F421395

General Info

Members Datasets Scaffolds Average Seq Length
359 239 718 125

Family's Representative Sequence

Representative Sequence 3300004625|Ga0055543_1004650|Ga0055543_10046502
Length 129
Sequence MKGVDFVWVLSGVLLNAVAQLLLKAGATSTGPISVTTAPSMLLRVASALAQHPAILAGLGCYAISVVAWIVALSRVEVSVAYPMLSIGYVVNALLAWWWFGEAVNAQRWLGIGVIVIGVVLVARSGSAR

Samples

Sample ID Description Type Environment
1 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
162 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
235 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
236 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
237 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
238 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
239 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 9.19
Rhizosphere 87.74
Stem 0
Stem Tuber 0
Unclassified 3.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055543_1004650 3300004625 Bacteria 3680
2 Ga0065165_1000281 3300005262 Bacteria 86863
3 Ga0065707_10187642 3300005295 Bacteria 1379
4 Ga0065707_10239875 3300005295 Bacteria 1159
5 Ga0070658_10012656 3300005327 Bacteria 6767
6 Ga0070690_100048605 3300005330 Bacteria 2702
7 Ga0068869_100024754 3300005334 Bacteria 4160
8 Ga0070666_10009071 3300005335 Bacteria 6200
9 Ga0070680_100550995 3300005336 Bacteria 988
10 Ga0070682_101071782 3300005337 Bacteria 673
11 Ga0068868_100041459 3300005338 Bacteria 3587
12 Ga0068868_100224677 3300005338 Bacteria 1573
13 Ga0070660_100293383 3300005339 Bacteria 1332
14 Ga0070689_100131620 3300005340 Bacteria 2006
15 Ga0070668_101032593 3300005347 Bacteria 740
16 Ga0070675_100070544 3300005354 Bacteria 2896
17 Ga0070675_101217865 3300005354 Bacteria 693
18 Ga0070671_100020538 3300005355 Bacteria 5387
19 Ga0070674_100717169 3300005356 Bacteria 856
20 Ga0070674_101532391 3300005356 Bacteria 600
21 Ga0070673_100204967 3300005364 Bacteria 1700
22 Ga0070688_100379202 3300005365 Bacteria 1042
23 Ga0070688_100683208 3300005365 Bacteria 793
24 Ga0070688_100781301 3300005365 Bacteria 745
25 Ga0070659_100053778 3300005366 Bacteria 3170
26 Ga0070667_100072783 3300005367 Bacteria 2929
27 Ga0070667_100178026 3300005367 Bacteria 1880
28 Ga0070667_100411063 3300005367 Bacteria 1233
29 Ga0070667_101039818 3300005367 Bacteria 765
30 Ga0070709_10500019 3300005434 Bacteria 923
31 Ga0070701_10177507 3300005438 Bacteria 1244
32 Ga0070701_10191029 3300005438 Bacteria 1205
33 Ga0070705_100171318 3300005440 Bacteria 1461
34 Ga0070705_100350768 3300005440 Bacteria 1076
35 Ga0070705_100584226 3300005440 Bacteria 862
36 Ga0070700_100799643 3300005441 Bacteria 759
37 Ga0070694_100038450 3300005444 Bacteria 3180
38 Ga0070694_100907031 3300005444 Bacteria 728
39 Ga0070663_102087239 3300005455 Bacteria 511
40 Ga0070678_100127171 3300005456 Bacteria 2019
41 Ga0070678_100629137 3300005456 Bacteria 961
42 Ga0070678_100757855 3300005456 Bacteria 878
43 Ga0070681_10043521 3300005458 Bacteria 4498
44 Ga0070681_10443839 3300005458 Unclassified 1209
45 Ga0068867_100210989 3300005459 Bacteria 1559
46 Ga0068867_100334420 3300005459 Bacteria 1259
47 Ga0068867_101342929 3300005459 Bacteria 661
48 Ga0070707_100315339 3300005468 Bacteria 1520
49 Ga0070698_101313504 3300005471 Bacteria 673
50 Ga0070699_100318681 3300005518 Bacteria 1397
51 Ga0070699_100469194 3300005518 Bacteria 1142
52 Ga0070699_102114983 3300005518 Bacteria 514
53 Ga0070679_100077611 3300005530 Bacteria 3311
54 Ga0070679_101514038 3300005530 Bacteria 618
55 Ga0068853_100122528 3300005539 Bacteria 2321
56 Ga0070672_100683223 3300005543 Bacteria 898
57 Ga0070672_102007548 3300005543 Bacteria 521
58 Ga0070696_100115876 3300005546 Bacteria 1934
59 Ga0070696_100531447 3300005546 Unclassified 940
60 Ga0070696_100821533 3300005546 Bacteria 766
61 Ga0070696_101109543 3300005546 Bacteria 665
62 Ga0070665_100053728 3300005548 Bacteria 4040
63 Ga0070665_100254407 3300005548 Bacteria 1757
64 Ga0070704_100026057 3300005549 Bacteria 3858
65 Ga0070704_100256748 3300005549 Bacteria 1438
66 Ga0068855_100054039 3300005563 Bacteria 4723
67 Ga0070664_100672368 3300005564 Bacteria 963
68 Ga0068857_100134582 3300005577 Bacteria 2231
69 Ga0068854_101263797 3300005578 Bacteria 663
70 Ga0068856_100408632 3300005614 Bacteria 1377
71 Ga0070702_100618908 3300005615 Bacteria 814
72 Ga0068852_100420039 3300005616 Bacteria 1319
73 Ga0068859_100032776 3300005617 Bacteria 5218
74 Ga0068864_100120281 3300005618 Bacteria 2348
75 Ga0068866_10578012 3300005718 Bacteria 755
76 Ga0068866_10662537 3300005718 Bacteria 712
77 Ga0068861_100227940 3300005719 Bacteria 1578
78 Ga0068851_10113651 3300005834 Bacteria 1448
79 Ga0068863_100073077 3300005841 Bacteria 3244
80 Ga0068863_100126592 3300005841 Bacteria 2438
81 Ga0068863_100528678 3300005841 Bacteria 1163
82 Ga0068858_100013329 3300005842 Bacteria 7754
83 Ga0068858_100278534 3300005842 Bacteria 1592
84 Ga0068858_100806229 3300005842 Bacteria 916
85 Ga0068860_100057232 3300005843 Bacteria 3706
86 Ga0068860_100141271 3300005843 Bacteria 2314
87 Ga0068862_100044824 3300005844 Bacteria 3773
88 Ga0081539_10016000 3300005985 Bacteria 5400
89 Ga0075432_10410823 3300006058 Bacteria 586
90 Ga0070716_101055674 3300006173 Bacteria 645
91 Ga0097621_100079870 3300006237 Bacteria 2720
92 Ga0097621_100329693 3300006237 Bacteria 1353
93 Ga0097621_100735729 3300006237 Bacteria 910
94 Ga0068871_100127167 3300006358 Bacteria 2158
95 Ga0068871_100178992 3300006358 Bacteria 1821
96 Ga0068871_100708339 3300006358 Bacteria 923
97 Ga0075428_100246178 3300006844 Bacteria 1928
98 Ga0075430_100616689 3300006846 Bacteria 895
99 Ga0075431_100043383 3300006847 Bacteria 4641
100 Ga0075431_100222819 3300006847 Bacteria 1924
101 Ga0075433_10383033 3300006852 Bacteria 1242
102 Ga0075429_100002429 3300006880 Bacteria 15689
103 Ga0068865_100055995 3300006881 Bacteria 2746
104 Ga0068865_100447155 3300006881 Unclassified 1068
105 Ga0068865_101694933 3300006881 Unclassified 570
106 Ga0097620_100032778 3300006931 Bacteria 5218
107 Ga0075435_100551713 3300007076 Bacteria 998
108 Ga0099795_10000024 3300007788 Bacteria 47792
109 Ga0111539_10124827 3300009094 Bacteria 3017
110 Ga0105245_10008101 3300009098 Bacteria 9193
111 Ga0105245_10028867 3300009098 Bacteria 4897
112 Ga0105247_10407068 3300009101 Bacteria 971
113 Ga0105241_10031222 3300009174 Bacteria 3988
114 Ga0105241_11688396 3300009174 Bacteria 615
115 Ga0105242_10082703 3300009176 Bacteria 2687
116 Ga0105242_10520791 3300009176 Bacteria 1134
117 Ga0105242_12350139 3300009176 Unclassified 580
118 Ga0105248_10001495 3300009177 Bacteria 26017
119 Ga0105248_10009050 3300009177 Bacteria 10952
120 Ga0105248_10107574 3300009177 Bacteria 3145
121 Ga0105237_10047684 3300009545 Bacteria 4306
122 Ga0105238_10434153 3300009551 Bacteria 1309
123 Ga0105238_11498375 3300009551 Bacteria 703
124 Ga0105249_10123441 3300009553 Bacteria 2464
125 Ga0105249_11187382 3300009553 Bacteria 834
126 Ga0099796_10000043 3300010159 Bacteria 25487
127 Ga0105239_10182833 3300010375 Bacteria 2345
128 Ga0105239_10398871 3300010375 Bacteria 1557
129 Ga0105246_10510118 3300011119 Bacteria 1023
130 Ga0157374_10020857 3300013296 Bacteria 5821
131 Ga0157374_10123727 3300013296 Bacteria 2498
132 Ga0157378_10003627 3300013297 Bacteria 13661
133 Ga0157378_11986029 3300013297 Bacteria 631
134 Ga0157378_13059243 3300013297 Bacteria 519
135 Ga0163162_10027941 3300013306 Bacteria 5580
136 Ga0163162_10052206 3300013306 Bacteria 4105
137 Ga0163162_11014239 3300013306 Bacteria 939
138 Ga0157375_10014886 3300013308 Bacteria 6952
139 Ga0157375_10262969 3300013308 Bacteria 1887
140 Ga0157375_10479548 3300013308 Bacteria 1409
141 Ga0157375_11365050 3300013308 Bacteria 834
142 Ga0163163_10290520 3300014325 Bacteria 1687
143 Ga0182008_10002400 3300014497 Bacteria 11778
144 Ga0157377_10264821 3300014745 Bacteria 1120
145 Ga0157379_10048658 3300014968 Bacteria 3785
146 Ga0157379_10097996 3300014968 Bacteria 2632
147 Ga0157379_11409721 3300014968 Bacteria 675
148 Ga0157376_10014189 3300014969 Bacteria 5970
149 Ga0157376_11374482 3300014969 Bacteria 737
150 Ga0182006_1039437 3300015261 Bacteria 1864
151 Ga0182007_10000225 3300015262 Bacteria 37944
152 Ga0183362_10002 3300015683 Bacteria 1432711
153 Ga0163161_10024519 3300017792 Bacteria 4262
154 Ga0163161_10189374 3300017792 Bacteria 1581
155 Ga0163161_11277713 3300017792 Bacteria 637
156 Ga0213872_10132233 3300021361 Bacteria 1098
157 Ga0209564_1025491 3300025295 Bacteria 1986
158 Ga0207653_10054012 3300025885 Bacteria 1343
159 Ga0207653_10391711 3300025885 Bacteria 544
160 Ga0207642_10472016 3300025899 Bacteria 764
161 Ga0207710_10229632 3300025900 Bacteria 923
162 Ga0207680_10274055 3300025903 Bacteria 1171
163 Ga0207699_10448008 3300025906 Bacteria 926
164 Ga0207705_10402888 3300025909 Bacteria 1058
165 Ga0207654_10047426 3300025911 Bacteria 2454
166 Ga0207707_10063302 3300025912 Bacteria 3219
167 Ga0207707_10272507 3300025912 Unclassified 1467
168 Ga0207695_10785731 3300025913 Bacteria 832
169 Ga0207671_10087324 3300025914 Bacteria 2345
170 Ga0207660_10488889 3300025917 Bacteria 998
171 Ga0207657_10874493 3300025919 Bacteria 693
172 Ga0207649_11018951 3300025920 Unclassified 652
173 Ga0207652_10297777 3300025921 Bacteria 1456
174 Ga0207652_11212009 3300025921 Bacteria 657
175 Ga0207646_10700009 3300025922 Bacteria 906
176 Ga0207694_10115593 3300025924 Bacteria 2138
177 Ga0207687_10190211 3300025927 Bacteria 1597
178 Ga0207644_10011008 3300025931 Bacteria 5974
179 Ga0207690_10027140 3300025932 Bacteria 3616
180 Ga0207686_11068135 3300025934 Bacteria 657
181 Ga0207669_10268536 3300025937 Bacteria 1280
182 Ga0207704_10028488 3300025938 Bacteria 3099
183 Ga0207704_10346500 3300025938 Bacteria 1155
184 Ga0207691_11624929 3300025940 Bacteria 525
185 Ga0207711_10019262 3300025941 Bacteria 5683
186 Ga0207711_10034030 3300025941 Bacteria 4314
187 Ga0207711_11039389 3300025941 Bacteria 759
188 Ga0207689_10022001 3300025942 Bacteria 5361
189 Ga0207667_10140368 3300025949 Bacteria 2488
190 Ga0207651_10273653 3300025960 Bacteria 1392
191 Ga0207712_10278226 3300025961 Bacteria 1365
192 Ga0207712_10751626 3300025961 Bacteria 854
193 Ga0207668_10385414 3300025972 Bacteria 1181
194 Ga0207658_10114362 3300025986 Bacteria 2139
195 Ga0207658_10428162 3300025986 Bacteria 1168
196 Ga0207658_10976506 3300025986 Bacteria 772
197 Ga0207677_10157882 3300026023 Bacteria 1759
198 Ga0207677_10601241 3300026023 Bacteria 965
199 Ga0207703_10170698 3300026035 Bacteria 1913
200 Ga0207703_10289891 3300026035 Bacteria 1489
201 Ga0207639_10101728 3300026041 Bacteria 2324
202 Ga0207708_10658729 3300026075 Bacteria 892
203 Ga0207708_11286316 3300026075 Bacteria 640
204 Ga0207702_10258679 3300026078 Bacteria 1638
205 Ga0207641_10028228 3300026088 Bacteria 4636
206 Ga0207641_10169574 3300026088 Bacteria 1991
207 Ga0207648_10042782 3300026089 Bacteria 3977
208 Ga0207648_10254668 3300026089 Bacteria 1565
209 Ga0207676_12326101 3300026095 Bacteria 533
210 Ga0207674_10030381 3300026116 Bacteria 5681
211 Ga0207674_10240794 3300026116 Bacteria 1756
212 Ga0207675_102317597 3300026118 Bacteria 550
213 Ga0207683_10167979 3300026121 Bacteria 1986
214 Ga0207683_10238156 3300026121 Bacteria 1660
215 Ga0207683_10851335 3300026121 Bacteria 846
216 Ga0209179_1000041 3300027512 Bacteria 26863
217 Ga0209971_1054162 3300027682 Bacteria 970
218 Ga0268266_10395731 3300028379 Bacteria 1305
219 Ga0268265_10317956 3300028380 Bacteria 1408
220 Ga0268264_10367386 3300028381 Bacteria 1374
221 Ga0268264_10546854 3300028381 Bacteria 1135
222 Ga0265325_10000877 3300031241 Bacteria 21725
223 Ga0265327_10000572 3300031251 Bacteria 62611
224 Ga0265327_10002259 3300031251 Bacteria 20791
225 Ga0316575_10004707 3300031665 Bacteria 4812
226 Ga0316576_10017518 3300031727 Bacteria 4870
227 Ga0316578_10023213 3300031728 Bacteria 3470
228 Ga0316578_10137116 3300031728 Bacteria 1473
229 Ga0316577_10159794 3300031733 Unclassified 1271
230 Ga0307412_10259057 3300031911 Unclassified 1355
231 Ga0307416_101501978 3300032002 Archaea 779
232 Ga0316583_10008530 3300032133 Bacteria 3696
233 Ga0316583_10016174 3300032133 Bacteria 2685
234 Ga0373944_0029254 3300035089 Bacteria 1646
235 Ga0373923_0510478 3300035111 Bacteria 587
236 Ga0373936_0135189 3300035113 Bacteria 1062
237 Ga0373936_0201820 3300035113 Bacteria 878
238 Ga0373936_0365338 3300035113 Bacteria 659
239 Ga0373939_0126047 3300035114 Bacteria 909
240 Ga0316574_0010832 3300035398 Bacteria 5165
241 Ga0316574_0147415 3300035398 Bacteria 1517
242 Ga0373935_0158097 3300035692 Bacteria 1543
243 Ga0373927_0023190 3300035695 Bacteria 4066
244 Ga0373927_0729823 3300035695 Unclassified 654
245 Ga0373933_0210466 3300035724 Bacteria 1246
246 Ga0373933_0213508 3300035724 Bacteria 1237
247 Ga0373947_0212481 3300035725 Bacteria 1269
248 Ga0373937_0331503 3300036401 Bacteria 1440
249 Ga0373937_0560868 3300036401 Bacteria 1085
250 Ga0316582_0545849 3300036647 Bacteria 798
251 Ga0316584_0552088 3300036712 Bacteria 804
252 Ga0373925_0046018 3300037068 Bacteria 3243
253 Ga0373925_0677692 3300037068 Bacteria 850
254 Ga0373925_1036406 3300037068 Bacteria 675
255 Ga0316581_0177967 3300037588 Bacteria 655
256 Ga0436365_1567491 3300039437 Bacteria 776
257 Ga0436361_0215015 3300039447 Bacteria 731
258 Ga0436361_0332262 3300039447 Bacteria 1134
259 Ga0436363_0627151 3300039450 Bacteria 528
260 Ga0451833_0099700 3300041491 Unclassified 841
261 Ga0451853_3004689 3300041512 Bacteria 602
262 Ga0439441_044898 3300042001 Bacteria 896
263 Ga0451577_0193926 3300042876 Bacteria 1833
264 Ga0466969_0069047 3300044656 Bacteria 1702
265 Ga0453684_0605243 3300044712 Bacteria 1201
266 Ga0451576_0145352 3300045051 Bacteria 2472
267 Ga0495638_0259237 3300046460 Bacteria 954
268 Ga0495651_0223656 3300046462 Bacteria 1301
269 Ga0495651_0403066 3300046462 Bacteria 893
270 Ga0495653_0628519 3300046463 Bacteria 658
271 Ga0495639_0001048 3300046475 Bacteria 12464
272 Ga0495594_0555868 3300046499 Bacteria 651
273 Ga0495618_0255327 3300046514 Bacteria 1099
274 Ga0495618_0384068 3300046514 Bacteria 861
275 Ga0495628_0219794 3300046516 Bacteria 1427
276 Ga0495630_0067589 3300046517 Bacteria 2687
277 Ga0495642_0061931 3300046528 Bacteria 1553
278 Ga0495586_0068006 3300046535 Bacteria 1943
279 Ga0495586_0608322 3300046535 Bacteria 631
280 Ga0495621_0004765 3300046539 Bacteria 3849
281 Ga0495621_0046272 3300046539 Bacteria 1543
282 Ga0495645_0069532 3300046543 Bacteria 2542
283 Ga0495645_0546188 3300046543 Bacteria 719
284 Ga0495622_0454932 3300046557 Bacteria 549
285 Ga0495633_0115048 3300046558 Bacteria 1247
286 Ga0495667_0264422 3300046559 Bacteria 1094
287 Ga0495656_0235049 3300046615 Bacteria 921
288 Ga0495661_0346088 3300046665 Bacteria 733
289 Ga0495588_0023052 3300046674 Bacteria 3079
290 Ga0495657_0441628 3300046675 Bacteria 762
291 Ga0495646_0207083 3300046680 Bacteria 1066
292 Ga0495658_0027754 3300046683 Bacteria 3050
293 Ga0495658_0193395 3300046683 Bacteria 1266
294 Ga0495600_0340866 3300046809 Bacteria 940
295 Ga0495600_0706822 3300046809 Bacteria 606
296 Ga0495581_0043444 3300047315 Bacteria 2600
297 Ga0495581_0853476 3300047315 Bacteria 521
298 Ga0495636_0117574 3300047318 Bacteria 1174
299 Ga0495680_0377234 3300047322 Bacteria 983
300 Ga0495687_016950 3300047443 Bacteria 3649
301 Ga0495677_0091979 3300047445 Bacteria 1144
302 Ga0495685_077022 3300047447 Bacteria 1113
303 Ga0495593_0302168 3300047673 Bacteria 800
304 Ga0495602_0682591 3300048088 Bacteria 699
305 Ga0495602_1047395 3300048088 Bacteria 537
306 Ga0495614_0063957 3300048089 Bacteria 1582
307 Ga0495615_0083371 3300048090 Bacteria 880
308 Ga0496100_0003967 3300048903 Bacteria 7778
309 Ga0496100_0273594 3300048903 Bacteria 1257
310 Ga0496101_0001788 3300048904 Bacteria 12930
311 Ga0496101_0227002 3300048904 Bacteria 1451
312 Ga0496101_0478997 3300048904 Bacteria 983
313 Ga0496102_0000994 3300048905 Bacteria 26666
314 Ga0496103_0117626 3300048906 Bacteria 1692
315 Ga0496104_0020758 3300048907 Bacteria 6024
316 Ga0496104_0068214 3300048907 Bacteria 3379
317 Ga0496104_0112834 3300048907 Bacteria 2607
318 Ga0496105_0007805 3300048908 Bacteria 8306
319 Ga0496105_0056590 3300048908 Bacteria 3237
320 Ga0496105_0074360 3300048908 Bacteria 2807
321 Ga0496106_0007931 3300048909 Bacteria 7844
322 Ga0496106_0728508 3300048909 Bacteria 789
323 Ga0496107_0847089 3300048910 Bacteria 668
324 Ga0496108_0004995 3300048911 Bacteria 10716
325 Ga0496108_0028121 3300048911 Bacteria 4651
326 Ga0496108_0030017 3300048911 Bacteria 4506
327 Ga0496108_0400682 3300048911 Bacteria 1198
328 Ga0496109_0037865 3300048912 Bacteria 4359
329 Ga0496109_0246656 3300048912 Bacteria 1681
330 Ga0496110_0004341 3300048913 Bacteria 10976
331 Ga0496110_0015577 3300048913 Bacteria 6332
332 Ga0496110_0202530 3300048913 Bacteria 1803
333 Ga0496111_0038545 3300048914 Bacteria 3425
334 Ga0496111_0230124 3300048914 Bacteria 1377
335 Ga0496111_0429604 3300048914 Bacteria 975
336 Ga0496111_0611887 3300048914 Bacteria 797
337 Ga0496112_0022903 3300048915 Bacteria 5959
338 Ga0496113_0153898 3300048916 Bacteria 1815
339 Ga0496114_0028014 3300048917 Bacteria 4619
340 Ga0496114_0133263 3300048917 Bacteria 2147
341 Ga0496121_0891881 3300048924 Bacteria 513
342 Ga0501039_1562894 3300049575 Bacteria 507
343 Ga0501075_1195999 3300049591 Bacteria 577
344 nmdc:mga03683_255256_c1 3300050489 Bacteria 815
345 nmdc:mga0k408_63358_c1 3300050493 Bacteria 2151
346 nmdc:mga05p37_159_c1 3300050507 Bacteria 65013
347 nmdc:mga09592_1447_c1 3300050508 Bacteria 19043
348 nmdc:mga06r32_208745_c1 3300050510 Bacteria 1941
349 nmdc:mga06r32_4328_c1 3300050510 Bacteria 12710
350 nmdc:mga0a205_229838_c1 3300050515 Bacteria 1738
351 Ga0495601_0073589 3300053077 Bacteria 2185
352 Ga0495612_0318063 3300053078 Bacteria 700
353 Ga0495619_0908379 3300053085 Bacteria 592
354 2547375436 2547132103 Bacteria 5115736
355 2792836443 2791355137 Bacteria 9654227
356 2843695078 2843690924 Bacteria 5169057
357 2846037440 2846033681 Bacteria 4377894
358 2846042058 2846037992 Bacteria 4526407
359 2939634952 2939631187 Bacteria 6118131
360 Ga0055543_1004650
361 Ga0065165_1000281
362 Ga0065707_10187642
363 Ga0065707_10239875
364 Ga0070658_10012656
365 Ga0070690_100048605
366 Ga0068869_100024754
367 Ga0070666_10009071
368 Ga0070680_100550995
369 Ga0070682_101071782
370 Ga0068868_100041459
371 Ga0068868_100224677
372 Ga0070660_100293383
373 Ga0070689_100131620
374 Ga0070668_101032593
375 Ga0070675_100070544
376 Ga0070675_101217865
377 Ga0070671_100020538
378 Ga0070674_100717169
379 Ga0070674_101532391
380 Ga0070673_100204967
381 Ga0070688_100379202
382 Ga0070688_100683208
383 Ga0070688_100781301
384 Ga0070659_100053778
385 Ga0070667_100072783
386 Ga0070667_100178026
387 Ga0070667_100411063
388 Ga0070667_101039818
389 Ga0070709_10500019
390 Ga0070701_10177507
391 Ga0070701_10191029
392 Ga0070705_100171318
393 Ga0070705_100350768
394 Ga0070705_100584226
395 Ga0070700_100799643
396 Ga0070694_100038450
397 Ga0070694_100907031
398 Ga0070663_102087239
399 Ga0070678_100127171
400 Ga0070678_100629137
401 Ga0070678_100757855
402 Ga0070681_10043521
403 Ga0070681_10443839
404 Ga0068867_100210989
405 Ga0068867_100334420
406 Ga0068867_101342929
407 Ga0070707_100315339
408 Ga0070698_101313504
409 Ga0070699_100318681
410 Ga0070699_100469194
411 Ga0070699_102114983
412 Ga0070679_100077611
413 Ga0070679_101514038
414 Ga0068853_100122528
415 Ga0070672_100683223
416 Ga0070672_102007548
417 Ga0070696_100115876
418 Ga0070696_100531447
419 Ga0070696_100821533
420 Ga0070696_101109543
421 Ga0070665_100053728
422 Ga0070665_100254407
423 Ga0070704_100026057
424 Ga0070704_100256748
425 Ga0068855_100054039
426 Ga0070664_100672368
427 Ga0068857_100134582
428 Ga0068854_101263797
429 Ga0068856_100408632
430 Ga0070702_100618908
431 Ga0068852_100420039
432 Ga0068859_100032776
433 Ga0068864_100120281
434 Ga0068866_10578012
435 Ga0068866_10662537
436 Ga0068861_100227940
437 Ga0068851_10113651
438 Ga0068863_100073077
439 Ga0068863_100126592
440 Ga0068863_100528678
441 Ga0068858_100013329
442 Ga0068858_100278534
443 Ga0068858_100806229
444 Ga0068860_100057232
445 Ga0068860_100141271
446 Ga0068862_100044824
447 Ga0081539_10016000
448 Ga0075432_10410823
449 Ga0070716_101055674
450 Ga0097621_100079870
451 Ga0097621_100329693
452 Ga0097621_100735729
453 Ga0068871_100127167
454 Ga0068871_100178992
455 Ga0068871_100708339
456 Ga0075428_100246178
457 Ga0075430_100616689
458 Ga0075431_100043383
459 Ga0075431_100222819
460 Ga0075433_10383033
461 Ga0075429_100002429
462 Ga0068865_100055995
463 Ga0068865_100447155
464 Ga0068865_101694933
465 Ga0097620_100032778
466 Ga0075435_100551713
467 Ga0099795_10000024
468 Ga0111539_10124827
469 Ga0105245_10008101
470 Ga0105245_10028867
471 Ga0105247_10407068
472 Ga0105241_10031222
473 Ga0105241_11688396
474 Ga0105242_10082703
475 Ga0105242_10520791
476 Ga0105242_12350139
477 Ga0105248_10001495
478 Ga0105248_10009050
479 Ga0105248_10107574
480 Ga0105237_10047684
481 Ga0105238_10434153
482 Ga0105238_11498375
483 Ga0105249_10123441
484 Ga0105249_11187382
485 Ga0099796_10000043
486 Ga0105239_10182833
487 Ga0105239_10398871
488 Ga0105246_10510118
489 Ga0157374_10020857
490 Ga0157374_10123727
491 Ga0157378_10003627
492 Ga0157378_11986029
493 Ga0157378_13059243
494 Ga0163162_10027941
495 Ga0163162_10052206
496 Ga0163162_11014239
497 Ga0157375_10014886
498 Ga0157375_10262969
499 Ga0157375_10479548
500 Ga0157375_11365050
501 Ga0163163_10290520
502 Ga0182008_10002400
503 Ga0157377_10264821
504 Ga0157379_10048658
505 Ga0157379_10097996
506 Ga0157379_11409721
507 Ga0157376_10014189
508 Ga0157376_11374482
509 Ga0182006_1039437
510 Ga0182007_10000225
511 Ga0183362_10002
512 Ga0163161_10024519
513 Ga0163161_10189374
514 Ga0163161_11277713
515 Ga0213872_10132233
516 Ga0209564_1025491
517 Ga0207653_10054012
518 Ga0207653_10391711
519 Ga0207642_10472016
520 Ga0207710_10229632
521 Ga0207680_10274055
522 Ga0207699_10448008
523 Ga0207705_10402888
524 Ga0207654_10047426
525 Ga0207707_10063302
526 Ga0207707_10272507
527 Ga0207695_10785731
528 Ga0207671_10087324
529 Ga0207660_10488889
530 Ga0207657_10874493
531 Ga0207649_11018951
532 Ga0207652_10297777
533 Ga0207652_11212009
534 Ga0207646_10700009
535 Ga0207694_10115593
536 Ga0207687_10190211
537 Ga0207644_10011008
538 Ga0207690_10027140
539 Ga0207686_11068135
540 Ga0207669_10268536
541 Ga0207704_10028488
542 Ga0207704_10346500
543 Ga0207691_11624929
544 Ga0207711_10019262
545 Ga0207711_10034030
546 Ga0207711_11039389
547 Ga0207689_10022001
548 Ga0207667_10140368
549 Ga0207651_10273653
550 Ga0207712_10278226
551 Ga0207712_10751626
552 Ga0207668_10385414
553 Ga0207658_10114362
554 Ga0207658_10428162
555 Ga0207658_10976506
556 Ga0207677_10157882
557 Ga0207677_10601241
558 Ga0207703_10170698
559 Ga0207703_10289891
560 Ga0207639_10101728
561 Ga0207708_10658729
562 Ga0207708_11286316
563 Ga0207702_10258679
564 Ga0207641_10028228
565 Ga0207641_10169574
566 Ga0207648_10042782
567 Ga0207648_10254668
568 Ga0207676_12326101
569 Ga0207674_10030381
570 Ga0207674_10240794
571 Ga0207675_102317597
572 Ga0207683_10167979
573 Ga0207683_10238156
574 Ga0207683_10851335
575 Ga0209179_1000041
576 Ga0209971_1054162
577 Ga0268266_10395731
578 Ga0268265_10317956
579 Ga0268264_10367386
580 Ga0268264_10546854
581 Ga0265325_10000877
582 Ga0265327_10000572
583 Ga0265327_10002259
584 Ga0316575_10004707
585 Ga0316576_10017518
586 Ga0316578_10023213
587 Ga0316578_10137116
588 Ga0316577_10159794
589 Ga0307412_10259057
590 Ga0307416_101501978
591 Ga0316583_10008530
592 Ga0316583_10016174
593 Ga0373944_0029254
594 Ga0373923_0510478
595 Ga0373936_0135189
596 Ga0373936_0201820
597 Ga0373936_0365338
598 Ga0373939_0126047
599 Ga0316574_0010832
600 Ga0316574_0147415
601 Ga0373935_0158097
602 Ga0373927_0023190
603 Ga0373927_0729823
604 Ga0373933_0210466
605 Ga0373933_0213508
606 Ga0373947_0212481
607 Ga0373937_0331503
608 Ga0373937_0560868
609 Ga0316582_0545849
610 Ga0316584_0552088
611 Ga0373925_0046018
612 Ga0373925_0677692
613 Ga0373925_1036406
614 Ga0316581_0177967
615 Ga0436365_1567491
616 Ga0436361_0215015
617 Ga0436361_0332262
618 Ga0436363_0627151
619 Ga0451833_0099700
620 Ga0451853_3004689
621 Ga0439441_044898
622 Ga0451577_0193926
623 Ga0466969_0069047
624 Ga0453684_0605243
625 Ga0451576_0145352
626 Ga0495638_0259237
627 Ga0495651_0223656
628 Ga0495651_0403066
629 Ga0495653_0628519
630 Ga0495639_0001048
631 Ga0495594_0555868
632 Ga0495618_0255327
633 Ga0495618_0384068
634 Ga0495628_0219794
635 Ga0495630_0067589
636 Ga0495642_0061931
637 Ga0495586_0068006
638 Ga0495586_0608322
639 Ga0495621_0004765
640 Ga0495621_0046272
641 Ga0495645_0069532
642 Ga0495645_0546188
643 Ga0495622_0454932
644 Ga0495633_0115048
645 Ga0495667_0264422
646 Ga0495656_0235049
647 Ga0495661_0346088
648 Ga0495588_0023052
649 Ga0495657_0441628
650 Ga0495646_0207083
651 Ga0495658_0027754
652 Ga0495658_0193395
653 Ga0495600_0340866
654 Ga0495600_0706822
655 Ga0495581_0043444
656 Ga0495581_0853476
657 Ga0495636_0117574
658 Ga0495680_0377234
659 Ga0495687_016950
660 Ga0495677_0091979
661 Ga0495685_077022
662 Ga0495593_0302168
663 Ga0495602_0682591
664 Ga0495602_1047395
665 Ga0495614_0063957
666 Ga0495615_0083371
667 Ga0496100_0003967
668 Ga0496100_0273594
669 Ga0496101_0001788
670 Ga0496101_0227002
671 Ga0496101_0478997
672 Ga0496102_0000994
673 Ga0496103_0117626
674 Ga0496104_0020758
675 Ga0496104_0068214
676 Ga0496104_0112834
677 Ga0496105_0007805
678 Ga0496105_0056590
679 Ga0496105_0074360
680 Ga0496106_0007931
681 Ga0496106_0728508
682 Ga0496107_0847089
683 Ga0496108_0004995
684 Ga0496108_0028121
685 Ga0496108_0030017
686 Ga0496108_0400682
687 Ga0496109_0037865
688 Ga0496109_0246656
689 Ga0496110_0004341
690 Ga0496110_0015577
691 Ga0496110_0202530
692 Ga0496111_0038545
693 Ga0496111_0230124
694 Ga0496111_0429604
695 Ga0496111_0611887
696 Ga0496112_0022903
697 Ga0496113_0153898
698 Ga0496114_0028014
699 Ga0496114_0133263
700 Ga0496121_0891881
701 Ga0501039_1562894
702 Ga0501075_1195999
703 nmdc:mga03683_255256_c1
704 nmdc:mga0k408_63358_c1
705 nmdc:mga05p37_159_c1
706 nmdc:mga09592_1447_c1
707 nmdc:mga06r32_208745_c1
708 nmdc:mga06r32_4328_c1
709 nmdc:mga0a205_229838_c1
710 Ga0495601_0073589
711 Ga0495612_0318063
712 Ga0495619_0908379
713 2547375436
714 2792836443
715 2843695078
716 2846037440
717 2846042058
718 2939634952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

33

115

0.91

PF00892

EamA

EamA-like transporter family

5

124

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8238 5 123
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.7947 5 123
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7943 5 123
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.7663 5 123
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.7536 5 126
ID Description Score Start End Superfamily
af_A0A1D6N5I5_20_286_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8282 5 129 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8215 5 129 1.10.3730.20
af_G4S7C7_57_179_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8175 5 129 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8009 5 129 1.10.3730.20
af_G4S7C7_57_179_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7988 5 129 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A349HK63-F1-model_v4 4-amino-4-deoxy-L-arabinose transferase 0.9408 5 112 GO:0005886
GO:0022857
AF-A0A534T8V4-F1-model_v4 DMT family transporter 0.9288 5 128 GO:0015095
GO:0016020
AF-A0A7T5UJY1-F1-model_v4 EamA family transporter 0.9236 2 127 GO:0005886
GO:0022857
AF-A0A662KAV8-F1-model_v4 Multidrug transporter 0.9166 2 123 GO:0005886
GO:0009245
GO:0022857
AF-X1I314-F1-model_v4 EamA domain-containing protein 0.9157 5 129 GO:0016020

Map