F421442

General Info

Members Datasets Scaffolds Average Seq Length
359 216 718 346

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100037125|Ga0070705_1000371251
Length 386
Sequence MTPLLGAVNESQDRSVGGNIRERDGRFGSILAAMTRDPGVHLIGSVPLADAATVFRTVAGALAPWLSRIPDGETGERRRWIYFQRLMLERHPAMEPDPTIPPFALRQWDGKLLREMTLLRFRHAIDPAAVTFETGYAAAARASYEIFRALRDAGAIPPGVRFQVCLPTPMASAYMYVSPGARAAYLPAYERALVQALHDIVSGIPAADLAIQWDVCQEVLIHEGFFPDRPASFEAQIAGELARLGQAVPDAVEMGYHLCYGSPADEHLVMPRDTAIMVAIANGIRRELVRARRIDFLHVPVPKDRTDTAYFQPLAGLRGFDDSTLYLGLIHHDDRDGDLARIRAAQNVTPAFGVSSECGWGRTDPGRVPSLLASHRAAAEHLRRAS

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.01
Nodule 0
Rhizoplane 0.84
Rhizosphere 93.87
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100037125 3300005440 Bacteria 2745
2 JGI25405J52794_10013102 3300003911 Bacteria 1604
3 Ga0065715_10110094 3300005293 Bacteria 2637
4 Ga0070658_10003694 3300005327 Bacteria 12521
5 Ga0070676_10000185 3300005328 Bacteria 25817
6 Ga0070690_100103078 3300005330 Bacteria 1894
7 Ga0070670_100014388 3300005331 Bacteria 6789
8 Ga0068869_100000264 3300005334 Bacteria 27514
9 Ga0068869_100044839 3300005334 Bacteria 3181
10 Ga0070680_100007832 3300005336 Bacteria 8145
11 Ga0070680_100010908 3300005336 Bacteria 7021
12 Ga0070682_100000146 3300005337 Bacteria 56419
13 Ga0068868_100031271 3300005338 Bacteria 4087
14 Ga0070660_100001989 3300005339 Bacteria 14105
15 Ga0070689_100038099 3300005340 Bacteria 3677
16 Ga0070691_10004011 3300005341 Bacteria 6666
17 Ga0070691_10040125 3300005341 Bacteria 2212
18 Ga0070687_100048909 3300005343 Bacteria 2176
19 Ga0070661_100000358 3300005344 Bacteria 36016
20 Ga0070692_10004105 3300005345 Bacteria 6022
21 Ga0070671_100129606 3300005355 Bacteria 2124
22 Ga0070659_100000581 3300005366 Bacteria 26710
23 Ga0070667_100129412 3300005367 Bacteria 2202
24 Ga0070701_10002297 3300005438 Bacteria 7328
25 Ga0070701_10036147 3300005438 Bacteria 2487
26 Ga0070705_100001690 3300005440 Bacteria 11531
27 Ga0070705_100067437 3300005440 Bacteria 2149
28 Ga0070700_100248690 3300005441 Bacteria 1274
29 Ga0070694_100006837 3300005444 Bacteria 6930
30 Ga0070694_100016003 3300005444 Bacteria 4720
31 Ga0070694_100134585 3300005444 Bacteria 1789
32 Ga0070708_100035301 3300005445 Bacteria 4355
33 Ga0070708_100147742 3300005445 Bacteria 2184
34 Ga0070708_100199808 3300005445 Bacteria 1871
35 Ga0070663_100032995 3300005455 Bacteria 3573
36 Ga0070663_100407029 3300005455 Bacteria 1113
37 Ga0070662_100035052 3300005457 Bacteria 3541
38 Ga0070662_100039528 3300005457 Bacteria 3355
39 Ga0070662_100188950 3300005457 Bacteria 1628
40 Ga0070681_10003012 3300005458 Bacteria 15626
41 Ga0070681_10084514 3300005458 Bacteria 3126
42 Ga0068867_100004678 3300005459 Bacteria 9628
43 Ga0068867_100153862 3300005459 Bacteria 1808
44 Ga0070706_100002088 3300005467 Bacteria 20346
45 Ga0070706_100009816 3300005467 Bacteria 8897
46 Ga0070706_100057100 3300005467 Bacteria 3601
47 Ga0070706_100088648 3300005467 Bacteria 2868
48 Ga0070706_100091255 3300005467 Bacteria 2825
49 Ga0070706_100264907 3300005467 Bacteria 1604
50 Ga0070706_100341671 3300005467 Bacteria 1396
51 Ga0070707_100085523 3300005468 Bacteria 3048
52 Ga0070707_100364220 3300005468 Bacteria 1404
53 Ga0070698_100021971 3300005471 Bacteria 6679
54 Ga0070698_100041482 3300005471 Bacteria 4724
55 Ga0070698_100067050 3300005471 Bacteria 3610
56 Ga0070699_100002681 3300005518 Bacteria 15908
57 Ga0070699_100010768 3300005518 Bacteria 7916
58 Ga0070699_100025312 3300005518 Bacteria 5118
59 Ga0070699_100073311 3300005518 Bacteria 2979
60 Ga0070699_100130143 3300005518 Bacteria 2218
61 Ga0070679_100000114 3300005530 Bacteria 63464
62 Ga0070679_100008675 3300005530 Bacteria 9581
63 Ga0070684_100013915 3300005535 Bacteria 6501
64 Ga0070697_100000647 3300005536 Bacteria 26319
65 Ga0070697_100061077 3300005536 Bacteria 3073
66 Ga0070697_100067806 3300005536 Bacteria 2919
67 Ga0070697_100111166 3300005536 Bacteria 2284
68 Ga0070697_100160208 3300005536 Bacteria 1901
69 Ga0070697_100209703 3300005536 Bacteria 1658
70 Ga0068853_100010962 3300005539 Bacteria 7347
71 Ga0070672_100098441 3300005543 Bacteria 2369
72 Ga0070695_100000508 3300005545 Bacteria 20393
73 Ga0070695_100004921 3300005545 Bacteria 7878
74 Ga0070695_100009934 3300005545 Bacteria 5673
75 Ga0070696_100003942 3300005546 Bacteria 9904
76 Ga0070696_100014801 3300005546 Bacteria 5235
77 Ga0070696_100068659 3300005546 Unclassified 2489
78 Ga0070693_100000023 3300005547 Bacteria 59138
79 Ga0070693_100023467 3300005547 Bacteria 3297
80 Ga0070704_100000398 3300005549 Bacteria 19988
81 Ga0070704_100015383 3300005549 Bacteria 4805
82 Ga0070704_100203549 3300005549 Bacteria 1600
83 Ga0068855_100000607 3300005563 Bacteria 43932
84 Ga0068855_100008899 3300005563 Bacteria 12135
85 Ga0068854_100001032 3300005578 Bacteria 16709
86 Ga0068856_100001021 3300005614 Bacteria 29787
87 Ga0068859_100204897 3300005617 Unclassified 2057
88 Ga0068859_100212504 3300005617 Bacteria 2021
89 Ga0068859_100407554 3300005617 Bacteria 1455
90 Ga0068864_100110098 3300005618 Bacteria 2452
91 Ga0068861_100033449 3300005719 Bacteria 3792
92 Ga0068861_100166219 3300005719 Unclassified 1824
93 Ga0068870_10000571 3300005840 Bacteria 13972
94 Ga0068863_100069479 3300005841 Bacteria 3330
95 Ga0068860_100001939 3300005843 Bacteria 21890
96 Ga0068860_100091049 3300005843 Bacteria 2906
97 Ga0068862_100003055 3300005844 Bacteria 14581
98 Ga0068862_100166876 3300005844 Unclassified 1968
99 Ga0081455_10002202 3300005937 Bacteria 23200
100 Ga0081455_10009129 3300005937 Bacteria 10229
101 Ga0081538_10043792 3300005981 Bacteria 2803
102 Ga0081540_1001963 3300005983 Bacteria 17161
103 Ga0081539_10001324 3300005985 Bacteria 43245
104 Ga0081539_10046233 3300005985 Bacteria 2496
105 Ga0075365_10068983 3300006038 Bacteria 2376
106 Ga0075432_10007656 3300006058 Bacteria 3684
107 Ga0070716_100007975 3300006173 Bacteria 5242
108 Ga0070712_100022869 3300006175 Bacteria 4122
109 Ga0075362_10090974 3300006177 Bacteria 1416
110 Ga0075362_10140878 3300006177 Bacteria 1152
111 Ga0075367_10007459 3300006178 Bacteria 5601
112 Ga0075369_10005972 3300006186 Bacteria 4583
113 Ga0075369_10022202 3300006186 Bacteria 2616
114 Ga0075370_10053036 3300006353 Bacteria 2301
115 Ga0075370_10100528 3300006353 Bacteria 1673
116 Ga0075428_100004228 3300006844 Bacteria 15804
117 Ga0075428_100071678 3300006844 Bacteria 3787
118 Ga0075430_100004628 3300006846 Bacteria 11574
119 Ga0075431_100000300 3300006847 Bacteria 38938
120 Ga0075431_100001701 3300006847 Bacteria 20668
121 Ga0075431_100098456 3300006847 Bacteria 3019
122 Ga0075433_10002521 3300006852 Bacteria 13935
123 Ga0075433_10009060 3300006852 Bacteria 7950
124 Ga0075433_10016865 3300006852 Bacteria 6035
125 Ga0075434_100004221 3300006871 Bacteria 12880
126 Ga0075434_100017719 3300006871 Bacteria 6866
127 Ga0075434_100018686 3300006871 Bacteria 6697
128 Ga0075434_100021967 3300006871 Bacteria 6211
129 Ga0075434_100072344 3300006871 Bacteria 3440
130 Ga0075436_100051559 3300006914 Bacteria 2840
131 Ga0075436_100100688 3300006914 Bacteria 2012
132 Ga0097620_100204917 3300006931 Unclassified 2057
133 Ga0097620_100212502 3300006931 Bacteria 2021
134 Ga0097620_100407565 3300006931 Bacteria 1455
135 Ga0075435_100004648 3300007076 Bacteria 9461
136 Ga0075435_100082653 3300007076 Bacteria 2640
137 Ga0075435_100088357 3300007076 Bacteria 2554
138 Ga0075435_100142724 3300007076 Bacteria 2010
139 Ga0099794_10003241 3300007265 Bacteria 6170
140 Ga0105240_10080719 3300009093 Bacteria 3999
141 Ga0111539_10000295 3300009094 Bacteria 60247
142 Ga0111539_10004543 3300009094 Bacteria 18148
143 Ga0111539_10154080 3300009094 Unclassified 2689
144 Ga0105245_10126448 3300009098 Bacteria 2393
145 Ga0114129_10002580 3300009147 Bacteria 25171
146 Ga0114129_10045898 3300009147 Bacteria 6141
147 Ga0114129_10063806 3300009147 Bacteria 5141
148 Ga0114129_10258689 3300009147 Bacteria 2334
149 Ga0114129_10707479 3300009147 Bacteria 1294
150 Ga0105241_10006705 3300009174 Bacteria 8472
151 Ga0105242_10155167 3300009176 Bacteria 1999
152 Ga0105248_10365425 3300009177 Bacteria 1624
153 Ga0105248_10508589 3300009177 Bacteria 1358
154 Ga0105237_10322909 3300009545 Bacteria 1547
155 Ga0105249_10081929 3300009553 Bacteria 3001
156 Ga0105249_10138841 3300009553 Unclassified 2328
157 Ga0105249_10166731 3300009553 Bacteria 2133
158 Ga0105239_10215641 3300010375 Bacteria 2152
159 Ga0157373_10000112 3300013100 Bacteria 64218
160 Ga0157370_10021699 3300013104 Bacteria 6397
161 Ga0163162_10050548 3300013306 Bacteria 4169
162 Ga0163162_10370559 3300013306 Bacteria 1565
163 Ga0157372_10000607 3300013307 Bacteria 39122
164 Ga0157380_10069109 3300014326 Bacteria 2849
165 Ga0157376_10390755 3300014969 Bacteria 1342
166 Ga0207653_10002224 3300025885 Bacteria 6183
167 Ga0207688_10019256 3300025901 Bacteria 3716
168 Ga0207645_10000269 3300025907 Bacteria 42960
169 Ga0207643_10000042 3300025908 Bacteria 84491
170 Ga0207705_10008727 3300025909 Bacteria 7386
171 Ga0207684_10003240 3300025910 Bacteria 15970
172 Ga0207684_10007059 3300025910 Bacteria 10156
173 Ga0207684_10009512 3300025910 Bacteria 8581
174 Ga0207684_10025972 3300025910 Bacteria 4992
175 Ga0207684_10338328 3300025910 Bacteria 1296
176 Ga0207654_10008972 3300025911 Bacteria 5073
177 Ga0207707_10000225 3300025912 Bacteria 60839
178 Ga0207693_10032257 3300025915 Bacteria 4135
179 Ga0207660_10000855 3300025917 Bacteria 20081
180 Ga0207660_10008597 3300025917 Bacteria 6605
181 Ga0207662_10089580 3300025918 Bacteria 1890
182 Ga0207657_10000393 3300025919 Bacteria 46100
183 Ga0207649_10010135 3300025920 Bacteria 5171
184 Ga0207652_10000610 3300025921 Bacteria 35634
185 Ga0207652_10000935 3300025921 Bacteria 27479
186 Ga0207652_10008628 3300025921 Bacteria 8201
187 Ga0207646_10000537 3300025922 Bacteria 50487
188 Ga0207646_10015434 3300025922 Bacteria 7214
189 Ga0207646_10051327 3300025922 Bacteria 3690
190 Ga0207694_10173767 3300025924 Bacteria 1745
191 Ga0207690_10002438 3300025932 Bacteria 11247
192 Ga0207706_10059744 3300025933 Bacteria 3358
193 Ga0207706_10086033 3300025933 Bacteria 2763
194 Ga0207670_10028961 3300025936 Bacteria 3522
195 Ga0207704_10023232 3300025938 Bacteria 3337
196 Ga0207665_10013453 3300025939 Bacteria 5381
197 Ga0207691_10040867 3300025940 Bacteria 4284
198 Ga0207711_10271856 3300025941 Bacteria 1559
199 Ga0207689_10000021 3300025942 Bacteria 110537
200 Ga0207689_10039741 3300025942 Bacteria 3894
201 Ga0207689_10256386 3300025942 Unclassified 1447
202 Ga0207679_10000227 3300025945 Bacteria 43907
203 Ga0207667_10003357 3300025949 Bacteria 19750
204 Ga0207667_10019121 3300025949 Bacteria 7659
205 Ga0207712_10190845 3300025961 Bacteria 1617
206 Ga0207640_10001805 3300025981 Bacteria 11491
207 Ga0207677_10012872 3300026023 Bacteria 4829
208 Ga0207639_10007857 3300026041 Bacteria 7286
209 Ga0207678_10050616 3300026067 Bacteria 3588
210 Ga0207708_10223052 3300026075 Bacteria 1511
211 Ga0207708_10315403 3300026075 Bacteria 1275
212 Ga0207702_10015186 3300026078 Bacteria 6384
213 Ga0207702_10269106 3300026078 Bacteria 1607
214 Ga0207648_10014487 3300026089 Bacteria 7283
215 Ga0207676_10070440 3300026095 Bacteria 2804
216 Ga0207674_10003120 3300026116 Bacteria 20446
217 Ga0207674_10180706 3300026116 Bacteria 2061
218 Ga0207675_100022055 3300026118 Bacteria 5928
219 Ga0207675_100028520 3300026118 Bacteria 5198
220 Ga0209969_1004167 3300027360 Bacteria 2025
221 Ga0209996_1003651 3300027395 Bacteria 1942
222 Ga0209995_1001746 3300027471 Bacteria 3379
223 Ga0209983_1001770 3300027665 Bacteria 4790
224 Ga0209971_1000133 3300027682 Bacteria 22063
225 Ga0209966_1000251 3300027695 Bacteria 19624
226 Ga0209998_10000095 3300027717 Bacteria 35134
227 Ga0209974_10000579 3300027876 Bacteria 12244
228 Ga0207428_10000456 3300027907 Bacteria 49546
229 Ga0207428_10008349 3300027907 Bacteria 9356
230 Ga0268266_10175541 3300028379 Bacteria 1948
231 Ga0268265_10001158 3300028380 Bacteria 23186
232 Ga0268264_10028027 3300028381 Bacteria 4606
233 Ga0268264_10205194 3300028381 Bacteria 1806
234 Ga0265337_1048906 3300028556 Bacteria 1196
235 Ga0265338_10068554 3300028800 Bacteria 3055
236 Ga0307408_100014300 3300031548 Bacteria 5273
237 Ga0307416_100038725 3300032002 Bacteria 3681
238 Ga0307411_10018859 3300032005 Bacteria 3970
239 Ga0373928_0006015 3300035084 Bacteria 2326
240 Ga0373940_0007092 3300035088 Bacteria 2515
241 Ga0373949_0013632 3300035090 Bacteria 1804
242 Ga0373951_0005915 3300035091 Bacteria 2823
243 Ga0373960_0001394 3300035121 Bacteria 5345
244 Ga0373961_0002806 3300035241 Bacteria 4444
245 Ga0395900_0019225 3300037418 Bacteria 6965
246 Ga0395898_0002903 3300037466 Bacteria 19508
247 Ga0395901_0025392 3300038443 Bacteria 6082
248 Ga0395901_0257503 3300038443 Bacteria 1817
249 Ga0436360_0779635 3300039438 Bacteria 10519
250 Ga0436361_0683064 3300039447 Bacteria 1297
251 Ga0436363_1452879 3300039450 Bacteria 3228
252 Ga0436362_0671079 3300039453 Bacteria 3440
253 Ga0436362_1088199 3300039453 Bacteria 2437
254 Ga0439441_007459 3300042001 Unclassified 1762
255 Ga0439448_0003208 3300042005 Bacteria 4515
256 Ga0439455_0044329 3300042012 Bacteria 1147
257 Ga0439458_0001524 3300042157 Bacteria 5801
258 Ga0439464_0010478 3300042439 Bacteria 2447
259 Ga0439460_0000570 3300042461 Bacteria 8087
260 Ga0451577_0002433 3300042876 Bacteria 22198
261 Ga0451577_0022174 3300042876 Bacteria 5799
262 Ga0451577_0032803 3300042876 Bacteria 4680
263 Ga0451577_0142137 3300042876 Bacteria 2157
264 Ga0453683_0047957 3300044673 Bacteria 2679
265 Ga0453683_0178706 3300044673 Unclassified 1345
266 Ga0453684_0030483 3300044712 Bacteria 7618
267 Ga0453684_0136350 3300044712 Bacteria 2938
268 Ga0453684_0175907 3300044712 Bacteria 2517
269 Ga0451576_0009013 3300045051 Bacteria 11621
270 Ga0451576_0024125 3300045051 Bacteria 6571
271 Ga0451576_0068876 3300045051 Bacteria 3682
272 Ga0451576_0097154 3300045051 Bacteria 3063
273 Ga0451576_0298005 3300045051 Bacteria 1686
274 Ga0495603_0015368 3300046455 Bacteria 4632
275 Ga0495580_0079719 3300046472 Bacteria 2283
276 Ga0495585_0172154 3300046492 Bacteria 1118
277 Ga0495594_0149921 3300046499 Bacteria 1324
278 Ga0495656_0156922 3300046615 Bacteria 1103
279 Ga0495670_0142250 3300046691 Bacteria 1255
280 Ga0495636_0115274 3300047318 Bacteria 1185
281 Ga0496102_0321565 3300048905 Bacteria 1457
282 Ga0496106_0074248 3300048909 Bacteria 2603
283 Ga0496112_0102380 3300048915 Bacteria 2833
284 Ga0501031_0204673 3300049568 Bacteria 1287
285 Ga0501036_0059334 3300049572 Bacteria 3242
286 Ga0501036_0249919 3300049572 Bacteria 1486
287 Ga0501038_0049403 3300049574 Bacteria 3637
288 Ga0501039_0044878 3300049575 Bacteria 3414
289 Ga0501040_0000678 3300049576 Bacteria 20986
290 Ga0501040_0012755 3300049576 Bacteria 5516
291 Ga0501041_0000180 3300049577 Bacteria 28591
292 Ga0501043_0273298 3300049579 Bacteria 1297
293 Ga0501046_0000197 3300049580 Bacteria 62253
294 Ga0501046_0214691 3300049580 Unclassified 1427
295 Ga0501047_0088005 3300049581 Bacteria 2983
296 Ga0501048_0017080 3300049582 Bacteria 5348
297 Ga0501071_0222552 3300049587 Bacteria 1421
298 Ga0501072_0218155 3300049588 Bacteria 1520
299 Ga0501074_0036878 3300049590 Bacteria 3542
300 Ga0501075_0024535 3300049591 Bacteria 4423
301 Ga0501076_0010612 3300049592 Bacteria 6841
302 Ga0501076_0110829 3300049592 Bacteria 2218
303 Ga0501076_0261121 3300049592 Bacteria 1418
304 Ga0501077_0002783 3300049593 Bacteria 10496
305 Ga0501077_0013532 3300049593 Bacteria 5118
306 Ga0501077_0092893 3300049593 Bacteria 1912
307 Ga0501079_0006096 3300049741 Bacteria 9036
308 Ga0501081_0008649 3300049743 Bacteria 6613
309 Ga0501081_0026248 3300049743 Bacteria 3926
310 Ga0501081_0408690 3300049743 Bacteria 1005
311 Ga0501083_0006683 3300049744 Bacteria 8181
312 Ga0501045_0006739 3300049824 Bacteria 7955
313 nmdc:mga03683_19880_c1 3300050489 Bacteria 2569
314 nmdc:mga03683_974_c1 3300050489 Bacteria 6301
315 nmdc:mga0yw44_4930_c1 3300050492 Bacteria 6213
316 nmdc:mga06z11_129445_c1 3300050494 Bacteria 1416
317 nmdc:mga07m45_32409_c1 3300050496 Bacteria 2898
318 nmdc:mga05p37_149426_c1 3300050507 Bacteria 2859
319 nmdc:mga05p37_33020_c1 3300050507 Bacteria 6337
320 nmdc:mga05p37_50567_c1 3300050507 Bacteria 5111
321 nmdc:mga09592_59696_c1 3300050508 Bacteria 3224
322 nmdc:mga0qj67_100605_c1 3300050509 Bacteria 2330
323 nmdc:mga0qj67_219485_c1 3300050509 Unclassified 1543
324 nmdc:mga0qj67_40490_c1 3300050509 Bacteria 3662
325 nmdc:mga06r32_145172_c1 3300050510 Bacteria 2350
326 nmdc:mga06r32_357666_c1 3300050510 Unclassified 1444
327 nmdc:mga06r32_8255_c1 3300050510 Bacteria 9375
328 nmdc:mga06r32_843_c1 3300050510 Bacteria 27153
329 nmdc:mga08y16_182016_c1 3300050511 Unclassified 2182
330 nmdc:mga08y16_4352_c1 3300050511 Bacteria 14797
331 nmdc:mga0n895_17006_c1 3300050512 Bacteria 6691
332 nmdc:mga0n895_19357_c1 3300050512 Bacteria 6326
333 nmdc:mga0n895_20222_c1 3300050512 Bacteria 6204
334 nmdc:mga0n895_212670_c1 3300050512 Unclassified 1964
335 nmdc:mga0n895_330186_c1 3300050512 Bacteria 1545
336 nmdc:mga0n895_49118_c1 3300050512 Bacteria 4132
337 nmdc:mga0n895_66012_c1 3300050512 Bacteria 3583
338 nmdc:mga0rr50_115634_c1 3300050513 Bacteria 2129
339 nmdc:mga0rr50_156007_c1 3300050513 Unclassified 1849
340 nmdc:mga0rr50_5599_c1 3300050513 Bacteria 7516
341 nmdc:mga08x19_13847_c1 3300050514 Bacteria 4886
342 nmdc:mga08x19_66328_c1 3300050514 Bacteria 2346
343 nmdc:mga0a205_1027_c1 3300050515 Bacteria 23222
344 nmdc:mga0a205_60615_c1 3300050515 Bacteria 3654
345 nmdc:mga0a205_8226_c1 3300050515 Bacteria 8744
346 nmdc:mga0a205_94349_c1 3300050515 Bacteria 2891
347 nmdc:mga0sz30_47414_c1 3300050516 Bacteria 1816
348 Ga0500641_0002217 3300053096 Bacteria 6872
349 Ga0500650_0122836 3300053098 Bacteria 1210
350 Ga0500616_0008122 3300053153 Bacteria 6562
351 Ga0500552_000849 3300053733 Bacteria 2873
352 Ga0501084_0022945 3300054114 Bacteria 5208
353 Ga0501084_0034225 3300054114 Bacteria 4248
354 Ga0501084_0125506 3300054114 Bacteria 2160
355 Ga0501084_0283488 3300054114 Bacteria 1399
356 Ga0501082_0000445 3300060353 Bacteria 36616
357 Ga0501082_0011481 3300060353 Bacteria 7624
358 Ga0530510_0042378 3300061734 Bacteria 3289
359 Ga0530510_0381585 3300061734 Bacteria 1061
360 Ga0070705_100037125
361 JGI25405J52794_10013102
362 Ga0065715_10110094
363 Ga0070658_10003694
364 Ga0070676_10000185
365 Ga0070690_100103078
366 Ga0070670_100014388
367 Ga0068869_100000264
368 Ga0068869_100044839
369 Ga0070680_100007832
370 Ga0070680_100010908
371 Ga0070682_100000146
372 Ga0068868_100031271
373 Ga0070660_100001989
374 Ga0070689_100038099
375 Ga0070691_10004011
376 Ga0070691_10040125
377 Ga0070687_100048909
378 Ga0070661_100000358
379 Ga0070692_10004105
380 Ga0070671_100129606
381 Ga0070659_100000581
382 Ga0070667_100129412
383 Ga0070701_10002297
384 Ga0070701_10036147
385 Ga0070705_100001690
386 Ga0070705_100067437
387 Ga0070700_100248690
388 Ga0070694_100006837
389 Ga0070694_100016003
390 Ga0070694_100134585
391 Ga0070708_100035301
392 Ga0070708_100147742
393 Ga0070708_100199808
394 Ga0070663_100032995
395 Ga0070663_100407029
396 Ga0070662_100035052
397 Ga0070662_100039528
398 Ga0070662_100188950
399 Ga0070681_10003012
400 Ga0070681_10084514
401 Ga0068867_100004678
402 Ga0068867_100153862
403 Ga0070706_100002088
404 Ga0070706_100009816
405 Ga0070706_100057100
406 Ga0070706_100088648
407 Ga0070706_100091255
408 Ga0070706_100264907
409 Ga0070706_100341671
410 Ga0070707_100085523
411 Ga0070707_100364220
412 Ga0070698_100021971
413 Ga0070698_100041482
414 Ga0070698_100067050
415 Ga0070699_100002681
416 Ga0070699_100010768
417 Ga0070699_100025312
418 Ga0070699_100073311
419 Ga0070699_100130143
420 Ga0070679_100000114
421 Ga0070679_100008675
422 Ga0070684_100013915
423 Ga0070697_100000647
424 Ga0070697_100061077
425 Ga0070697_100067806
426 Ga0070697_100111166
427 Ga0070697_100160208
428 Ga0070697_100209703
429 Ga0068853_100010962
430 Ga0070672_100098441
431 Ga0070695_100000508
432 Ga0070695_100004921
433 Ga0070695_100009934
434 Ga0070696_100003942
435 Ga0070696_100014801
436 Ga0070696_100068659
437 Ga0070693_100000023
438 Ga0070693_100023467
439 Ga0070704_100000398
440 Ga0070704_100015383
441 Ga0070704_100203549
442 Ga0068855_100000607
443 Ga0068855_100008899
444 Ga0068854_100001032
445 Ga0068856_100001021
446 Ga0068859_100204897
447 Ga0068859_100212504
448 Ga0068859_100407554
449 Ga0068864_100110098
450 Ga0068861_100033449
451 Ga0068861_100166219
452 Ga0068870_10000571
453 Ga0068863_100069479
454 Ga0068860_100001939
455 Ga0068860_100091049
456 Ga0068862_100003055
457 Ga0068862_100166876
458 Ga0081455_10002202
459 Ga0081455_10009129
460 Ga0081538_10043792
461 Ga0081540_1001963
462 Ga0081539_10001324
463 Ga0081539_10046233
464 Ga0075365_10068983
465 Ga0075432_10007656
466 Ga0070716_100007975
467 Ga0070712_100022869
468 Ga0075362_10090974
469 Ga0075362_10140878
470 Ga0075367_10007459
471 Ga0075369_10005972
472 Ga0075369_10022202
473 Ga0075370_10053036
474 Ga0075370_10100528
475 Ga0075428_100004228
476 Ga0075428_100071678
477 Ga0075430_100004628
478 Ga0075431_100000300
479 Ga0075431_100001701
480 Ga0075431_100098456
481 Ga0075433_10002521
482 Ga0075433_10009060
483 Ga0075433_10016865
484 Ga0075434_100004221
485 Ga0075434_100017719
486 Ga0075434_100018686
487 Ga0075434_100021967
488 Ga0075434_100072344
489 Ga0075436_100051559
490 Ga0075436_100100688
491 Ga0097620_100204917
492 Ga0097620_100212502
493 Ga0097620_100407565
494 Ga0075435_100004648
495 Ga0075435_100082653
496 Ga0075435_100088357
497 Ga0075435_100142724
498 Ga0099794_10003241
499 Ga0105240_10080719
500 Ga0111539_10000295
501 Ga0111539_10004543
502 Ga0111539_10154080
503 Ga0105245_10126448
504 Ga0114129_10002580
505 Ga0114129_10045898
506 Ga0114129_10063806
507 Ga0114129_10258689
508 Ga0114129_10707479
509 Ga0105241_10006705
510 Ga0105242_10155167
511 Ga0105248_10365425
512 Ga0105248_10508589
513 Ga0105237_10322909
514 Ga0105249_10081929
515 Ga0105249_10138841
516 Ga0105249_10166731
517 Ga0105239_10215641
518 Ga0157373_10000112
519 Ga0157370_10021699
520 Ga0163162_10050548
521 Ga0163162_10370559
522 Ga0157372_10000607
523 Ga0157380_10069109
524 Ga0157376_10390755
525 Ga0207653_10002224
526 Ga0207688_10019256
527 Ga0207645_10000269
528 Ga0207643_10000042
529 Ga0207705_10008727
530 Ga0207684_10003240
531 Ga0207684_10007059
532 Ga0207684_10009512
533 Ga0207684_10025972
534 Ga0207684_10338328
535 Ga0207654_10008972
536 Ga0207707_10000225
537 Ga0207693_10032257
538 Ga0207660_10000855
539 Ga0207660_10008597
540 Ga0207662_10089580
541 Ga0207657_10000393
542 Ga0207649_10010135
543 Ga0207652_10000610
544 Ga0207652_10000935
545 Ga0207652_10008628
546 Ga0207646_10000537
547 Ga0207646_10015434
548 Ga0207646_10051327
549 Ga0207694_10173767
550 Ga0207690_10002438
551 Ga0207706_10059744
552 Ga0207706_10086033
553 Ga0207670_10028961
554 Ga0207704_10023232
555 Ga0207665_10013453
556 Ga0207691_10040867
557 Ga0207711_10271856
558 Ga0207689_10000021
559 Ga0207689_10039741
560 Ga0207689_10256386
561 Ga0207679_10000227
562 Ga0207667_10003357
563 Ga0207667_10019121
564 Ga0207712_10190845
565 Ga0207640_10001805
566 Ga0207677_10012872
567 Ga0207639_10007857
568 Ga0207678_10050616
569 Ga0207708_10223052
570 Ga0207708_10315403
571 Ga0207702_10015186
572 Ga0207702_10269106
573 Ga0207648_10014487
574 Ga0207676_10070440
575 Ga0207674_10003120
576 Ga0207674_10180706
577 Ga0207675_100022055
578 Ga0207675_100028520
579 Ga0209969_1004167
580 Ga0209996_1003651
581 Ga0209995_1001746
582 Ga0209983_1001770
583 Ga0209971_1000133
584 Ga0209966_1000251
585 Ga0209998_10000095
586 Ga0209974_10000579
587 Ga0207428_10000456
588 Ga0207428_10008349
589 Ga0268266_10175541
590 Ga0268265_10001158
591 Ga0268264_10028027
592 Ga0268264_10205194
593 Ga0265337_1048906
594 Ga0265338_10068554
595 Ga0307408_100014300
596 Ga0307416_100038725
597 Ga0307411_10018859
598 Ga0373928_0006015
599 Ga0373940_0007092
600 Ga0373949_0013632
601 Ga0373951_0005915
602 Ga0373960_0001394
603 Ga0373961_0002806
604 Ga0395900_0019225
605 Ga0395898_0002903
606 Ga0395901_0025392
607 Ga0395901_0257503
608 Ga0436360_0779635
609 Ga0436361_0683064
610 Ga0436363_1452879
611 Ga0436362_0671079
612 Ga0436362_1088199
613 Ga0439441_007459
614 Ga0439448_0003208
615 Ga0439455_0044329
616 Ga0439458_0001524
617 Ga0439464_0010478
618 Ga0439460_0000570
619 Ga0451577_0002433
620 Ga0451577_0022174
621 Ga0451577_0032803
622 Ga0451577_0142137
623 Ga0453683_0047957
624 Ga0453683_0178706
625 Ga0453684_0030483
626 Ga0453684_0136350
627 Ga0453684_0175907
628 Ga0451576_0009013
629 Ga0451576_0024125
630 Ga0451576_0068876
631 Ga0451576_0097154
632 Ga0451576_0298005
633 Ga0495603_0015368
634 Ga0495580_0079719
635 Ga0495585_0172154
636 Ga0495594_0149921
637 Ga0495656_0156922
638 Ga0495670_0142250
639 Ga0495636_0115274
640 Ga0496102_0321565
641 Ga0496106_0074248
642 Ga0496112_0102380
643 Ga0501031_0204673
644 Ga0501036_0059334
645 Ga0501036_0249919
646 Ga0501038_0049403
647 Ga0501039_0044878
648 Ga0501040_0000678
649 Ga0501040_0012755
650 Ga0501041_0000180
651 Ga0501043_0273298
652 Ga0501046_0000197
653 Ga0501046_0214691
654 Ga0501047_0088005
655 Ga0501048_0017080
656 Ga0501071_0222552
657 Ga0501072_0218155
658 Ga0501074_0036878
659 Ga0501075_0024535
660 Ga0501076_0010612
661 Ga0501076_0110829
662 Ga0501076_0261121
663 Ga0501077_0002783
664 Ga0501077_0013532
665 Ga0501077_0092893
666 Ga0501079_0006096
667 Ga0501081_0008649
668 Ga0501081_0026248
669 Ga0501081_0408690
670 Ga0501083_0006683
671 Ga0501045_0006739
672 nmdc:mga03683_19880_c1
673 nmdc:mga03683_974_c1
674 nmdc:mga0yw44_4930_c1
675 nmdc:mga06z11_129445_c1
676 nmdc:mga07m45_32409_c1
677 nmdc:mga05p37_149426_c1
678 nmdc:mga05p37_33020_c1
679 nmdc:mga05p37_50567_c1
680 nmdc:mga09592_59696_c1
681 nmdc:mga0qj67_100605_c1
682 nmdc:mga0qj67_219485_c1
683 nmdc:mga0qj67_40490_c1
684 nmdc:mga06r32_145172_c1
685 nmdc:mga06r32_357666_c1
686 nmdc:mga06r32_8255_c1
687 nmdc:mga06r32_843_c1
688 nmdc:mga08y16_182016_c1
689 nmdc:mga08y16_4352_c1
690 nmdc:mga0n895_17006_c1
691 nmdc:mga0n895_19357_c1
692 nmdc:mga0n895_20222_c1
693 nmdc:mga0n895_212670_c1
694 nmdc:mga0n895_330186_c1
695 nmdc:mga0n895_49118_c1
696 nmdc:mga0n895_66012_c1
697 nmdc:mga0rr50_115634_c1
698 nmdc:mga0rr50_156007_c1
699 nmdc:mga0rr50_5599_c1
700 nmdc:mga08x19_13847_c1
701 nmdc:mga08x19_66328_c1
702 nmdc:mga0a205_1027_c1
703 nmdc:mga0a205_60615_c1
704 nmdc:mga0a205_8226_c1
705 nmdc:mga0a205_94349_c1
706 nmdc:mga0sz30_47414_c1
707 Ga0500641_0002217
708 Ga0500650_0122836
709 Ga0500616_0008122
710 Ga0500552_000849
711 Ga0501084_0022945
712 Ga0501084_0034225
713 Ga0501084_0125506
714 Ga0501084_0283488
715 Ga0501082_0000445
716 Ga0501082_0011481
717 Ga0530510_0042378
718 Ga0530510_0381585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u1j-assembly1.cif.gz_A a. thaliana cobalamine independent methionine synthase 0.698 1 346
3l7r-assembly1.cif.gz_A crystal structure of mete from streptococcus mutans 0.691 1 346
2nq5-assembly1.cif.gz_A crystal structure of methyltransferase from streptococcus mutans 0.6803 1 346
4l6h-assembly1.cif.gz_A crystal structure of the candida albicans methionine synthase in complex with methotrexate and homocysteine 0.6593 3 346
4l61-assembly1.cif.gz_A crystal structure of the candida albicans methionine synthase in complex with methionine 0.6589 3 346
ID Description Score Start End Superfamily
af_Q55G42_28_396_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.6999 1 346 3.20.20.210
af_Q55G42_28_396_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.6963 1 346 3.20.20.210
4l61A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.6743 3 346 3.20.20.210
af_Q54X49_428_818_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.6545 1 346 3.20.20.210
af_Q54JW3_30_435_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6408 142 264 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6N9BG47-F1-model_v4 Uncharacterized protein 0.9891 62 312
AF-A0A7T9EPD3-F1-model_v4 deleted 0.9865 161 347
AF-A0A382P6W0-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9833 4 321
AF-A0A382RDS1-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.982 4 278
AF-A0A2E8MDL1-F1-model_v4 Cobalamin-independent methionine synthase MetE C-terminal/archaeal domain-containing protein 0.9811 2 347

Map