F421345

General Info

Members Datasets Scaffolds Average Seq Length
358 165 716 156

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_001181|Ga0590071_001181_5138_5662
Length 174
Sequence MRRNMLLGSILLALAWAALQGDITLANLLVGYVXXXXILALLAKGGVMPSTLASRTAHAVELAGFFIWELVLANVRVARDVVRPRTTIRPAVVAIPLDVTTDGEILLLSMLINITPGSVTIDLSEDRRTLYVHVMHMASAEASRREIKDGFERRVRLLFESSRGRSQSVEARDV

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
102 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
103 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
108 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
111 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
112 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
113 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
114 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
115 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
120 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 0
Rhizoplane 1.68
Rhizosphere 89.94
Stem 0
Stem Tuber 0
Unclassified 24.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_001181 3300059421 Bacteria 7062
2 MRS1b_contig_1480570 2162886011 Bacteria 1174
3 Ga0065704_10113626 3300005289 Unclassified 1889
4 Ga0065712_10013990 3300005290 Bacteria 2383
5 Ga0065712_10097112 3300005290 Bacteria 2161
6 Ga0065715_10020743 3300005293 Unclassified 1778
7 Ga0065715_10181044 3300005293 Unclassified 1476
8 Ga0065715_10804072 3300005293 Unclassified 609
9 Ga0065707_10108452 3300005295 Unclassified 2510
10 Ga0070676_10349575 3300005328 Bacteria 1016
11 Ga0070676_10776444 3300005328 Unclassified 705
12 Ga0070683_100227739 3300005329 Bacteria 1772
13 Ga0070690_100423413 3300005330 Unclassified 982
14 Ga0070670_100017785 3300005331 Bacteria 6099
15 Ga0070670_100321854 3300005331 Bacteria 1355
16 Ga0070677_10096416 3300005333 Bacteria 1296
17 Ga0070677_10425737 3300005333 Bacteria 705
18 Ga0070677_10667920 3300005333 Unclassified 582
19 Ga0068869_100191407 3300005334 Bacteria 1609
20 Ga0068869_100623759 3300005334 Unclassified 913
21 Ga0068869_100718447 3300005334 Unclassified 853
22 Ga0070661_100893326 3300005344 Bacteria 733
23 Ga0070668_100602255 3300005347 Bacteria 961
24 Ga0070668_101111833 3300005347 Bacteria 713
25 Ga0070668_101199323 3300005347 Bacteria 688
26 Ga0070669_100008204 3300005353 Bacteria 7460
27 Ga0070669_100047353 3300005353 Bacteria 3136
28 Ga0070675_100035646 3300005354 Bacteria 4044
29 Ga0070675_100212347 3300005354 Bacteria 1682
30 Ga0070675_101655384 3300005354 Unclassified 590
31 Ga0070674_100116760 3300005356 Unclassified 1969
32 Ga0070674_100635896 3300005356 Unclassified 905
33 Ga0070673_100089506 3300005364 Bacteria 2512
34 Ga0070673_100460595 3300005364 Bacteria 1145
35 Ga0070673_100721197 3300005364 Unclassified 917
36 Ga0070688_100551180 3300005365 Unclassified 876
37 Ga0070667_100264062 3300005367 Bacteria 1542
38 Ga0070667_100645282 3300005367 Bacteria 977
39 Ga0070701_10096296 3300005438 Bacteria 1631
40 Ga0070700_100230154 3300005441 Bacteria 1319
41 Ga0070663_100204986 3300005455 Bacteria 1541
42 Ga0070662_100183210 3300005457 Bacteria 1652
43 Ga0068867_100362083 3300005459 Unclassified 1213
44 Ga0070684_101090581 3300005535 Bacteria 750
45 Ga0070672_100004565 3300005543 Bacteria 9064
46 Ga0070696_100076767 3300005546 Bacteria 2359
47 Ga0070665_100047750 3300005548 Bacteria 4296
48 Ga0070665_100304957 3300005548 Bacteria 1595
49 Ga0070665_100378509 3300005548 Unclassified 1423
50 Ga0070665_100432732 3300005548 Unclassified 1325
51 Ga0070664_101774156 3300005564 Unclassified 585
52 Ga0068857_100306583 3300005577 Bacteria 1464
53 Ga0068852_100427697 3300005616 Unclassified 1307
54 Ga0068852_100754945 3300005616 Bacteria 985
55 Ga0068859_101568375 3300005617 Bacteria 727
56 Ga0068861_100030477 3300005719 Bacteria 3954
57 Ga0068861_100145606 3300005719 Archaea 1938
58 Ga0068861_100170115 3300005719 Bacteria 1805
59 Ga0068870_10101499 3300005840 Unclassified 1627
60 Ga0068860_101116047 3300005843 Unclassified 808
61 Ga0068862_100407509 3300005844 Bacteria 1273
62 Ga0068862_100590709 3300005844 Bacteria 1065
63 Ga0075368_10038531 3300006042 Bacteria 1872
64 Ga0075368_10040008 3300006042 Bacteria 1840
65 Ga0075368_10063500 3300006042 Unclassified 1482
66 Ga0075364_10040382 3300006051 Bacteria 3026
67 Ga0075367_10004088 3300006178 Bacteria 7065
68 Ga0075367_10004938 3300006178 Bacteria 6574
69 Ga0075366_10016146 3300006195 Bacteria 4288
70 Ga0075366_10371639 3300006195 Unclassified 879
71 Ga0075366_10607142 3300006195 Bacteria 678
72 Ga0075370_10025079 3300006353 Bacteria 3296
73 Ga0075370_10033442 3300006353 Bacteria 2879
74 Ga0075428_100003380 3300006844 Bacteria 17454
75 Ga0075428_100091460 3300006844 Bacteria 3318
76 Ga0075428_101660747 3300006844 Unclassified 667
77 Ga0075430_100013689 3300006846 Bacteria 6916
78 Ga0075430_100093666 3300006846 Bacteria 2511
79 Ga0075430_101182666 3300006846 Unclassified 630
80 Ga0075431_100011684 3300006847 Bacteria 8860
81 Ga0075431_100053077 3300006847 Bacteria 4179
82 Ga0075431_100196188 3300006847 Bacteria 2067
83 Ga0075431_100372444 3300006847 Bacteria 1433
84 Ga0075434_100605381 3300006871 Bacteria 1115
85 Ga0075429_100021320 3300006880 Bacteria 5617
86 Ga0075429_100093405 3300006880 Bacteria 2624
87 Ga0068865_100531100 3300006881 Bacteria 985
88 Ga0097620_101567906 3300006931 Bacteria 727
89 Ga0111539_10000435 3300009094 Bacteria 52742
90 Ga0111539_10001942 3300009094 Bacteria 27552
91 Ga0111539_10005117 3300009094 Bacteria 17008
92 Ga0111539_12613391 3300009094 Unclassified 585
93 Ga0114129_10010365 3300009147 Bacteria 13292
94 Ga0114129_12327161 3300009147 Bacteria 643
95 Ga0105248_11571619 3300009177 Unclassified 745
96 Ga0105246_11115498 3300011119 Unclassified 721
97 Ga0163162_10572045 3300013306 Bacteria 1257
98 Ga0157375_10072144 3300013308 Unclassified 3469
99 Ga0163163_10182315 3300014325 Bacteria 2147
100 Ga0157380_10220638 3300014326 Bacteria 1696
101 Ga0157380_10487590 3300014326 Bacteria 1194
102 Ga0157380_10568498 3300014326 Bacteria 1116
103 Ga0157380_12209391 3300014326 Unclassified 614
104 Ga0157377_10566251 3300014745 Bacteria 805
105 Ga0157376_11066372 3300014969 Unclassified 833
106 Ga0157376_11473151 3300014969 Unclassified 713
107 Ga0207697_10122260 3300025315 Bacteria 1121
108 Ga0207697_10144737 3300025315 Unclassified 1032
109 Ga0207682_10009905 3300025893 Bacteria 3746
110 Ga0207682_10120939 3300025893 Bacteria 1161
111 Ga0207688_10043531 3300025901 Bacteria 2500
112 Ga0207688_10135200 3300025901 Bacteria 1448
113 Ga0207688_10429079 3300025901 Unclassified 822
114 Ga0207647_10723520 3300025904 Unclassified 541
115 Ga0207645_10112376 3300025907 Bacteria 1764
116 Ga0207645_10151414 3300025907 Bacteria 1514
117 Ga0207645_10317968 3300025907 Bacteria 1038
118 Ga0207643_10030867 3300025908 Bacteria 2985
119 Ga0207643_10045892 3300025908 Bacteria 2469
120 Ga0207705_10444421 3300025909 Bacteria 1005
121 Ga0207681_10014350 3300025923 Bacteria 4922
122 Ga0207681_10036695 3300025923 Bacteria 3235
123 Ga0207650_10197909 3300025925 Bacteria 1608
124 Ga0207650_10739593 3300025925 Bacteria 832
125 Ga0207659_10076659 3300025926 Bacteria 2458
126 Ga0207659_10196646 3300025926 Bacteria 1607
127 Ga0207659_10287412 3300025926 Unclassified 1346
128 Ga0207690_10776232 3300025932 Bacteria 791
129 Ga0207706_10171835 3300025933 Bacteria 1904
130 Ga0207670_10552636 3300025936 Bacteria 941
131 Ga0207669_10146687 3300025937 Bacteria 1646
132 Ga0207669_10159099 3300025937 Bacteria 1593
133 Ga0207669_10679981 3300025937 Unclassified 844
134 Ga0207691_10088289 3300025940 Bacteria 2781
135 Ga0207689_10382114 3300025942 Unclassified 1172
136 Ga0207679_10563795 3300025945 Bacteria 1023
137 Ga0207679_10855788 3300025945 Unclassified 831
138 Ga0207651_10403344 3300025960 Bacteria 1163
139 Ga0207651_11358709 3300025960 Unclassified 639
140 Ga0207668_10031238 3300025972 Bacteria 3506
141 Ga0207668_10059766 3300025972 Bacteria 2672
142 Ga0207678_10454285 3300026067 Bacteria 1114
143 Ga0207708_10193617 3300026075 Bacteria 1620
144 Ga0207648_10032511 3300026089 Bacteria 4605
145 Ga0207674_10353073 3300026116 Bacteria 1421
146 Ga0207675_100049992 3300026118 Bacteria 3901
147 Ga0207675_100064653 3300026118 Bacteria 3419
148 Ga0207675_100178172 3300026118 Bacteria 2034
149 Ga0207675_100732671 3300026118 Bacteria 999
150 Ga0207683_11087146 3300026121 Bacteria 742
151 Ga0209984_1021359 3300027424 Bacteria 888
152 Ga0209971_1092275 3300027682 Unclassified 739
153 Ga0209813_10085205 3300027866 Unclassified 1052
154 Ga0209813_10096118 3300027866 Bacteria 1002
155 Ga0207428_10002366 3300027907 Bacteria 18833
156 Ga0207428_10007033 3300027907 Bacteria 10302
157 Ga0268266_10060657 3300028379 Bacteria 3261
158 Ga0268266_10062023 3300028379 Bacteria 3225
159 Ga0268265_11713881 3300028380 Unclassified 634
160 Ga0268264_10339549 3300028381 Unclassified 1426
161 Ga0316182_1326112 3300030745 Unclassified 973
162 Ga0307408_100000763 3300031548 Bacteria 25884
163 Ga0307408_100599899 3300031548 Bacteria 978
164 Ga0307408_101258047 3300031548 Bacteria 692
165 Ga0307408_101420170 3300031548 Bacteria 654
166 Ga0307405_11804607 3300031731 Bacteria 544
167 Ga0307413_10124395 3300031824 Bacteria 1753
168 Ga0307413_10299951 3300031824 Bacteria 1218
169 Ga0307413_11086043 3300031824 Unclassified 690
170 Ga0307412_10869717 3300031911 Unclassified 788
171 Ga0307412_11467799 3300031911 Unclassified 619
172 Ga0307409_100150128 3300031995 Bacteria 2022
173 Ga0307409_100248826 3300031995 Bacteria 1624
174 Ga0307409_100564294 3300031995 Bacteria 1120
175 Ga0307409_101372271 3300031995 Bacteria 733
176 Ga0307416_100193807 3300032002 Bacteria 1920
177 Ga0307416_100406772 3300032002 Bacteria 1400
178 Ga0307416_101304865 3300032002 Bacteria 832
179 Ga0307414_10893272 3300032004 Bacteria 814
180 Ga0307411_10017151 3300032005 Bacteria 4116
181 Ga0307411_10038388 3300032005 Bacteria 3021
182 Ga0307411_10647439 3300032005 Bacteria 914
183 Ga0307411_10889475 3300032005 Unclassified 790
184 Ga0451797_0737644 3300041453 Bacteria 574
185 Ga0451798_0524887 3300041458 Bacteria 572
186 Ga0451800_1664555 3300041459 Bacteria 989
187 Ga0451807_2417133 3300041486 Unclassified 558
188 Ga0451851_1196591 3300041507 Unclassified 660
189 Ga0451853_3581012 3300041512 Bacteria 1291
190 Ga0451853_3851426 3300041512 Bacteria 2130
191 Ga0439433_0023018 3300041999 Bacteria 1400
192 Ga0439437_013709 3300042000 Bacteria 943
193 Ga0439441_007437 3300042001 Bacteria 1764
194 Ga0450919_022870 3300042121 Unclassified 707
195 Ga0450920_018586 3300042122 Bacteria 1331
196 Ga0450894_003851 3300042131 Bacteria 1963
197 Ga0450894_006010 3300042131 Bacteria 1570
198 Ga0450894_042939 3300042131 Unclassified 652
199 Ga0450896_006566 3300042133 Bacteria 1595
200 Ga0450899_030345 3300042135 Unclassified 656
201 Ga0450906_029555 3300042145 Bacteria 969
202 Ga0439446_0093884 3300042156 Bacteria 942
203 Ga0439446_0186054 3300042156 Unclassified 696
204 Ga0450908_011302 3300042184 Bacteria 1635
205 Ga0450908_060762 3300042184 Unclassified 664
206 Ga0439435_0008263 3300042436 Bacteria 2410
207 Ga0439435_0024055 3300042436 Bacteria 1604
208 Ga0439435_0064727 3300042436 Bacteria 1072
209 Ga0439464_0016778 3300042439 Unclassified 1983
210 Ga0439464_0123122 3300042439 Bacteria 800
211 Ga0439464_0201695 3300042439 Bacteria 634
212 Ga0450918_012863 3300042531 Bacteria 1456
213 Ga0495643_0013201 3300046522 Bacteria 4954
214 Ga0496105_1401109 3300048908 Unclassified 506
215 Ga0496106_0400027 3300048909 Bacteria 1104
216 Ga0501031_0048488 3300049568 Bacteria 2768
217 Ga0501031_0120898 3300049568 Bacteria 1711
218 Ga0501031_0370961 3300049568 Unclassified 926
219 Ga0501032_0235576 3300049569 Bacteria 1190
220 Ga0501032_0236543 3300049569 Unclassified 1187
221 Ga0501034_0049113 3300049571 Bacteria 4259
222 Ga0501036_0013288 3300049572 Bacteria 6836
223 Ga0501036_0019667 3300049572 Bacteria 5669
224 Ga0501036_0078851 3300049572 Bacteria 2786
225 Ga0501036_0092167 3300049572 Bacteria 2560
226 Ga0501036_0215209 3300049572 Bacteria 1614
227 Ga0501036_0238838 3300049572 Bacteria 1524
228 Ga0501036_0765520 3300049572 Bacteria 796
229 Ga0501036_0789772 3300049572 Unclassified 782
230 Ga0501037_0594336 3300049573 Bacteria 744
231 Ga0501038_0220392 3300049574 Bacteria 1514
232 Ga0501038_0311532 3300049574 Archaea 1233
233 Ga0501038_0325399 3300049574 Bacteria 1202
234 Ga0501038_0496321 3300049574 Bacteria 934
235 Ga0501038_0860141 3300049574 Unclassified 671
236 Ga0501039_0032811 3300049575 Bacteria 4005
237 Ga0501039_0185475 3300049575 Bacteria 1636
238 Ga0501040_0036358 3300049576 Bacteria 3342
239 Ga0501040_0085033 3300049576 Bacteria 2195
240 Ga0501040_0178380 3300049576 Bacteria 1505
241 Ga0501040_0520423 3300049576 Bacteria 858
242 Ga0501041_0023181 3300049577 Bacteria 3722
243 Ga0501041_0043269 3300049577 Bacteria 2738
244 Ga0501041_0098506 3300049577 Bacteria 1808
245 Ga0501041_0100152 3300049577 Bacteria 1793
246 Ga0501042_0049517 3300049578 Bacteria 2997
247 Ga0501042_0062610 3300049578 Bacteria 2658
248 Ga0501042_0098255 3300049578 Unclassified 2105
249 Ga0501042_0465378 3300049578 Bacteria 917
250 Ga0501046_0059151 3300049580 Bacteria 3003
251 Ga0501046_0138848 3300049580 Bacteria 1840
252 Ga0501046_0519005 3300049580 Unclassified 852
253 Ga0501048_0012255 3300049582 Bacteria 6381
254 Ga0501048_0034960 3300049582 Bacteria 3621
255 Ga0501048_0035808 3300049582 Bacteria 3570
256 Ga0501048_0080843 3300049582 Bacteria 2293
257 Ga0501048_0127857 3300049582 Bacteria 1797
258 Ga0501048_0953844 3300049582 Unclassified 617
259 Ga0501048_0965120 3300049582 Unclassified 613
260 Ga0501068_0159210 3300049584 Bacteria 1423
261 Ga0501068_0299801 3300049584 Bacteria 1029
262 Ga0501071_0009827 3300049587 Bacteria 6387
263 Ga0501071_0015901 3300049587 Bacteria 5168
264 Ga0501071_0116362 3300049587 Bacteria 1979
265 Ga0501071_0325778 3300049587 Bacteria 1167
266 Ga0501072_0019968 3300049588 Bacteria 5187
267 Ga0501072_0020841 3300049588 Bacteria 5081
268 Ga0501072_0191872 3300049588 Bacteria 1629
269 Ga0501072_0446294 3300049588 Unclassified 1025
270 Ga0501072_0478629 3300049588 Bacteria 985
271 Ga0501073_0045804 3300049589 Bacteria 3080
272 Ga0501073_0396251 3300049589 Unclassified 954
273 Ga0501073_0727026 3300049589 Unclassified 685
274 Ga0501074_0076935 3300049590 Bacteria 2395
275 Ga0501074_0124067 3300049590 Unclassified 1847
276 Ga0501074_0527929 3300049590 Bacteria 836
277 Ga0501074_0560460 3300049590 Bacteria 809
278 Ga0501075_0004856 3300049591 Bacteria 9153
279 Ga0501075_0018773 3300049591 Bacteria 5011
280 Ga0501075_0229068 3300049591 Bacteria 1417
281 Ga0501075_0342683 3300049591 Bacteria 1139
282 Ga0501075_0689766 3300049591 Bacteria 778
283 Ga0501075_0807584 3300049591 Unclassified 714
284 Ga0501076_0004795 3300049592 Bacteria 9651
285 Ga0501076_0019431 3300049592 Bacteria 5194
286 Ga0501076_0022727 3300049592 Bacteria 4823
287 Ga0501076_0135256 3300049592 Unclassified 2001
288 Ga0501076_0283463 3300049592 Bacteria 1357
289 Ga0501076_0348679 3300049592 Bacteria 1216
290 Ga0501076_0380187 3300049592 Bacteria 1161
291 Ga0501076_0455994 3300049592 Bacteria 1053
292 Ga0501076_0457831 3300049592 Bacteria 1050
293 Ga0501077_0085266 3300049593 Bacteria 2002
294 Ga0501077_0126301 3300049593 Bacteria 1621
295 Ga0501223_103595 3300049663 Unclassified 588
296 Ga0501079_0045878 3300049741 Bacteria 3373
297 Ga0501079_0092414 3300049741 Bacteria 2344
298 Ga0501079_0280769 3300049741 Bacteria 1302
299 Ga0501079_0473644 3300049741 Unclassified 984
300 Ga0501079_0613827 3300049741 Unclassified 856
301 Ga0501080_0081897 3300049742 Bacteria 2998
302 Ga0501080_0090066 3300049742 Bacteria 2850
303 Ga0501080_0251721 3300049742 Unclassified 1611
304 Ga0501080_0264196 3300049742 Bacteria 1567
305 Ga0501081_0057667 3300049743 Bacteria 2686
306 Ga0501081_0108903 3300049743 Unclassified 1965
307 Ga0501081_0170990 3300049743 Bacteria 1569
308 Ga0501081_0582955 3300049743 Bacteria 837
309 Ga0501081_0726057 3300049743 Unclassified 746
310 Ga0501083_0140409 3300049744 Bacteria 1582
311 Ga0501035_0071049 3300049822 Bacteria 3083
312 Ga0501035_0431649 3300049822 Unclassified 1092
313 Ga0501035_0467345 3300049822 Bacteria 1042
314 Ga0501045_0042760 3300049824 Bacteria 3299
315 Ga0501045_0090183 3300049824 Bacteria 2265
316 Ga0501045_0096761 3300049824 Bacteria 2184
317 Ga0501045_0107428 3300049824 Bacteria 2068
318 Ga0501045_0917518 3300049824 Unclassified 643
319 nmdc:mga00v17_109936_c1 3300050491 Bacteria 1748
320 nmdc:mga00v17_194124_c1 3300050491 Unclassified 1312
321 nmdc:mga00v17_6747_c1 3300050491 Bacteria 6099
322 nmdc:mga0k408_236599_c1 3300050493 Bacteria 1090
323 nmdc:mga0k408_38283_c1 3300050493 Bacteria 2752
324 nmdc:mga0k408_483345_c1 3300050493 Bacteria 734
325 nmdc:mga06z11_103031_c1 3300050494 Bacteria 1569
326 nmdc:mga06z11_12471_c1 3300050494 Bacteria 3698
327 nmdc:mga06z11_194613_c1 3300050494 Unclassified 1175
328 nmdc:mga06z11_341398_c1 3300050494 Bacteria 895
329 nmdc:mga06z11_815966_c1 3300050494 Bacteria 568
330 nmdc:mga04h51_75016_c1 3300050495 Unclassified 1189
331 nmdc:mga07m45_63648_c1 3300050496 Bacteria 2092
332 nmdc:mga07m45_9633_c1 3300050496 Bacteria 5020
333 nmdc:mga05p37_329455_c1 3300050507 Bacteria 1804
334 nmdc:mga05p37_9592_c1 3300050507 Bacteria 11464
335 nmdc:mga09592_3651_c1 3300050508 Bacteria 12407
336 nmdc:mga09592_87885_c1 3300050508 Bacteria 2654
337 nmdc:mga0qj67_113221_c1 3300050509 Bacteria 2191
338 nmdc:mga0qj67_52460_c1 3300050509 Bacteria 3228
339 nmdc:mga0qj67_877566_c1 3300050509 Unclassified 708
340 nmdc:mga06r32_22502_c1 3300050510 Bacteria 5827
341 nmdc:mga06r32_26168_c1 3300050510 Bacteria 5436
342 nmdc:mga06r32_74888_c1 3300050510 Bacteria 3283
343 nmdc:mga08y16_1639_c1 3300050511 Bacteria 22669
344 nmdc:mga08y16_195_c1 3300050511 Bacteria 54659
345 nmdc:mga08y16_209_c1 3300050511 Bacteria 52522
346 Ga0501084_0028452 3300054114 Bacteria 4672
347 Ga0501084_0293810 3300054114 Bacteria 1372
348 Ga0501084_0318917 3300054114 Unclassified 1313
349 Ga0501084_0671910 3300054114 Bacteria 874
350 Ga0590075_003776 3300059424 Bacteria 3593
351 Ga0590077_002789 3300059426 Bacteria 3677
352 Ga0501082_0161315 3300060353 Bacteria 1948
353 Ga0501082_0187856 3300060353 Bacteria 1798
354 Ga0501082_0407875 3300060353 Bacteria 1186
355 Ga0501082_0414650 3300060353 Bacteria 1176
356 Ga0501082_0689262 3300060353 Bacteria 894
357 Ga0530510_0004120 3300061734 Bacteria 10037
358 Ga0530510_0148128 3300061734 Bacteria 1732
359 Ga0590071_001181
360 MRS1b_contig_1480570
361 Ga0065704_10113626
362 Ga0065712_10013990
363 Ga0065712_10097112
364 Ga0065715_10020743
365 Ga0065715_10181044
366 Ga0065715_10804072
367 Ga0065707_10108452
368 Ga0070676_10349575
369 Ga0070676_10776444
370 Ga0070683_100227739
371 Ga0070690_100423413
372 Ga0070670_100017785
373 Ga0070670_100321854
374 Ga0070677_10096416
375 Ga0070677_10425737
376 Ga0070677_10667920
377 Ga0068869_100191407
378 Ga0068869_100623759
379 Ga0068869_100718447
380 Ga0070661_100893326
381 Ga0070668_100602255
382 Ga0070668_101111833
383 Ga0070668_101199323
384 Ga0070669_100008204
385 Ga0070669_100047353
386 Ga0070675_100035646
387 Ga0070675_100212347
388 Ga0070675_101655384
389 Ga0070674_100116760
390 Ga0070674_100635896
391 Ga0070673_100089506
392 Ga0070673_100460595
393 Ga0070673_100721197
394 Ga0070688_100551180
395 Ga0070667_100264062
396 Ga0070667_100645282
397 Ga0070701_10096296
398 Ga0070700_100230154
399 Ga0070663_100204986
400 Ga0070662_100183210
401 Ga0068867_100362083
402 Ga0070684_101090581
403 Ga0070672_100004565
404 Ga0070696_100076767
405 Ga0070665_100047750
406 Ga0070665_100304957
407 Ga0070665_100378509
408 Ga0070665_100432732
409 Ga0070664_101774156
410 Ga0068857_100306583
411 Ga0068852_100427697
412 Ga0068852_100754945
413 Ga0068859_101568375
414 Ga0068861_100030477
415 Ga0068861_100145606
416 Ga0068861_100170115
417 Ga0068870_10101499
418 Ga0068860_101116047
419 Ga0068862_100407509
420 Ga0068862_100590709
421 Ga0075368_10038531
422 Ga0075368_10040008
423 Ga0075368_10063500
424 Ga0075364_10040382
425 Ga0075367_10004088
426 Ga0075367_10004938
427 Ga0075366_10016146
428 Ga0075366_10371639
429 Ga0075366_10607142
430 Ga0075370_10025079
431 Ga0075370_10033442
432 Ga0075428_100003380
433 Ga0075428_100091460
434 Ga0075428_101660747
435 Ga0075430_100013689
436 Ga0075430_100093666
437 Ga0075430_101182666
438 Ga0075431_100011684
439 Ga0075431_100053077
440 Ga0075431_100196188
441 Ga0075431_100372444
442 Ga0075434_100605381
443 Ga0075429_100021320
444 Ga0075429_100093405
445 Ga0068865_100531100
446 Ga0097620_101567906
447 Ga0111539_10000435
448 Ga0111539_10001942
449 Ga0111539_10005117
450 Ga0111539_12613391
451 Ga0114129_10010365
452 Ga0114129_12327161
453 Ga0105248_11571619
454 Ga0105246_11115498
455 Ga0163162_10572045
456 Ga0157375_10072144
457 Ga0163163_10182315
458 Ga0157380_10220638
459 Ga0157380_10487590
460 Ga0157380_10568498
461 Ga0157380_12209391
462 Ga0157377_10566251
463 Ga0157376_11066372
464 Ga0157376_11473151
465 Ga0207697_10122260
466 Ga0207697_10144737
467 Ga0207682_10009905
468 Ga0207682_10120939
469 Ga0207688_10043531
470 Ga0207688_10135200
471 Ga0207688_10429079
472 Ga0207647_10723520
473 Ga0207645_10112376
474 Ga0207645_10151414
475 Ga0207645_10317968
476 Ga0207643_10030867
477 Ga0207643_10045892
478 Ga0207705_10444421
479 Ga0207681_10014350
480 Ga0207681_10036695
481 Ga0207650_10197909
482 Ga0207650_10739593
483 Ga0207659_10076659
484 Ga0207659_10196646
485 Ga0207659_10287412
486 Ga0207690_10776232
487 Ga0207706_10171835
488 Ga0207670_10552636
489 Ga0207669_10146687
490 Ga0207669_10159099
491 Ga0207669_10679981
492 Ga0207691_10088289
493 Ga0207689_10382114
494 Ga0207679_10563795
495 Ga0207679_10855788
496 Ga0207651_10403344
497 Ga0207651_11358709
498 Ga0207668_10031238
499 Ga0207668_10059766
500 Ga0207678_10454285
501 Ga0207708_10193617
502 Ga0207648_10032511
503 Ga0207674_10353073
504 Ga0207675_100049992
505 Ga0207675_100064653
506 Ga0207675_100178172
507 Ga0207675_100732671
508 Ga0207683_11087146
509 Ga0209984_1021359
510 Ga0209971_1092275
511 Ga0209813_10085205
512 Ga0209813_10096118
513 Ga0207428_10002366
514 Ga0207428_10007033
515 Ga0268266_10060657
516 Ga0268266_10062023
517 Ga0268265_11713881
518 Ga0268264_10339549
519 Ga0316182_1326112
520 Ga0307408_100000763
521 Ga0307408_100599899
522 Ga0307408_101258047
523 Ga0307408_101420170
524 Ga0307405_11804607
525 Ga0307413_10124395
526 Ga0307413_10299951
527 Ga0307413_11086043
528 Ga0307412_10869717
529 Ga0307412_11467799
530 Ga0307409_100150128
531 Ga0307409_100248826
532 Ga0307409_100564294
533 Ga0307409_101372271
534 Ga0307416_100193807
535 Ga0307416_100406772
536 Ga0307416_101304865
537 Ga0307414_10893272
538 Ga0307411_10017151
539 Ga0307411_10038388
540 Ga0307411_10647439
541 Ga0307411_10889475
542 Ga0451797_0737644
543 Ga0451798_0524887
544 Ga0451800_1664555
545 Ga0451807_2417133
546 Ga0451851_1196591
547 Ga0451853_3581012
548 Ga0451853_3851426
549 Ga0439433_0023018
550 Ga0439437_013709
551 Ga0439441_007437
552 Ga0450919_022870
553 Ga0450920_018586
554 Ga0450894_003851
555 Ga0450894_006010
556 Ga0450894_042939
557 Ga0450896_006566
558 Ga0450899_030345
559 Ga0450906_029555
560 Ga0439446_0093884
561 Ga0439446_0186054
562 Ga0450908_011302
563 Ga0450908_060762
564 Ga0439435_0008263
565 Ga0439435_0024055
566 Ga0439435_0064727
567 Ga0439464_0016778
568 Ga0439464_0123122
569 Ga0439464_0201695
570 Ga0450918_012863
571 Ga0495643_0013201
572 Ga0496105_1401109
573 Ga0496106_0400027
574 Ga0501031_0048488
575 Ga0501031_0120898
576 Ga0501031_0370961
577 Ga0501032_0235576
578 Ga0501032_0236543
579 Ga0501034_0049113
580 Ga0501036_0013288
581 Ga0501036_0019667
582 Ga0501036_0078851
583 Ga0501036_0092167
584 Ga0501036_0215209
585 Ga0501036_0238838
586 Ga0501036_0765520
587 Ga0501036_0789772
588 Ga0501037_0594336
589 Ga0501038_0220392
590 Ga0501038_0311532
591 Ga0501038_0325399
592 Ga0501038_0496321
593 Ga0501038_0860141
594 Ga0501039_0032811
595 Ga0501039_0185475
596 Ga0501040_0036358
597 Ga0501040_0085033
598 Ga0501040_0178380
599 Ga0501040_0520423
600 Ga0501041_0023181
601 Ga0501041_0043269
602 Ga0501041_0098506
603 Ga0501041_0100152
604 Ga0501042_0049517
605 Ga0501042_0062610
606 Ga0501042_0098255
607 Ga0501042_0465378
608 Ga0501046_0059151
609 Ga0501046_0138848
610 Ga0501046_0519005
611 Ga0501048_0012255
612 Ga0501048_0034960
613 Ga0501048_0035808
614 Ga0501048_0080843
615 Ga0501048_0127857
616 Ga0501048_0953844
617 Ga0501048_0965120
618 Ga0501068_0159210
619 Ga0501068_0299801
620 Ga0501071_0009827
621 Ga0501071_0015901
622 Ga0501071_0116362
623 Ga0501071_0325778
624 Ga0501072_0019968
625 Ga0501072_0020841
626 Ga0501072_0191872
627 Ga0501072_0446294
628 Ga0501072_0478629
629 Ga0501073_0045804
630 Ga0501073_0396251
631 Ga0501073_0727026
632 Ga0501074_0076935
633 Ga0501074_0124067
634 Ga0501074_0527929
635 Ga0501074_0560460
636 Ga0501075_0004856
637 Ga0501075_0018773
638 Ga0501075_0229068
639 Ga0501075_0342683
640 Ga0501075_0689766
641 Ga0501075_0807584
642 Ga0501076_0004795
643 Ga0501076_0019431
644 Ga0501076_0022727
645 Ga0501076_0135256
646 Ga0501076_0283463
647 Ga0501076_0348679
648 Ga0501076_0380187
649 Ga0501076_0455994
650 Ga0501076_0457831
651 Ga0501077_0085266
652 Ga0501077_0126301
653 Ga0501223_103595
654 Ga0501079_0045878
655 Ga0501079_0092414
656 Ga0501079_0280769
657 Ga0501079_0473644
658 Ga0501079_0613827
659 Ga0501080_0081897
660 Ga0501080_0090066
661 Ga0501080_0251721
662 Ga0501080_0264196
663 Ga0501081_0057667
664 Ga0501081_0108903
665 Ga0501081_0170990
666 Ga0501081_0582955
667 Ga0501081_0726057
668 Ga0501083_0140409
669 Ga0501035_0071049
670 Ga0501035_0431649
671 Ga0501035_0467345
672 Ga0501045_0042760
673 Ga0501045_0090183
674 Ga0501045_0096761
675 Ga0501045_0107428
676 Ga0501045_0917518
677 nmdc:mga00v17_109936_c1
678 nmdc:mga00v17_194124_c1
679 nmdc:mga00v17_6747_c1
680 nmdc:mga0k408_236599_c1
681 nmdc:mga0k408_38283_c1
682 nmdc:mga0k408_483345_c1
683 nmdc:mga06z11_103031_c1
684 nmdc:mga06z11_12471_c1
685 nmdc:mga06z11_194613_c1
686 nmdc:mga06z11_341398_c1
687 nmdc:mga06z11_815966_c1
688 nmdc:mga04h51_75016_c1
689 nmdc:mga07m45_63648_c1
690 nmdc:mga07m45_9633_c1
691 nmdc:mga05p37_329455_c1
692 nmdc:mga05p37_9592_c1
693 nmdc:mga09592_3651_c1
694 nmdc:mga09592_87885_c1
695 nmdc:mga0qj67_113221_c1
696 nmdc:mga0qj67_52460_c1
697 nmdc:mga0qj67_877566_c1
698 nmdc:mga06r32_22502_c1
699 nmdc:mga06r32_26168_c1
700 nmdc:mga06r32_74888_c1
701 nmdc:mga08y16_1639_c1
702 nmdc:mga08y16_195_c1
703 nmdc:mga08y16_209_c1
704 Ga0501084_0028452
705 Ga0501084_0293810
706 Ga0501084_0318917
707 Ga0501084_0671910
708 Ga0590075_003776
709 Ga0590077_002789
710 Ga0501082_0161315
711 Ga0501082_0187856
712 Ga0501082_0407875
713 Ga0501082_0414650
714 Ga0501082_0689262
715 Ga0530510_0004120
716 Ga0530510_0148128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

9

157

0.94

Map