 Ga0265318_10070504 3300028577 Bacteria 1295
158 Ga0265322_10023192 3300028654 Bacteria 1775
159 Ga0265338_10014180 3300028800 Bacteria 8902
160 Ga0265338_10066670 3300028800 Bacteria 3114
161 Ga0265330_10048437 3300031235 Bacteria 1869
162 Ga0265332_10013121 3300031238 Bacteria 3672
163 Ga0265320_10015917 3300031240 Bacteria 4233
164 Ga0265320_10022993 3300031240 Bacteria 3326
165 Ga0265325_10012299 3300031241 Bacteria 4897
166 Ga0265340_10006213 3300031247 Bacteria 6583
167 Ga0265340_10078217 3300031247 Bacteria 1560
168 Ga0265340_10091731 3300031247 Bacteria 1419
169 Ga0265340_10114502 3300031247 Bacteria 1244
170 Ga0265339_10081392 3300031249 Bacteria 1711
171 Ga0265331_10080099 3300031250 Bacteria 1518
172 Ga0265316_10000646 3300031344 Bacteria 38773
173 Ga0265316_10003899 3300031344 Bacteria 14946
174 Ga0265316_10024909 3300031344 Bacteria 5001
175 Ga0265316_10093582 3300031344 Bacteria 2290
176 Ga0265316_10111228 3300031344 Bacteria 2074
177 Ga0265313_10006009 3300031595 Bacteria 8768
178 Ga0265313_10052247 3300031595 Bacteria 1951
179 Ga0265314_10013096 3300031711 Bacteria 6720
180 Ga0265342_10000286 3300031712 Bacteria 57224
181 Ga0265342_10020249 3300031712 Bacteria 4272
182 Ga0265342_10221701 3300031712 Bacteria 1018
183 Ga0316576_10219424 3300031727 Bacteria 1431
184 Ga0316576_10224396 3300031727 Bacteria 1413
185 Ga0316578_10038366 3300031728 Bacteria 2762
186 Ga0316577_10003921 3300031733 Bacteria 7597
187 Ga0316577_10009230 3300031733 Bacteria 5304
188 Ga0316577_10010992 3300031733 Bacteria 4897
189 Ga0316585_10024825 3300032137 Bacteria 1856
190 Ga0316596_1076281 3300033541 Bacteria 899
191 Ga0373933_0157786 3300035724 Bacteria 1440
192 Ga0316582_0000899 3300036647 Bacteria 12205
193 Ga0316582_0004057 3300036647 Bacteria 7319
194 Ga0316582_0006382 3300036647 Bacteria 6183
195 Ga0316582_0132318 3300036647 Bacteria 1676
196 Ga0316584_0021212 3300036712 Bacteria 4718
197 Ga0373925_0524889 3300037068 Bacteria 973
198 Ga0395900_0217008 3300037418 Bacteria 1930
199 Ga0395898_0430300 3300037466 Bacteria 1257
200 Ga0395905_0604052 3300037471 Bacteria 999
201 Ga0436364_0270841 3300037853 Bacteria 3919
202 Ga0436364_0417041 3300037853 Unclassified 3944
203 Ga0436364_0680564 3300037853 Bacteria 1061
204 Ga0436364_0823782 3300037853 Bacteria 2179
205 Ga0395901_0546335 3300038443 Bacteria 1174
206 Ga0400483_142555 3300039062 Bacteria 6187
207 Ga0400483_273622 3300039062 Bacteria 3119
208 Ga0436365_0274631 3300039437 Bacteria 71187
209 Ga0436365_1444938 3300039437 Bacteria 9574
210 Ga0436360_0104681 3300039438 Bacteria 3882
211 Ga0436360_0130922 3300039438 Bacteria 1312
212 Ga0436360_0563391 3300039438 Bacteria 6704
213 Ga0436360_0574478 3300039438 Bacteria 3821
214 Ga0436360_0740600 3300039438 Bacteria 2687
215 Ga0436360_0870159 3300039438 Bacteria 6414
216 Ga0436361_0058985 3300039447 Bacteria 4178
217 Ga0436361_0199913 3300039447 Bacteria 2865
218 Ga0436361_0339872 3300039447 Bacteria 2531
219 Ga0436361_0625410 3300039447 Bacteria 1087
220 Ga0436361_0636144 3300039447 Bacteria 4151
221 Ga0436361_0727404 3300039447 Bacteria 8019
222 Ga0436361_0911193 3300039447 Unclassified 3474
223 Ga0436361_0970645 3300039447 Bacteria 1503
224 Ga0436361_1023310 3300039447 Bacteria 1019
225 Ga0436361_1027516 3300039447 Bacteria 1940
226 Ga0436363_0008853 3300039450 Bacteria 2258
227 Ga0436363_0379554 3300039450 Bacteria 3346
228 Ga0436363_1073760 3300039450 Bacteria 9526
229 Ga0436363_1712984 3300039450 Bacteria 3390
230 Ga0436362_0737857 3300039453 Bacteria 801
231 Ga0436362_0885251 3300039453 Bacteria 1040
232 Ga0436362_0907623 3300039453 Unclassified 1237
233 Ga0436362_0929478 3300039453 Bacteria 3157
234 Ga0436362_1157666 3300039453 Bacteria 2798
235 Ga0451577_0073858 3300042876 Bacteria 3042
236 Ga0453683_0015653 3300044673 Bacteria 4907
237 Ga0466966_0144468 3300044684 Bacteria 1452
238 Ga0453684_0000007 3300044712 Bacteria 1301482
239 Ga0453684_0018476 3300044712 Bacteria 10698
240 Ga0466971_0103633 3300044719 Bacteria 1309
241 Ga0466959_0006458 3300045049 Bacteria 8121
242 Ga0451576_0244872 3300045051 Bacteria 1873
243 Ga0495580_0221870 3300046472 Bacteria 1299
244 Ga0495643_0002544 3300046522 Bacteria 14270
245 Ga0495687_010784 3300047443 Bacteria 4975
246 Ga0496100_0221111 3300048903 Bacteria 1390
247 Ga0496106_0333629 3300048909 Bacteria 1218
248 Ga0496107_0148467 3300048910 Bacteria 1734
249 Ga0496108_0192957 3300048911 Bacteria 1766
250 Ga0496110_0192063 3300048913 Bacteria 1854
251 Ga0496111_0141465 3300048914 Bacteria 1783
252 Ga0496115_0080486 3300048918 Bacteria 2652
253 Ga0496126_0118106 3300048929 Bacteria 2303
254 Ga0501031_0012717 3300049568 Bacteria 5498
255 Ga0501031_0064927 3300049568 Bacteria 2378
256 Ga0501031_0112361 3300049568 Bacteria 1779
257 Ga0501032_0168973 3300049569 Bacteria 1434
258 Ga0501033_0003325 3300049570 Bacteria 13280
259 Ga0501033_0043960 3300049570 Bacteria 3325
260 Ga0501033_0200899 3300049570 Bacteria 1424
261 Ga0501034_0022001 3300049571 Bacteria 6495
262 Ga0501034_0058340 3300049571 Bacteria 3879
263 Ga0501034_0150391 3300049571 Bacteria 2304
264 Ga0501034_0499903 3300049571 Bacteria 1130
265 Ga0501034_0534839 3300049571 Bacteria 1082
266 Ga0501034_0584492 3300049571 Bacteria 1023
267 Ga0501036_0024975 3300049572 Bacteria 5040
268 Ga0501036_0081156 3300049572 Bacteria 2741
269 Ga0501036_0497856 3300049572 Bacteria 1014
270 Ga0501037_0034996 3300049573 Bacteria 3705
271 Ga0501037_0081941 3300049573 Bacteria 2339
272 Ga0501037_0095704 3300049573 Bacteria 2146
273 Ga0501037_0224331 3300049573 Bacteria 1321
274 Ga0501038_0001099 3300049574 Bacteria 24480
275 Ga0501038_0048987 3300049574 Bacteria 3654
276 Ga0501039_0088621 3300049575 Bacteria 2410
277 Ga0501041_0201493 3300049577 Bacteria 1248
278 Ga0501042_0267962 3300049578 Bacteria 1233
279 Ga0501043_0012453 3300049579 Bacteria 6654
280 Ga0501046_0004964 3300049580 Bacteria 11940
281 Ga0501046_0040979 3300049580 Bacteria 3698
282 Ga0501046_0170799 3300049580 Bacteria 1632
283 Ga0501046_0199044 3300049580 Bacteria 1491
284 Ga0501047_0033947 3300049581 Bacteria 4925
285 Ga0501047_0203080 3300049581 Bacteria 1842
286 Ga0501047_0234052 3300049581 Bacteria 1689
287 Ga0501047_0326074 3300049581 Bacteria 1374
288 Ga0501068_0019170 3300049584 Bacteria 3969
289 Ga0501068_0140713 3300049584 Bacteria 1513
290 Ga0501069_0002061 3300049585 Bacteria 10103
291 Ga0501069_0180443 3300049585 Bacteria 1220
292 Ga0501069_0333708 3300049585 Bacteria 892
293 Ga0501070_0000382 3300049586 Bacteria 40489
294 Ga0501070_0076460 3300049586 Bacteria 2772
295 Ga0501070_0083320 3300049586 Bacteria 2647
296 Ga0501070_0154687 3300049586 Bacteria 1891
297 Ga0501070_0229955 3300049586 Bacteria 1519
298 Ga0501071_0175132 3300049587 Bacteria 1607
299 Ga0501072_0059268 3300049588 Bacteria 3018
300 Ga0501073_0000489 3300049589 Bacteria 27601
301 Ga0501073_0025814 3300049589 Bacteria 4209
302 Ga0501073_0040674 3300049589 Bacteria 3288
303 Ga0501073_0093503 3300049589 Bacteria 2089
304 Ga0501074_0004900 3300049590 Bacteria 9598
305 Ga0501074_0007518 3300049590 Bacteria 7884
306 Ga0501074_0124261 3300049590 Bacteria 1845
307 Ga0501074_0499241 3300049590 Bacteria 862
308 Ga0501076_0142385 3300049592 Bacteria 1949
309 Ga0501076_0191688 3300049592 Bacteria 1668
310 Ga0501076_0231442 3300049592 Bacteria 1511
311 Ga0501080_0014554 3300049742 Bacteria 7247
312 Ga0501080_0018852 3300049742 Bacteria 6388
313 Ga0501080_0083831 3300049742 Bacteria 2962
314 Ga0501080_0228938 3300049742 Bacteria 1699
315 Ga0501080_0241142 3300049742 Bacteria 1650
316 Ga0501081_0031843 3300049743 Bacteria 3575
317 Ga0501083_0002162 3300049744 Bacteria 13479
318 Ga0501083_0041042 3300049744 Bacteria 3139
319 Ga0501083_0078416 3300049744 Bacteria 2191
320 Ga0501035_0014513 3300049822 Bacteria 7270
321 Ga0501035_0014883 3300049822 Bacteria 7179
322 Ga0501035_0148119 3300049822 Bacteria 2038
323 Ga0501044_0002719 3300049823 Bacteria 20109
324 Ga0501044_0049870 3300049823 Bacteria 4321
325 Ga0501044_0129407 3300049823 Bacteria 2519
326 Ga0501045_0121747 3300049824 Bacteria 1937
327 nmdc:mga05p37_100900_c1 3300050507 Bacteria 3555
328 nmdc:mga05p37_229755_c1 3300050507 Bacteria 2236
329 nmdc:mga09592_175947_c1 3300050508 Bacteria 1851
330 nmdc:mga0qj67_166892_c1 3300050509 Bacteria 1787
331 nmdc:mga0qj67_58027_c1 3300050509 Bacteria 3069
332 nmdc:mga06r32_17238_c1 3300050510 Bacteria 6593
333 nmdc:mga06r32_29818_c1 3300050510 Bacteria 5117
334 nmdc:mga0n895_483491_c1 3300050512 Bacteria 1248
335 nmdc:mga0n895_871154_c1 3300050512 Bacteria 887
336 Ga0500559_0107838 3300053136 Bacteria 1288
337 Ga0500616_0136941 3300053153 Bacteria 1149
338 Ga0501084_0198570 3300054114 Bacteria 1692
339 Ga0501084_0381263 3300054114 Bacteria 1191
340 Ga0501084_0552355 3300054114 Bacteria 973
341 Ga0501082_0012484 3300060353 Bacteria 7298
342 Ga0530510_0151184 3300061734 Bacteria 1714
343 Ga0530510_0405843 3300061734 Bacteria 1028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0737857 Ga0436362_0737857_57_731 220
2 3300044712 Ga0453684_0018476 Ga0453684_0018476_8832_9584 231
3 3300049581 Ga0501047_0234052 Ga0501047_0234052_957_1661 234
4 3300025935 Ga0207709_10664304 Ga0207709_106643041 237
5 3300005467 Ga0070706_100064701 Ga0070706_1000647013 239
6 3300013306 Ga0163162_10568746 Ga0163162_105687461 239
7 3300025922 Ga0207646_10360397 Ga0207646_103603972 239
8 3300028381 Ga0268264_10628006 Ga0268264_106280061 239
9 3300039453 Ga0436362_0885251 Ga0436362_0885251_249_980 239
10 3300005436 Ga0070713_100005976 Ga0070713_1000059764 240
11 3300006175 Ga0070712_100105008 Ga0070712_1001050082 240
12 3300013306 Ga0163162_10171150 Ga0163162_101711502 240
13 3300028573 Ga0265334_10004147 Ga0265334_100041474 243
14 3300028800 Ga0265338_10066670 Ga0265338_100666703 243
15 3300031240 Ga0265320_10015917 Ga0265320_100159173 243
16 3300031250 Ga0265331_10080099 Ga0265331_100800992 243
17 3300031344 Ga0265316_10093582 Ga0265316_100935822 243
18 3300005467 Ga0070706_100000272 Ga0070706_1000002722 244
19 3300005467 Ga0070706_100269611 Ga0070706_1002696112 244
20 3300021361 Ga0213872_10161325 Ga0213872_101613251 244
21 3300021377 Ga0213874_10034817 Ga0213874_100348172 244
22 3300021441 Ga0213871_10025564 Ga0213871_100255642 244
23 3300025910 Ga0207684_10000328 Ga0207684_100003285 244
24 3300025922 Ga0207646_10049310 Ga0207646_100493103 244
25 3300025939 Ga0207665_10010157 Ga0207665_100101572 244
26 3300039447 Ga0436361_0970645 Ga0436361_0970645_314_1066 244
27 3300039450 Ga0436363_0008853 Ga0436363_0008853_363_1097 244
28 3300044673 Ga0453683_0015653 Ga0453683_0015653_3425_4177 244
29 3300049571 Ga0501034_0499903 Ga0501034_0499903_368_1120 244
30 3300049578 Ga0501042_0267962 Ga0501042_0267962_38_784 244
31 3300061734 Ga0530510_0405843 Ga0530510_0405843_188_955 244
32 3300005467 Ga0070706_100000903 Ga0070706_10000090311 245
33 3300025910 Ga0207684_10001498 Ga0207684_1000149813 245
34 3300021361 Ga0213872_10130488 Ga0213872_101304882 246
35 3300039438 Ga0436360_0740600 Ga0436360_0740600_153_905 246
36 3300039447 Ga0436361_1027516 Ga0436361_1027516_161_913 246
37 3300005471 Ga0070698_100006057 Ga0070698_10000605714 247
38 3300005536 Ga0070697_100016767 Ga0070697_1000167675 247
39 3300006173 Ga0070716_100153065 Ga0070716_1001530651 247
40 3300006175 Ga0070712_100075365 Ga0070712_1000753653 247
41 3300021361 Ga0213872_10041628 Ga0213872_100416283 247
42 3300021361 Ga0213872_10137109 Ga0213872_101371091 247
43 3300021384 Ga0213876_10007613 Ga0213876_100076134 247
44 3300021441 Ga0213871_10001680 Ga0213871_100016806 247
45 3300025915 Ga0207693_10235970 Ga0207693_102359702 247
46 3300025922 Ga0207646_10013334 Ga0207646_100133347 247
47 3300025928 Ga0207700_10182023 Ga0207700_101820232 247
48 3300039437 Ga0436365_0274631 Ga0436365_0274631_313_1068 247
49 3300039438 Ga0436360_0104681 Ga0436360_0104681_2763_3518 247
50 3300039438 Ga0436360_0574478 Ga0436360_0574478_2563_3318 247
51 3300039447 Ga0436361_0636144 Ga0436361_0636144_2015_2770 247
52 3300039447 Ga0436361_1023310 Ga0436361_1023310_160_918 247
53 iso_pu_bacteria 2643221629 2644165577 248
54 iso_pu_bacteria 2643221662 2644351056 248
55 3300037853 Ga0436364_0823782 Ga0436364_0823782_1278_2039 251
56 iso_pu_bacteria 2939669807 2939673023 251
57 3300048929 Ga0496126_0118106 Ga0496126_0118106_212_985 252
58 iso_pu_bacteria 2979742915 2979752040 253
59 3300003763 Ga0055529_1010835 Ga0055529_10108352 255
60 3300005334 Ga0068869_100035190 Ga0068869_1000351901 255
61 3300005336 Ga0070680_100548146 Ga0070680_1005481461 255
62 3300005354 Ga0070675_100503864 Ga0070675_1005038641 255
63 3300005438 Ga0070701_10060179 Ga0070701_100601792 255
64 3300005441 Ga0070700_100188977 Ga0070700_1001889771 255
65 3300005456 Ga0070678_100163444 Ga0070678_1001634442 255
66 3300005518 Ga0070699_100003511 Ga0070699_1000035113 255
67 3300005539 Ga0068853_100278903 Ga0068853_1002789031 255
68 3300005545 Ga0070695_100561251 Ga0070695_1005612511 255
69 3300005547 Ga0070693_100051526 Ga0070693_1000515262 255
70 3300005548 Ga0070665_100179538 Ga0070665_1001795382 255
71 3300005577 Ga0068857_100181339 Ga0068857_1001813391 255
72 3300005614 Ga0068856_100049013 Ga0068856_1000490134 255
73 3300005718 Ga0068866_10394885 Ga0068866_103948851 255
74 3300005843 Ga0068860_100605933 Ga0068860_1006059332 255
75 3300007076 Ga0075435_100160590 Ga0075435_1001605901 255
76 3300007265 Ga0099794_10065824 Ga0099794_100658242 255
77 3300009553 Ga0105249_10156683 Ga0105249_101566833 255
78 3300010375 Ga0105239_10057522 Ga0105239_100575224 255
79 3300025254 Ga0209148_1000810 Ga0209148_10008106 255
80 3300025272 Ga0209455_1000640 Ga0209455_100064012 255
81 3300025932 Ga0207690_10101583 Ga0207690_101015832 255
82 3300025945 Ga0207679_10635843 Ga0207679_106358431 255
83 3300026041 Ga0207639_10798885 Ga0207639_107988851 255
84 3300026075 Ga0207708_10293129 Ga0207708_102931291 255
85 3300026121 Ga0207683_10125106 Ga0207683_101251063 255
86 3300028379 Ga0268266_10173418 Ga0268266_101734182 255
87 3300050512 nmdc:mga0n895_483491_c1 nmdc:mga0n895_483491_c1_260_1042 255
88 3300005329 Ga0070683_100590032 Ga0070683_1005900322 256
89 3300005614 Ga0068856_100265993 Ga0068856_1002659932 256
90 3300005937 Ga0081455_10036781 Ga0081455_100367812 256
91 3300006846 Ga0075430_100008579 Ga0075430_1000085799 256
92 3300006847 Ga0075431_100048481 Ga0075431_1000484814 256
93 3300006880 Ga0075429_100187393 Ga0075429_1001873932 256
94 3300009093 Ga0105240_10182014 Ga0105240_101820141 256
95 3300009093 Ga0105240_10273192 Ga0105240_102731922 256
96 3300009545 Ga0105237_10034479 Ga0105237_100344792 256
97 3300014497 Ga0182008_10133645 Ga0182008_101336452 256
98 3300021377 Ga0213874_10057474 Ga0213874_100574741 256
99 3300025913 Ga0207695_10250258 Ga0207695_102502582 256
100 3300028558 Ga0265326_10061728 Ga0265326_100617281 256
101 3300028654 Ga0265322_10023192 Ga0265322_100231922 256
102 3300028800 Ga0265338_10014180 Ga0265338_100141805 256
103 3300031238 Ga0265332_10013121 Ga0265332_100131212 256
104 3300031240 Ga0265320_10022993 Ga0265320_100229932 256
105 3300031247 Ga0265340_10114502 Ga0265340_101145022 256
106 3300031344 Ga0265316_10000646 Ga0265316_1000064630 256
107 3300031344 Ga0265316_10003899 Ga0265316_100038996 256
108 3300031712 Ga0265342_10000286 Ga0265342_100002869 256
109 3300031712 Ga0265342_10221701 Ga0265342_102217011 256
110 3300031727 Ga0316576_10219424 Ga0316576_102194242 256
111 3300031727 Ga0316576_10224396 Ga0316576_102243962 256
112 3300031728 Ga0316578_10038366 Ga0316578_100383662 256
113 3300031733 Ga0316577_10003921 Ga0316577_100039216 256
114 3300031733 Ga0316577_10009230 Ga0316577_100092305 256
115 3300031733 Ga0316577_10010992 Ga0316577_100109923 256
116 3300032137 Ga0316585_10024825 Ga0316585_100248252 256
117 3300033541 Ga0316596_1076281 Ga0316596_10762811 256
118 3300036647 Ga0316582_0000899 Ga0316582_0000899_364_1152 256
119 3300036647 Ga0316582_0004057 Ga0316582_0004057_3436_4224 256
120 3300036647 Ga0316582_0006382 Ga0316582_0006382_552_1340 256
121 3300036647 Ga0316582_0132318 Ga0316582_0132318_167_955 256
122 3300037418 Ga0395900_0217008 Ga0395900_0217008_735_1517 256
123 3300039447 Ga0436361_0625410 Ga0436361_0625410_72_884 256
124 3300039450 Ga0436363_0379554 Ga0436363_0379554_558_1328 256
125 3300039453 Ga0436362_0929478 Ga0436362_0929478_1549_2319 256
126 3300042876 Ga0451577_0073858 Ga0451577_0073858_1349_2137 256
127 3300044712 Ga0453684_0000007 Ga0453684_0000007_1215567_1216355 256
128 3300045051 Ga0451576_0244872 Ga0451576_0244872_1053_1835 256
129 3300048903 Ga0496100_0221111 Ga0496100_0221111_507_1277 256
130 3300048909 Ga0496106_0333629 Ga0496106_0333629_209_979 256
131 3300048910 Ga0496107_0148467 Ga0496107_0148467_437_1207 256
132 3300048911 Ga0496108_0192957 Ga0496108_0192957_220_1005 256
133 3300048913 Ga0496110_0192063 Ga0496110_0192063_922_1692 256
134 3300048914 Ga0496111_0141465 Ga0496111_0141465_951_1721 256
135 3300048918 Ga0496115_0080486 Ga0496115_0080486_1787_2557 256
136 3300049570 Ga0501033_0003325 Ga0501033_0003325_5773_6579 256
137 3300049571 Ga0501034_0022001 Ga0501034_0022001_5305_6111 256
138 3300049572 Ga0501036_0024975 Ga0501036_0024975_3750_4556 256
139 3300049573 Ga0501037_0034996 Ga0501037_0034996_2572_3378 256
140 3300049574 Ga0501038_0001099 Ga0501038_0001099_22559_23365 256
141 3300049577 Ga0501041_0201493 Ga0501041_0201493_362_1144 256
142 3300049579 Ga0501043_0012453 Ga0501043_0012453_1197_2003 256
143 3300049580 Ga0501046_0004964 Ga0501046_0004964_7442_8248 256
144 3300049585 Ga0501069_0002061 Ga0501069_0002061_5782_6588 256
145 3300049586 Ga0501070_0000382 Ga0501070_0000382_38448_39254 256
146 3300049589 Ga0501073_0000489 Ga0501073_0000489_12120_12926 256
147 3300049590 Ga0501074_0004900 Ga0501074_0004900_4497_5303 256
148 3300049742 Ga0501080_0018852 Ga0501080_0018852_3883_4689 256
149 3300049744 Ga0501083_0002162 Ga0501083_0002162_6702_7508 256
150 3300049822 Ga0501035_0014513 Ga0501035_0014513_493_1299 256
151 3300049823 Ga0501044_0002719 Ga0501044_0002719_6574_7380 256
152 3300050508 nmdc:mga09592_175947_c1 nmdc:mga09592_175947_c1_199_984 256
153 3300050509 nmdc:mga0qj67_58027_c1 nmdc:mga0qj67_58027_c1_1559_2344 256
154 3300050510 nmdc:mga06r32_29818_c1 nmdc:mga06r32_29818_c1_1221_2006 256
155 3300053136 Ga0500559_0107838 Ga0500559_0107838_323_1102 256
156 3300054114 Ga0501084_0198570 Ga0501084_0198570_120_926 256
157 3300060353 Ga0501082_0012484 Ga0501082_0012484_2409_3215 256
158 3300005842 Ga0068858_100259111 Ga0068858_1002591112 257
159 3300021361 Ga0213872_10027554 Ga0213872_100275543 257
160 3300021388 Ga0213875_10040544 Ga0213875_100405442 257
161 3300021441 Ga0213871_10001812 Ga0213871_100018123 257
162 3300026035 Ga0207703_10232613 Ga0207703_102326132 257
163 3300037853 Ga0436364_0270841 Ga0436364_0270841_2636_3409 257
164 3300039438 Ga0436360_0563391 Ga0436360_0563391_3661_4434 257
165 3300039438 Ga0436360_0870159 Ga0436360_0870159_2287_3060 257
166 3300039447 Ga0436361_0058985 Ga0436361_0058985_841_1614 257
167 3300039447 Ga0436361_0339872 Ga0436361_0339872_93_866 257
168 3300039453 Ga0436362_1157666 Ga0436362_1157666_1965_2738 257
169 iso_pu_bacteria 2512047030 2512346681 257
170 3300005339 Ga0070660_100040695 Ga0070660_1000406951 258
171 3300005344 Ga0070661_100007868 Ga0070661_1000078685 258
172 3300005366 Ga0070659_100146741 Ga0070659_1001467412 258
173 3300005437 Ga0070710_10101399 Ga0070710_101013992 258
174 3300005439 Ga0070711_100547496 Ga0070711_1005474961 258
175 3300005445 Ga0070708_100024734 Ga0070708_1000247343 258
176 3300005468 Ga0070707_100122743 Ga0070707_1001227433 258
177 3300005518 Ga0070699_100316190 Ga0070699_1003161901 258
178 3300005549 Ga0070704_100301456 Ga0070704_1003014562 258
179 3300005563 Ga0068855_100053747 Ga0068855_1000537472 258
180 3300005578 Ga0068854_100251026 Ga0068854_1002510262 258
181 3300006028 Ga0070717_10095645 Ga0070717_100956453 258
182 3300007788 Ga0099795_10103957 Ga0099795_101039571 258
183 3300009093 Ga0105240_10105758 Ga0105240_101057584 258
184 3300009093 Ga0105240_10628280 Ga0105240_106282802 258
185 3300009174 Ga0105241_10027452 Ga0105241_100274524 258
186 3300009551 Ga0105238_10072894 Ga0105238_100728942 258
187 3300009553 Ga0105249_10666414 Ga0105249_106664141 258
188 3300013102 Ga0157371_10021730 Ga0157371_100217302 258
189 3300013105 Ga0157369_10255567 Ga0157369_102555671 258
190 3300015265 Ga0182005_1006495 Ga0182005_10064952 258
191 3300021361 Ga0213872_10001802 Ga0213872_100018024 258
192 3300021377 Ga0213874_10036566 Ga0213874_100365661 258
193 3300025898 Ga0207692_10313847 Ga0207692_103138472 258
194 3300025906 Ga0207699_10191190 Ga0207699_101911902 258
195 3300025910 Ga0207684_10033980 Ga0207684_100339804 258
196 3300025910 Ga0207684_10221902 Ga0207684_102219022 258
197 3300025919 Ga0207657_10033068 Ga0207657_100330684 258
198 3300025920 Ga0207649_10128643 Ga0207649_101286433 258
199 3300025924 Ga0207694_10241465 Ga0207694_102414652 258
200 3300025932 Ga0207690_10032680 Ga0207690_100326803 258
201 3300025949 Ga0207667_10009811 Ga0207667_100098112 258
202 3300026078 Ga0207702_10032533 Ga0207702_100325336 258
203 3300036712 Ga0316584_0021212 Ga0316584_0021212_1487_2317 258
204 3300037466 Ga0395898_0430300 Ga0395898_0430300_392_1177 258
205 3300037853 Ga0436364_0417041 Ga0436364_0417041_63_863 258
206 3300038443 Ga0395901_0546335 Ga0395901_0546335_135_920 258
207 3300039438 Ga0436360_0130922 Ga0436360_0130922_341_1180 258
208 3300039447 Ga0436361_0199913 Ga0436361_0199913_1893_2687 258
209 3300039447 Ga0436361_0727404 Ga0436361_0727404_4957_5751 258
210 3300039447 Ga0436361_0911193 Ga0436361_0911193_2359_3153 258
211 3300039450 Ga0436363_1073760 Ga0436363_1073760_516_1316 258
212 3300039453 Ga0436362_0907623 Ga0436362_0907623_29_823 258
213 3300049568 Ga0501031_0064927 Ga0501031_0064927_1334_2143 258
214 3300049572 Ga0501036_0497856 Ga0501036_0497856_85_894 258
215 3300049573 Ga0501037_0095704 Ga0501037_0095704_322_1104 258
216 3300049573 Ga0501037_0224331 Ga0501037_0224331_300_1109 258
217 3300049575 Ga0501039_0088621 Ga0501039_0088621_594_1403 258
218 3300049580 Ga0501046_0199044 Ga0501046_0199044_85_894 258
219 3300049581 Ga0501047_0326074 Ga0501047_0326074_292_1074 258
220 3300049586 Ga0501070_0076460 Ga0501070_0076460_885_1667 258
221 3300049587 Ga0501071_0175132 Ga0501071_0175132_547_1395 258
222 3300049588 Ga0501072_0059268 Ga0501072_0059268_247_1056 258
223 3300049589 Ga0501073_0093503 Ga0501073_0093503_163_945 258
224 3300049590 Ga0501074_0499241 Ga0501074_0499241_23_805 258
225 3300049592 Ga0501076_0191688 Ga0501076_0191688_274_1083 258
226 3300049592 Ga0501076_0231442 Ga0501076_0231442_142_999 258
227 3300049742 Ga0501080_0083831 Ga0501080_0083831_1164_1973 258
228 3300049742 Ga0501080_0228938 Ga0501080_0228938_145_927 258
229 3300049743 Ga0501081_0031843 Ga0501081_0031843_1860_2669 258
230 3300049822 Ga0501035_0148119 Ga0501035_0148119_1148_1957 258
231 3300049824 Ga0501045_0121747 Ga0501045_0121747_268_1077 258
232 3300061734 Ga0530510_0151184 Ga0530510_0151184_71_880 258
233 iso_pu_bacteria 2501025501 2501076095 258
234 iso_pu_bacteria 2501025504 2501409588 258
235 iso_pu_bacteria 2510917014 2511099118 258
236 iso_pu_bacteria 2510917015 2511108777 258
237 iso_pu_bacteria 2513237082 2513557609 258
238 iso_pu_bacteria 2513237083 2513565662 258
239 iso_pu_bacteria 2515154122 2515682317 258
240 iso_pu_bacteria 2515154189 2516019162 258
241 iso_pu_bacteria 2883087390 2883087799 258
242 iso_pu_bacteria 2902682994 2902690709 258
243 iso_pu_bacteria 8003955200 8003961138 258
244 3300006847 Ga0075431_100416857 Ga0075431_1004168572 259
245 3300006880 Ga0075429_100046207 Ga0075429_1000462073 259
246 3300009147 Ga0114129_10000821 Ga0114129_100008213 259
247 3300037471 Ga0395905_0604052 Ga0395905_0604052_151_930 259
248 3300050507 nmdc:mga05p37_100900_c1 nmdc:mga05p37_100900_c1_2090_2875 259
249 3300050510 nmdc:mga06r32_17238_c1 nmdc:mga06r32_17238_c1_2982_3767 259
250 3300010159 Ga0099796_10088234 Ga0099796_100882342 260
251 3300035724 Ga0373933_0157786 Ga0373933_0157786_608_1393 260
252 3300037068 Ga0373925_0524889 Ga0373925_0524889_53_838 260
253 3300044684 Ga0466966_0144468 Ga0466966_0144468_228_1010 260
254 3300044719 Ga0466971_0103633 Ga0466971_0103633_369_1151 260
255 3300045049 Ga0466959_0006458 Ga0466959_0006458_1354_2136 260
256 3300046472 Ga0495580_0221870 Ga0495580_0221870_172_957 260
257 3300049572 Ga0501036_0081156 Ga0501036_0081156_684_1466 260
258 3300049581 Ga0501047_0203080 Ga0501047_0203080_943_1725 260
259 3300005436 Ga0070713_100209238 Ga0070713_1002092381 261
260 3300025928 Ga0207700_10157665 Ga0207700_101576652 261
261 3300028577 Ga0265318_10070504 Ga0265318_100705042 261
262 3300031235 Ga0265330_10048437 Ga0265330_100484372 261
263 3300031249 Ga0265339_10081392 Ga0265339_100813921 261
264 3300031344 Ga0265316_10024909 Ga0265316_100249094 261
265 3300031595 Ga0265313_10006009 Ga0265313_100060096 261
266 3300031711 Ga0265314_10013096 Ga0265314_100130962 261
267 3300039437 Ga0436365_1444938 Ga0436365_1444938_4276_5067 261
268 2162886012 MBSR1b_contig_228711 MBSR1b_0337.00006040 262
269 3300005327 Ga0070658_10051217 Ga0070658_100512173 262
270 3300005339 Ga0070660_100027343 Ga0070660_1000273432 262
271 3300005344 Ga0070661_100000849 Ga0070661_1000008492 262
272 3300005455 Ga0070663_100054141 Ga0070663_1000541412 262
273 3300005455 Ga0070663_100088478 Ga0070663_1000884782 262
274 3300005455 Ga0070663_100131691 Ga0070663_1001316912 262
275 3300005458 Ga0070681_10278341 Ga0070681_102783411 262
276 3300005535 Ga0070684_100198861 Ga0070684_1001988612 262
277 3300005539 Ga0068853_100002143 Ga0068853_10000214312 262
278 3300005546 Ga0070696_100298423 Ga0070696_1002984232 262
279 3300005547 Ga0070693_100120695 Ga0070693_1001206952 262
280 3300005563 Ga0068855_100022428 Ga0068855_1000224285 262
281 3300005563 Ga0068855_100060373 Ga0068855_1000603732 262
282 3300005578 Ga0068854_100007729 Ga0068854_1000077293 262
283 3300005616 Ga0068852_100004407 Ga0068852_1000044075 262
284 3300005834 Ga0068851_10000213 Ga0068851_1000021312 262
285 3300006195 Ga0075366_10108196 Ga0075366_101081961 262
286 3300006846 Ga0075430_100088010 Ga0075430_1000880102 262
287 3300006871 Ga0075434_100144768 Ga0075434_1001447682 262
288 3300006871 Ga0075434_100476902 Ga0075434_1004769022 262
289 3300009147 Ga0114129_10589776 Ga0114129_105897762 262
290 3300009177 Ga0105248_10573045 Ga0105248_105730452 262
291 3300009545 Ga0105237_10030285 Ga0105237_100302854 262
292 3300009551 Ga0105238_10006301 Ga0105238_1000630110 262
293 3300009765 Ga0123341_1000634 Ga0123341_100063421 262
294 3300010375 Ga0105239_10011077 Ga0105239_100110774 262
295 3300025321 Ga0207656_10000501 Ga0207656_100005014 262
296 3300025909 Ga0207705_10035430 Ga0207705_100354302 262
297 3300025914 Ga0207671_10017903 Ga0207671_100179034 262
298 3300025919 Ga0207657_10003868 Ga0207657_100038684 262
299 3300025920 Ga0207649_10002031 Ga0207649_1000203112 262
300 3300025932 Ga0207690_10052586 Ga0207690_100525862 262
301 3300025949 Ga0207667_10007039 Ga0207667_100070394 262
302 3300025949 Ga0207667_10759861 Ga0207667_107598611 262
303 3300025981 Ga0207640_10017972 Ga0207640_100179724 262
304 3300026041 Ga0207639_10020968 Ga0207639_100209684 262
305 3300026067 Ga0207678_10030448 Ga0207678_100304483 262
306 3300026067 Ga0207678_10054946 Ga0207678_100549463 262
307 3300026142 Ga0207698_10005255 Ga0207698_100052555 262
308 3300031241 Ga0265325_10012299 Ga0265325_100122994 262
309 3300031247 Ga0265340_10006213 Ga0265340_100062135 262
310 3300031247 Ga0265340_10078217 Ga0265340_100782172 262
311 3300031247 Ga0265340_10091731 Ga0265340_100917312 262
312 3300031344 Ga0265316_10111228 Ga0265316_101112282 262
313 3300031595 Ga0265313_10052247 Ga0265313_100522472 262
314 3300031712 Ga0265342_10020249 Ga0265342_100202494 262
315 3300037853 Ga0436364_0680564 Ga0436364_0680564_237_1031 262
316 3300039062 Ga0400483_142555 Ga0400483_142555_3158_3973 262
317 3300039062 Ga0400483_273622 Ga0400483_273622_1841_2638 262
318 3300039450 Ga0436363_1712984 Ga0436363_1712984_39_833 262
319 3300046522 Ga0495643_0002544 Ga0495643_0002544_12911_13765 262
320 3300047443 Ga0495687_010784 Ga0495687_010784_3508_4362 262
321 3300049568 Ga0501031_0012717 Ga0501031_0012717_2894_3688 262
322 3300049568 Ga0501031_0112361 Ga0501031_0112361_876_1670 262
323 3300049569 Ga0501032_0168973 Ga0501032_0168973_470_1264 262
324 3300049570 Ga0501033_0043960 Ga0501033_0043960_1332_2126 262
325 3300049570 Ga0501033_0200899 Ga0501033_0200899_429_1223 262
326 3300049571 Ga0501034_0058340 Ga0501034_0058340_1449_2243 262
327 3300049571 Ga0501034_0150391 Ga0501034_0150391_1031_1828 262
328 3300049571 Ga0501034_0534839 Ga0501034_0534839_115_909 262
329 3300049571 Ga0501034_0584492 Ga0501034_0584492_129_923 262
330 3300049573 Ga0501037_0081941 Ga0501037_0081941_68_862 262
331 3300049574 Ga0501038_0048987 Ga0501038_0048987_631_1425 262
332 3300049580 Ga0501046_0040979 Ga0501046_0040979_259_1056 262
333 3300049580 Ga0501046_0170799 Ga0501046_0170799_490_1290 262
334 3300049581 Ga0501047_0033947 Ga0501047_0033947_556_1353 262
335 3300049584 Ga0501068_0019170 Ga0501068_0019170_2465_3262 262
336 3300049584 Ga0501068_0140713 Ga0501068_0140713_519_1316 262
337 3300049585 Ga0501069_0180443 Ga0501069_0180443_31_828 262
338 3300049585 Ga0501069_0333708 Ga0501069_0333708_24_821 262
339 3300049586 Ga0501070_0083320 Ga0501070_0083320_127_921 262
340 3300049586 Ga0501070_0154687 Ga0501070_0154687_641_1435 262
341 3300049586 Ga0501070_0229955 Ga0501070_0229955_540_1337 262
342 3300049589 Ga0501073_0025814 Ga0501073_0025814_361_1155 262
343 3300049589 Ga0501073_0040674 Ga0501073_0040674_2197_3000 262
344 3300049590 Ga0501074_0007518 Ga0501074_0007518_5048_5845 262
345 3300049590 Ga0501074_0124261 Ga0501074_0124261_1027_1824 262
346 3300049592 Ga0501076_0142385 Ga0501076_0142385_822_1619 262
347 3300049742 Ga0501080_0014554 Ga0501080_0014554_5847_6641 262
348 3300049742 Ga0501080_0241142 Ga0501080_0241142_747_1541 262
349 3300049744 Ga0501083_0041042 Ga0501083_0041042_1342_2139 262
350 3300049744 Ga0501083_0078416 Ga0501083_0078416_574_1371 262
351 3300049822 Ga0501035_0014883 Ga0501035_0014883_2869_3663 262
352 3300049823 Ga0501044_0049870 Ga0501044_0049870_556_1353 262
353 3300049823 Ga0501044_0129407 Ga0501044_0129407_151_945 262
354 3300050507 nmdc:mga05p37_229755_c1 nmdc:mga05p37_229755_c1_746_1585 262
355 3300050509 nmdc:mga0qj67_166892_c1 nmdc:mga0qj67_166892_c1_393_1211 262
356 3300050512 nmdc:mga0n895_871154_c1 nmdc:mga0n895_871154_c1_32_820 262
357 3300053153 Ga0500616_0136941 Ga0500616_0136941_204_1001 262
358 3300054114 Ga0501084_0381263 Ga0501084_0381263_113_910 262
359 3300054114 Ga0501084_0552355 Ga0501084_0552355_36_833 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

54

210

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.8935 15 243
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.8886 15 240
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.8885 15 244
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8855 17 245
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8842 17 245
ID Description Score Start End Superfamily
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9371 15 253 3.40.50.300
af_P77509_259_498_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9252 14 253 3.40.50.300
af_P04983_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9187 15 257 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9144 15 253 3.40.50.300
af_P04983_256_497_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9101 17 252 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X5HV14-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9533 14 247 GO:0005524
GO:0016887
AF-C7REM8-F1-model_v4 ABC transporter related 0.951 17 247 GO:0005524
GO:0016887
AF-A0A3B9Q488-F1-model_v4 D-xylose ABC transporter ATP-binding protein 0.9469 14 247 GO:0005524
GO:0016887
AF-D9TQI8-F1-model_v4 ABC transporter related 0.9451 14 247 GO:0005524
GO:0016887
AF-A0A124IP86-F1-model_v4 D-ribose transporter ATP-binding protein 0.942 14 253 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
85.13 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map