F421270

General Info

Members Datasets Scaffolds Average Seq Length
358 215 342 154

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0000002|Ga0451576_0000002_315814_316371
Length 185
Sequence MFFLRNRDELAKAVCHVAESPIFAPFMSNTKKVRPSFDQIYMELAENLALRSHCVKAQVGAVLTKDTRIVSLGYNGPPSGTHNCNEEWPEEGCPRDSKGSCSLALHAEQNAILYASKNNVTIEGSTLYVTLSPCIACARIIYTMGIKRVIFKNSYADFKGIPSDEGVDFLRKFGVNVVRYEELLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
10 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
11 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
12 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
15 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
16 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
17 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
149 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
167 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
204 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
205 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
210 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
211 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
214 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
215 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.69
Metatranscriptomes 0.84
Isolates 4.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.34
Nodule 0
Rhizoplane 0.84
Rhizosphere 82.68
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_928690 2162886007 Bacteria 1676
2 JGI24736J21556_1005521 3300001904 Bacteria 2134
3 JGI24736J21556_1010590 3300001904 Bacteria 1505
4 JGI24737J22298_10009863 3300001990 Unclassified 3162
5 JGI24737J22298_10014915 3300001990 Bacteria 2518
6 JGI24743J22301_10021464 3300001991 Bacteria 1234
7 JGI24735J21928_10096890 3300002067 Bacteria 846
8 JGI24744J21845_10002459 3300002077 Bacteria 3775
9 JGI25162J39368_1000180 3300002737 Bacteria 67985
10 JGI25162J39368_1001035 3300002737 Bacteria 17180
11 JGI25152J39213_1000195 3300002773 Bacteria 40804
12 JGI25150J39212_1000014 3300002774 Bacteria 170955
13 JGI25151J46595_10000042 3300003187 Bacteria 170955
14 JGI25165J46597_1010761 3300003214 Bacteria 1324
15 JGI25153J46596_10000009 3300003215 Bacteria 340925
16 rootH2_10005336 3300003320 Bacteria 90063
17 rootH2_10185660 3300003320 Bacteria 4813
18 rootL2_10047737 3300003322 Bacteria 4797
19 rootL2_10127735 3300003322 Bacteria 2388
20 Ga0055536_1000019 3300003781 Bacteria 203087
21 Ga0055536_1007821 3300003781 Bacteria 4714
22 Ga0055530_10001246 3300003791 Bacteria 19383
23 Ga0058863_10039596 3300004799 Bacteria 2756
24 Ga0058862_10959678 3300004803 Bacteria 2894
25 Ga0065165_1000169 3300005262 Bacteria 115398
26 Ga0065714_10064969 3300005288 Bacteria 14694
27 Ga0065714_10082763 3300005288 Bacteria 2288
28 Ga0065714_10184564 3300005288 Bacteria 923
29 Ga0065714_10193023 3300005288 Bacteria 921
30 Ga0070658_10084497 3300005327 Bacteria 2610
31 Ga0070676_10000004 3300005328 Bacteria 82919
32 Ga0068869_100272521 3300005334 Bacteria 1358
33 Ga0070680_100011331 3300005336 Bacteria 6896
34 Ga0068868_100008840 3300005338 Bacteria 7216
35 Ga0068868_100152610 3300005338 Bacteria 1903
36 Ga0068868_100175394 3300005338 Bacteria 1776
37 Ga0070660_100290705 3300005339 Bacteria 1338
38 Ga0070689_100198483 3300005340 Bacteria 1637
39 Ga0070675_100973184 3300005354 Bacteria 779
40 Ga0070671_100028142 3300005355 Bacteria 4628
41 Ga0070671_100995310 3300005355 Bacteria 734
42 Ga0070673_100128526 3300005364 Bacteria 2123
43 Ga0070659_100035543 3300005366 Bacteria 3880
44 Ga0070659_100217953 3300005366 Bacteria 1574
45 Ga0070667_100421105 3300005367 Bacteria 1217
46 Ga0070714_100131620 3300005435 Bacteria 2236
47 Ga0070678_100001206 3300005456 Bacteria 13708
48 Ga0070662_100000014 3300005457 Bacteria 110124
49 Ga0070662_100082408 3300005457 Bacteria 2399
50 Ga0070681_10002077 3300005458 Bacteria 18184
51 Ga0068867_100000636 3300005459 Bacteria 23189
52 Ga0070685_10078617 3300005466 Bacteria 1972
53 Ga0070679_100031317 3300005530 Bacteria 5254
54 Ga0070679_100060058 3300005530 Bacteria 3789
55 Ga0070679_100188124 3300005530 Bacteria 2034
56 Ga0070684_100084273 3300005535 Bacteria 2817
57 Ga0070684_100893059 3300005535 Bacteria 832
58 Ga0068853_100008704 3300005539 Bacteria 8163
59 Ga0068853_100233972 3300005539 Bacteria 1682
60 Ga0070672_100481786 3300005543 Bacteria 1071
61 Ga0070665_100000032 3300005548 Bacteria 333352
62 Ga0068855_100000049 3300005563 Bacteria 145321
63 Ga0068855_100000658 3300005563 Bacteria 42234
64 Ga0068855_100129646 3300005563 Bacteria 2881
65 Ga0068855_100233879 3300005563 Bacteria 2056
66 Ga0068857_100278036 3300005577 Bacteria 1539
67 Ga0068854_100756677 3300005578 Unclassified 843
68 Ga0068856_100000424 3300005614 Bacteria 46509
69 Ga0068856_100337910 3300005614 Bacteria 1524
70 Ga0068856_100451024 3300005614 Bacteria 1307
71 Ga0068852_100055048 3300005616 Bacteria 3432
72 Ga0068852_100239174 3300005616 Bacteria 1734
73 Ga0068852_100597844 3300005616 Bacteria 1107
74 Ga0068859_101792169 3300005617 Bacteria 678
75 Ga0068866_10034351 3300005718 Bacteria 2469
76 Ga0068870_10094485 3300005840 Bacteria 1678
77 Ga0070715_10184211 3300006163 Bacteria 1049
78 Ga0070712_100577645 3300006175 Bacteria 949
79 Ga0075366_10000703 3300006195 Bacteria 15855
80 Ga0075366_10110309 3300006195 Bacteria 1654
81 Ga0097621_100002869 3300006237 Bacteria 11830
82 Ga0097621_101246792 3300006237 Bacteria 701
83 Ga0075370_10034846 3300006353 Bacteria 2823
84 Ga0068871_100000021 3300006358 Bacteria 83155
85 Ga0068865_100000045 3300006881 Bacteria 70227
86 Ga0097620_101791768 3300006931 Bacteria 678
87 Ga0105244_10416614 3300009036 Bacteria 618
88 Ga0105240_10007157 3300009093 Bacteria 16255
89 Ga0105240_10028192 3300009093 Bacteria 7339
90 Ga0105240_10194574 3300009093 Bacteria 2382
91 Ga0105240_10614511 3300009093 Bacteria 1195
92 Ga0105240_10788472 3300009093 Bacteria 1030
93 Ga0105240_11580345 3300009093 Unclassified 686
94 Ga0105245_10742284 3300009098 Unclassified 1017
95 Ga0105241_10000305 3300009174 Bacteria 36958
96 Ga0105241_10133391 3300009174 Bacteria 2013
97 Ga0105242_10113678 3300009176 Bacteria 2312
98 Ga0105242_10176773 3300009176 Bacteria 1880
99 Ga0105242_10873494 3300009176 Bacteria 897
100 Ga0105248_11890330 3300009177 Bacteria 677
101 Ga0105237_10000578 3300009545 Bacteria 51257
102 Ga0105237_10008501 3300009545 Bacteria 11105
103 Ga0105238_10002640 3300009551 Bacteria 17863
104 Ga0105239_10000001 3300010375 Bacteria 617353
105 Ga0105239_10003907 3300010375 Bacteria 18070
106 Ga0105239_10027624 3300010375 Bacteria 6244
107 Ga0105239_10430540 3300010375 Bacteria 1495
108 Ga0105246_10276162 3300011119 Bacteria 1346
109 Ga0157373_10000493 3300013100 Bacteria 31173
110 Ga0157373_10006735 3300013100 Bacteria 8552
111 Ga0157373_10008371 3300013100 Bacteria 7682
112 Ga0157373_10069136 3300013100 Bacteria 2497
113 Ga0157373_10220451 3300013100 Bacteria 1338
114 Ga0157371_10000266 3300013102 Bacteria 71146
115 Ga0157371_10000918 3300013102 Bacteria 33144
116 Ga0157371_10002705 3300013102 Bacteria 16743
117 Ga0157371_10017950 3300013102 Bacteria 5243
118 Ga0157371_10021981 3300013102 Bacteria 4682
119 Ga0157371_10339904 3300013102 Bacteria 1092
120 Ga0157371_10420053 3300013102 Bacteria 980
121 Ga0157371_10528245 3300013102 Bacteria 873
122 Ga0157370_10000197 3300013104 Bacteria 75846
123 Ga0157370_10085326 3300013104 Bacteria 2966
124 Ga0157370_10106422 3300013104 Bacteria 2625
125 Ga0157370_10112781 3300013104 Bacteria 2541
126 Ga0157370_10115000 3300013104 Bacteria 2513
127 Ga0157370_10143654 3300013104 Bacteria 2223
128 Ga0157370_10143766 3300013104 Bacteria 2222
129 Ga0157370_10158839 3300013104 Bacteria 2104
130 Ga0157370_10411582 3300013104 Bacteria 1244
131 Ga0157370_10548843 3300013104 Bacteria 1059
132 Ga0157370_11428322 3300013104 Bacteria 622
133 Ga0157369_10000031 3300013105 Bacteria 203214
134 Ga0157369_10000958 3300013105 Bacteria 36639
135 Ga0157369_10107257 3300013105 Bacteria 2971
136 Ga0157369_10162043 3300013105 Bacteria 2361
137 Ga0157369_10201993 3300013105 Unclassified 2086
138 Ga0157369_10489426 3300013105 Bacteria 1273
139 Ga0157374_10001269 3300013296 Bacteria 21541
140 Ga0157374_10017554 3300013296 Bacteria 6302
141 Ga0157374_10686684 3300013296 Bacteria 1036
142 Ga0157378_10028410 3300013297 Bacteria 4935
143 Ga0157378_10621540 3300013297 Bacteria 1093
144 Ga0163162_10000093 3300013306 Bacteria 82738
145 Ga0163162_10035771 3300013306 Bacteria 4947
146 Ga0163162_10311286 3300013306 Bacteria 1707
147 Ga0163162_10371489 3300013306 Bacteria 1563
148 Ga0163162_11581694 3300013306 Bacteria 748
149 Ga0157372_10000073 3300013307 Bacteria 107356
150 Ga0157372_10000251 3300013307 Bacteria 59407
151 Ga0157372_10001839 3300013307 Bacteria 22988
152 Ga0157372_10002319 3300013307 Bacteria 20622
153 Ga0157372_10037713 3300013307 Bacteria 5332
154 Ga0157372_10049355 3300013307 Bacteria 4680
155 Ga0157372_10175028 3300013307 Bacteria 2484
156 Ga0157375_10250437 3300013308 Bacteria 1932
157 Ga0163163_10168544 3300014325 Bacteria 2236
158 Ga0157380_10000019 3300014326 Bacteria 116129
159 Ga0157380_11274298 3300014326 Bacteria 781
160 Ga0182008_10000024 3300014497 Bacteria 199978
161 Ga0182008_10000082 3300014497 Bacteria 74716
162 Ga0182008_10000503 3300014497 Bacteria 29456
163 Ga0182008_10015222 3300014497 Bacteria 4017
164 Ga0157377_10002355 3300014745 Bacteria 8336
165 Ga0157376_10544455 3300014969 Bacteria 1148
166 Ga0182006_1000424 3300015261 Bacteria 33825
167 Ga0182006_1001382 3300015261 Bacteria 14763
168 Ga0182006_1002791 3300015261 Bacteria 9323
169 Ga0182006_1003339 3300015261 Bacteria 8263
170 Ga0182007_10000002 3300015262 Bacteria 564661
171 Ga0182007_10254405 3300015262 Bacteria 631
172 Ga0183373_1004 3300015682 Bacteria 537398
173 Ga0163161_10000856 3300017792 Bacteria 23716
174 Ga0163161_10932229 3300017792 Bacteria 738
175 Ga0163161_11680749 3300017792 Bacteria 562
176 Ga0213872_10024047 3300021361 Bacteria 2802
177 Ga0209563_115289 3300025230 Bacteria 965
178 Ga0207427_100025 3300025231 Bacteria 433726
179 Ga0209437_100010 3300025233 Bacteria 838447
180 Ga0209437_100148 3300025233 Bacteria 158795
181 Ga0207425_1000023 3300025245 Bacteria 341339
182 Ga0209026_1000805 3300025250 Bacteria 17035
183 Ga0209026_1016149 3300025250 Bacteria 1212
184 Ga0209129_1000032 3300025258 Bacteria 341150
185 Ga0209233_1000017 3300025261 Bacteria 898076
186 Ga0209233_1008486 3300025261 Bacteria 3178
187 Ga0209676_1000009 3300025292 Bacteria 981719
188 Ga0209676_1000329 3300025292 Bacteria 91571
189 Ga0209025_1000047 3300025294 Bacteria 341150
190 Ga0209758_1000145 3300025297 Bacteria 170553
191 Ga0209050_1000094 3300025298 Bacteria 242893
192 Ga0209050_1032930 3300025298 Bacteria 1582
193 Ga0207655_1057709 3300025728 Bacteria 1522
194 Ga0207647_10000022 3300025904 Bacteria 118094
195 Ga0207647_10000499 3300025904 Bacteria 31400
196 Ga0207645_10000151 3300025907 Bacteria 54588
197 Ga0207643_10290442 3300025908 Bacteria 1016
198 Ga0207705_10087314 3300025909 Bacteria 2281
199 Ga0207654_10002120 3300025911 Bacteria 10159
200 Ga0207707_10005461 3300025912 Bacteria 11112
201 Ga0207695_10008283 3300025913 Bacteria 13039
202 Ga0207695_10018922 3300025913 Bacteria 7946
203 Ga0207695_10046570 3300025913 Bacteria 4596
204 Ga0207695_10273487 3300025913 Bacteria 1584
205 Ga0207695_10659425 3300025913 Bacteria 927
206 Ga0207695_10834880 3300025913 Bacteria 801
207 Ga0207671_10006948 3300025914 Bacteria 9958
208 Ga0207671_10011028 3300025914 Bacteria 7399
209 Ga0207671_10026560 3300025914 Bacteria 4336
210 Ga0207693_10239098 3300025915 Bacteria 1426
211 Ga0207660_10006965 3300025917 Bacteria 7323
212 Ga0207652_10066856 3300025921 Bacteria 3116
213 Ga0207652_10154826 3300025921 Unclassified 2053
214 Ga0207694_10018165 3300025924 Bacteria 5317
215 Ga0207690_10029414 3300025932 Bacteria 3493
216 Ga0207690_10182619 3300025932 Bacteria 1581
217 Ga0207706_10000047 3300025933 Bacteria 119022
218 Ga0207686_10107006 3300025934 Bacteria 1879
219 Ga0207686_10109125 3300025934 Bacteria 1863
220 Ga0207686_10220432 3300025934 Unclassified 1369
221 Ga0207704_10000077 3300025938 Bacteria 60841
222 Ga0207691_10889652 3300025940 Bacteria 746
223 Ga0207661_10244444 3300025944 Bacteria 1593
224 Ga0207667_10000015 3300025949 Bacteria 417534
225 Ga0207667_10001998 3300025949 Bacteria 25593
226 Ga0207667_10047384 3300025949 Bacteria 4550
227 Ga0207651_10025271 3300025960 Bacteria 3690
228 Ga0207658_10519662 3300025986 Bacteria 1062
229 Ga0207677_10141807 3300026023 Bacteria 1841
230 Ga0207639_10006130 3300026041 Bacteria 8161
231 Ga0207702_10010544 3300026078 Bacteria 7725
232 Ga0207702_10392507 3300026078 Bacteria 1337
233 Ga0207702_10415007 3300026078 Bacteria 1301
234 Ga0207702_10487784 3300026078 Bacteria 1200
235 Ga0207648_10001095 3300026089 Bacteria 30359
236 Ga0207683_10005179 3300026121 Bacteria 11193
237 Ga0207698_10022714 3300026142 Bacteria 4367
238 Ga0207698_10239102 3300026142 Bacteria 1654
239 Ga0207698_10576028 3300026142 Bacteria 1107
240 Ga0268266_10000030 3300028379 Bacteria 417120
241 Ga0265334_10007918 3300028573 Bacteria 4542
242 Ga0307515_10001574 3300028794 Bacteria 50970
243 Ga0307515_10041837 3300028794 Bacteria 7190
244 Ga0265338_10043008 3300028800 Bacteria 4198
245 Ga0316181_1052441 3300030744 Bacteria 1802
246 Ga0316182_1346660 3300030745 Unclassified 892
247 Ga0265327_10019584 3300031251 Bacteria 4153
248 Ga0307509_10062346 3300031507 Bacteria 3932
249 Ga0307408_101076052 3300031548 Bacteria 745
250 Ga0307405_10004464 3300031731 Bacteria 6614
251 Ga0307405_11061359 3300031731 Bacteria 694
252 Ga0307414_10025723 3300032004 Bacteria 3775
253 Ga0307414_10046040 3300032004 Bacteria 2991
254 Ga0307414_10091575 3300032004 Bacteria 2260
255 Ga0307414_10093544 3300032004 Bacteria 2241
256 Ga0307414_10153981 3300032004 Bacteria 1817
257 Ga0307411_10700754 3300032005 Bacteria 882
258 Ga0373923_0290361 3300035111 Bacteria 772
259 Ga0373941_0074133 3300035115 Bacteria 1136
260 Ga0373955_0425243 3300035172 Bacteria 808
261 Ga0373937_0050811 3300036401 Bacteria 3799
262 Ga0373937_0347916 3300036401 Bacteria 1404
263 Ga0395899_0000021 3300037312 Bacteria 391702
264 Ga0395899_0000209 3300037312 Bacteria 85489
265 Ga0395899_0000749 3300037312 Bacteria 32276
266 Ga0395900_0000406 3300037418 Bacteria 62078
267 Ga0395900_0027830 3300037418 Bacteria 5791
268 Ga0395900_0032777 3300037418 Bacteria 5344
269 Ga0395900_0056520 3300037418 Bacteria 4039
270 Ga0395900_0242336 3300037418 Bacteria 1808
271 Ga0395900_0812632 3300037418 Bacteria 862
272 Ga0395898_0003004 3300037466 Bacteria 19122
273 Ga0395905_0000001 3300037471 Bacteria 2037079
274 Ga0395905_0000175 3300037471 Bacteria 104024
275 Ga0395905_0000705 3300037471 Bacteria 44338
276 Ga0395905_0000981 3300037471 Bacteria 36581
277 Ga0395905_0426298 3300037471 Bacteria 1223
278 Ga0395901_0000313 3300038443 Bacteria 59766
279 Ga0395901_0158398 3300038443 Bacteria 2378
280 Ga0395901_0274631 3300038443 Bacteria 1752
281 Ga0436361_0793109 3300039447 Bacteria 21720
282 Ga0451795_1706276 3300041456 Bacteria 883
283 Ga0451835_1127072 3300041492 Bacteria 648
284 Ga0439448_0071618 3300042005 Bacteria 1155
285 Ga0466966_0807624 3300044684 Unclassified 565
286 Ga0466961_0029110 3300044693 Bacteria 3551
287 Ga0453684_0008451 3300044712 Bacteria 18431
288 Ga0451576_0000002 3300045051 Bacteria 1670975
289 Ga0466958_0045640 3300045836 Bacteria 2644
290 Ga0495592_0103326 3300046454 Bacteria 2027
291 Ga0495651_0076728 3300046462 Bacteria 2531
292 Ga0495650_0091894 3300046471 Bacteria 1153
293 Ga0495585_0000268 3300046492 Bacteria 52128
294 Ga0495585_0215461 3300046492 Bacteria 971
295 Ga0495606_0009027 3300046507 Bacteria 8517
296 Ga0495606_0023338 3300046507 Bacteria 4484
297 Ga0495606_0029375 3300046507 Bacteria 3861
298 Ga0495610_0009337 3300046512 Bacteria 6209
299 Ga0495610_0011497 3300046512 Bacteria 5410
300 Ga0495616_0051386 3300046513 Bacteria 2056
301 Ga0495631_0056622 3300046518 Bacteria 1707
302 Ga0495637_0065417 3300046520 Bacteria 1480
303 Ga0495648_0008346 3300046524 Bacteria 8165
304 Ga0495663_0060424 3300046525 Bacteria 1191
305 Ga0495654_0211456 3300046530 Bacteria 825
306 Ga0495587_0224485 3300046536 Bacteria 1059
307 Ga0495609_0007404 3300046538 Bacteria 5485
308 Ga0495633_0002082 3300046558 Bacteria 14389
309 Ga0495633_0065525 3300046558 Bacteria 1697
310 Ga0495668_0000009 3300046616 Bacteria 492623
311 Ga0495634_0118216 3300046642 Bacteria 1699
312 Ga0495625_0000385 3300046660 Bacteria 67419
313 Ga0495625_0001975 3300046660 Bacteria 23138
314 Ga0495658_0037745 3300046683 Bacteria 2672
315 Ga0495600_0402960 3300046809 Bacteria 851
316 Ga0495675_0755446 3300047444 Unclassified 541
317 Ga0495681_0085159 3300047470 Bacteria 1404
318 Ga0495684_0054703 3300047471 Bacteria 3044
319 Ga0495686_0000299 3300047472 Bacteria 85384
320 Ga0495686_0001086 3300047472 Bacteria 32331
321 Ga0495686_0442680 3300047472 Unclassified 691
322 Ga0495614_0014365 3300048089 Bacteria 3466
323 Ga0496115_0053918 3300048918 Bacteria 3228
324 Ga0496115_0309179 3300048918 Bacteria 1294
325 Ga0496122_0000869 3300048925 Bacteria 56890
326 Ga0496123_0009832 3300048926 Bacteria 8542
327 Ga0496125_0086359 3300048928 Bacteria 2373
328 Ga0501223_000187 3300049663 Bacteria 16254
329 Ga0501241_001051 3300049758 Bacteria 5829
330 Ga0501241_009103 3300049758 Bacteria 1809
331 Ga0501269_008758 3300049766 Bacteria 1226
332 nmdc:mga0k408_544_c1 3300050493 Bacteria 15911
333 nmdc:mga0k408_65692_c1 3300050493 Bacteria 2112
334 nmdc:mga07m45_34229_c1 3300050496 Bacteria 2823
335 Ga0495601_0824374 3300053077 Unclassified 588
336 Ga0500635_0001217 3300053080 Bacteria 6162
337 Ga0500646_0151029 3300053090 Bacteria 769
338 Ga0500647_0208127 3300053091 Bacteria 883
339 Ga0500651_0000455 3300053093 Bacteria 21853
340 Ga0500614_014079 3300053123 Bacteria 1766
341 Ga0500627_0199007 3300053158 Unclassified 898
342 Ga0587062_002509 3300059639 Unclassified 1755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2977232053 2977236039 146
2 iso_pu_bacteria 2585427687 2586206308 147
3 iso_pu_bacteria 2738541302 2738856144 147
4 iso_pu_bacteria 2739367651 2739588295 147
5 iso_pu_bacteria 2739367656 2739613927 147
6 iso_pu_bacteria 2818991437 2819546275 147
7 iso_pu_bacteria 2842722452 2842723894 147
8 iso_pu_bacteria 2842909656 2842912374 147
9 iso_pu_bacteria 2849281842 2849282803 147
10 iso_pu_bacteria 2857627736 2857629282 147
11 iso_pu_bacteria 2904445276 2904446548 147
12 iso_pu_bacteria 2945997725 2945999357 147
13 iso_pu_bacteria 2954016120 2954021754 147
14 3300013104 Ga0157370_10000197 Ga0157370_1000019742 148
15 3300014497 Ga0182008_10015222 Ga0182008_100152224 148
16 3300015262 Ga0182007_10254405 Ga0182007_102544051 148
17 3300017792 Ga0163161_10000856 Ga0163161_100008569 148
18 3300025914 Ga0207671_10006948 Ga0207671_100069488 148
19 3300001904 JGI24736J21556_1005521 JGI24736J21556_10055212 149
20 3300001904 JGI24736J21556_1010590 JGI24736J21556_10105902 149
21 3300001990 JGI24737J22298_10009863 JGI24737J22298_100098635 149
22 3300002737 JGI25162J39368_1000180 JGI25162J39368_100018013 149
23 3300003320 rootH2_10005336 rootH2_1000533627 149
24 3300003322 rootL2_10047737 rootL2_100477371 149
25 3300003322 rootL2_10127735 rootL2_101277352 149
26 3300005288 Ga0065714_10064969 Ga0065714_100649696 149
27 3300005288 Ga0065714_10082763 Ga0065714_100827632 149
28 3300005338 Ga0068868_100152610 Ga0068868_1001526102 149
29 3300005364 Ga0070673_100128526 Ga0070673_1001285263 149
30 3300005366 Ga0070659_100035543 Ga0070659_1000355435 149
31 3300005366 Ga0070659_100217953 Ga0070659_1002179532 149
32 3300005457 Ga0070662_100000014 Ga0070662_10000001420 149
33 3300005530 Ga0070679_100060058 Ga0070679_1000600581 149
34 3300005548 Ga0070665_100000032 Ga0070665_100000032239 149
35 3300006175 Ga0070712_100577645 Ga0070712_1005776451 149
36 3300006195 Ga0075366_10000703 Ga0075366_100007036 149
37 3300006195 Ga0075366_10110309 Ga0075366_101103092 149
38 3300006237 Ga0097621_101246792 Ga0097621_1012467921 149
39 3300009093 Ga0105240_10007157 Ga0105240_100071577 149
40 3300009093 Ga0105240_10614511 Ga0105240_106145112 149
41 3300009093 Ga0105240_11580345 Ga0105240_115803452 149
42 3300009098 Ga0105245_10742284 Ga0105245_107422841 149
43 3300009174 Ga0105241_10000305 Ga0105241_1000030532 149
44 3300010375 Ga0105239_10000001 Ga0105239_10000001257 149
45 3300010375 Ga0105239_10003907 Ga0105239_100039072 149
46 3300013100 Ga0157373_10069136 Ga0157373_100691362 149
47 3300013102 Ga0157371_10002705 Ga0157371_100027055 149
48 3300013104 Ga0157370_10085326 Ga0157370_100853262 149
49 3300013104 Ga0157370_10115000 Ga0157370_101150003 149
50 3300013105 Ga0157369_10000958 Ga0157369_1000095817 149
51 3300013105 Ga0157369_10201993 Ga0157369_102019932 149
52 3300013296 Ga0157374_10001269 Ga0157374_100012694 149
53 3300013306 Ga0163162_10311286 Ga0163162_103112862 149
54 3300013306 Ga0163162_10371489 Ga0163162_103714892 149
55 3300013306 Ga0163162_11581694 Ga0163162_115816942 149
56 3300013307 Ga0157372_10000073 Ga0157372_1000007345 149
57 3300013307 Ga0157372_10049355 Ga0157372_100493552 149
58 3300014326 Ga0157380_10000019 Ga0157380_1000001913 149
59 3300014497 Ga0182008_10000024 Ga0182008_1000002460 149
60 3300014745 Ga0157377_10002355 Ga0157377_100023552 149
61 3300021361 Ga0213872_10024047 Ga0213872_100240472 149
62 3300025233 Ga0209437_100148 Ga0209437_10014849 149
63 3300025904 Ga0207647_10000022 Ga0207647_1000002297 149
64 3300025904 Ga0207647_10000499 Ga0207647_1000049917 149
65 3300025911 Ga0207654_10002120 Ga0207654_100021208 149
66 3300025913 Ga0207695_10834880 Ga0207695_108348801 149
67 3300025915 Ga0207693_10239098 Ga0207693_102390981 149
68 3300025932 Ga0207690_10029414 Ga0207690_100294142 149
69 3300025932 Ga0207690_10182619 Ga0207690_101826192 149
70 3300025933 Ga0207706_10000047 Ga0207706_100000479 149
71 3300025949 Ga0207667_10047384 Ga0207667_100473844 149
72 3300026023 Ga0207677_10141807 Ga0207677_101418072 149
73 3300026078 Ga0207702_10487784 Ga0207702_104877842 149
74 3300028379 Ga0268266_10000030 Ga0268266_1000003092 149
75 3300028794 Ga0307515_10001574 Ga0307515_100015744 149
76 3300037312 Ga0395899_0000209 Ga0395899_0000209_22417_22890 149
77 3300037471 Ga0395905_0000705 Ga0395905_0000705_21814_22263 149
78 3300039447 Ga0436361_0793109 Ga0436361_0793109_10382_10840 149
79 3300041492 Ga0451835_1127072 Ga0451835_1127072_42_500 149
80 3300042005 Ga0439448_0071618 Ga0439448_0071618_88_546 149
81 3300044684 Ga0466966_0807624 Ga0466966_0807624_48_503 149
82 3300044693 Ga0466961_0029110 Ga0466961_0029110_403_876 149
83 3300045836 Ga0466958_0045640 Ga0466958_0045640_784_1239 149
84 3300046471 Ga0495650_0091894 Ga0495650_0091894_70_525 149
85 3300046492 Ga0495585_0000268 Ga0495585_0000268_29801_30256 149
86 3300046492 Ga0495585_0215461 Ga0495585_0215461_371_826 149
87 3300046507 Ga0495606_0009027 Ga0495606_0009027_551_1030 149
88 3300046507 Ga0495606_0023338 Ga0495606_0023338_3971_4429 149
89 3300046513 Ga0495616_0051386 Ga0495616_0051386_742_1197 149
90 3300046518 Ga0495631_0056622 Ga0495631_0056622_436_891 149
91 3300046524 Ga0495648_0008346 Ga0495648_0008346_5429_5884 149
92 3300046530 Ga0495654_0211456 Ga0495654_0211456_282_737 149
93 3300046538 Ga0495609_0007404 Ga0495609_0007404_4388_4843 149
94 3300046558 Ga0495633_0002082 Ga0495633_0002082_13030_13485 149
95 3300046616 Ga0495668_0000009 Ga0495668_0000009_262513_262968 149
96 3300046660 Ga0495625_0000385 Ga0495625_0000385_41577_42032 149
97 3300046660 Ga0495625_0001975 Ga0495625_0001975_7266_7721 149
98 3300046683 Ga0495658_0037745 Ga0495658_0037745_108_563 149
99 3300046809 Ga0495600_0402960 Ga0495600_0402960_273_728 149
100 3300047472 Ga0495686_0000299 Ga0495686_0000299_22937_23395 149
101 3300048089 Ga0495614_0014365 Ga0495614_0014365_2230_2685 149
102 3300050493 nmdc:mga0k408_544_c1 nmdc:mga0k408_544_c1_6269_6724 149
103 3300050493 nmdc:mga0k408_65692_c1 nmdc:mga0k408_65692_c1_705_1166 149
104 3300053080 Ga0500635_0001217 Ga0500635_0001217_3500_3961 149
105 3300053091 Ga0500647_0208127 Ga0500647_0208127_311_766 149
106 3300053093 Ga0500651_0000455 Ga0500651_0000455_17103_17552 149
107 3300053123 Ga0500614_014079 Ga0500614_014079_1296_1751 149
108 iso_pu_bacteria 2911138879 2911141601 149
109 3300001990 JGI24737J22298_10014915 JGI24737J22298_100149152 150
110 3300001991 JGI24743J22301_10021464 JGI24743J22301_100214642 150
111 3300002067 JGI24735J21928_10096890 JGI24735J21928_100968902 150
112 3300002077 JGI24744J21845_10002459 JGI24744J21845_100024594 150
113 3300002737 JGI25162J39368_1001035 JGI25162J39368_10010354 150
114 3300002773 JGI25152J39213_1000195 JGI25152J39213_10001958 150
115 3300002774 JGI25150J39212_1000014 JGI25150J39212_100001441 150
116 3300003187 JGI25151J46595_10000042 JGI25151J46595_1000004241 150
117 3300003214 JGI25165J46597_1010761 JGI25165J46597_10107612 150
118 3300003215 JGI25153J46596_10000009 JGI25153J46596_1000000941 150
119 3300003320 rootH2_10185660 rootH2_101856603 150
120 3300004799 Ga0058863_10039596 Ga0058863_100395962 150
121 3300004803 Ga0058862_10959678 Ga0058862_109596782 150
122 3300005288 Ga0065714_10193023 Ga0065714_101930231 150
123 3300005327 Ga0070658_10084497 Ga0070658_100844972 150
124 3300005328 Ga0070676_10000004 Ga0070676_1000000451 150
125 3300005334 Ga0068869_100272521 Ga0068869_1002725211 150
126 3300005336 Ga0070680_100011331 Ga0070680_1000113314 150
127 3300005338 Ga0068868_100008840 Ga0068868_1000088404 150
128 3300005338 Ga0068868_100175394 Ga0068868_1001753942 150
129 3300005354 Ga0070675_100973184 Ga0070675_1009731841 150
130 3300005355 Ga0070671_100028142 Ga0070671_1000281422 150
131 3300005355 Ga0070671_100995310 Ga0070671_1009953101 150
132 3300005367 Ga0070667_100421105 Ga0070667_1004211051 150
133 3300005435 Ga0070714_100131620 Ga0070714_1001316203 150
134 3300005456 Ga0070678_100001206 Ga0070678_1000012069 150
135 3300005457 Ga0070662_100082408 Ga0070662_1000824082 150
136 3300005458 Ga0070681_10002077 Ga0070681_1000207713 150
137 3300005459 Ga0068867_100000636 Ga0068867_10000063615 150
138 3300005466 Ga0070685_10078617 Ga0070685_100786172 150
139 3300005530 Ga0070679_100031317 Ga0070679_1000313173 150
140 3300005530 Ga0070679_100188124 Ga0070679_1001881242 150
141 3300005535 Ga0070684_100084273 Ga0070684_1000842732 150
142 3300005535 Ga0070684_100893059 Ga0070684_1008930591 150
143 3300005539 Ga0068853_100008704 Ga0068853_1000087042 150
144 3300005539 Ga0068853_100233972 Ga0068853_1002339722 150
145 3300005543 Ga0070672_100481786 Ga0070672_1004817862 150
146 3300005563 Ga0068855_100000049 Ga0068855_10000004972 150
147 3300005563 Ga0068855_100000658 Ga0068855_10000065825 150
148 3300005563 Ga0068855_100129646 Ga0068855_1001296462 150
149 3300005563 Ga0068855_100233879 Ga0068855_1002338792 150
150 3300005577 Ga0068857_100278036 Ga0068857_1002780362 150
151 3300005614 Ga0068856_100000424 Ga0068856_1000004245 150
152 3300005614 Ga0068856_100337910 Ga0068856_1003379103 150
153 3300005614 Ga0068856_100451024 Ga0068856_1004510241 150
154 3300005616 Ga0068852_100239174 Ga0068852_1002391742 150
155 3300005718 Ga0068866_10034351 Ga0068866_100343512 150
156 3300005840 Ga0068870_10094485 Ga0068870_100944853 150
157 3300006163 Ga0070715_10184211 Ga0070715_101842112 150
158 3300006237 Ga0097621_100002869 Ga0097621_1000028697 150
159 3300006353 Ga0075370_10034846 Ga0075370_100348462 150
160 3300006358 Ga0068871_100000021 Ga0068871_1000000214 150
161 3300006881 Ga0068865_100000045 Ga0068865_10000004526 150
162 3300009093 Ga0105240_10028192 Ga0105240_100281926 150
163 3300009174 Ga0105241_10133391 Ga0105241_101333912 150
164 3300009176 Ga0105242_10113678 Ga0105242_101136781 150
165 3300009176 Ga0105242_10176773 Ga0105242_101767731 150
166 3300009176 Ga0105242_10873494 Ga0105242_108734942 150
167 3300009177 Ga0105248_11890330 Ga0105248_118903302 150
168 3300009545 Ga0105237_10008501 Ga0105237_100085017 150
169 3300009551 Ga0105238_10002640 Ga0105238_100026404 150
170 3300010375 Ga0105239_10027624 Ga0105239_100276243 150
171 3300010375 Ga0105239_10430540 Ga0105239_104305402 150
172 3300011119 Ga0105246_10276162 Ga0105246_102761622 150
173 3300013100 Ga0157373_10000493 Ga0157373_1000049313 150
174 3300013100 Ga0157373_10008371 Ga0157373_100083714 150
175 3300013100 Ga0157373_10220451 Ga0157373_102204512 150
176 3300013102 Ga0157371_10000266 Ga0157371_1000026618 150
177 3300013102 Ga0157371_10339904 Ga0157371_103399042 150
178 3300013104 Ga0157370_10106422 Ga0157370_101064222 150
179 3300013104 Ga0157370_10548843 Ga0157370_105488432 150
180 3300013104 Ga0157370_11428322 Ga0157370_114283221 150
181 3300013105 Ga0157369_10107257 Ga0157369_101072573 150
182 3300013105 Ga0157369_10162043 Ga0157369_101620432 150
183 3300013105 Ga0157369_10489426 Ga0157369_104894262 150
184 3300013296 Ga0157374_10017554 Ga0157374_100175543 150
185 3300013297 Ga0157378_10028410 Ga0157378_100284105 150
186 3300013297 Ga0157378_10621540 Ga0157378_106215402 150
187 3300013307 Ga0157372_10000251 Ga0157372_1000025117 150
188 3300013307 Ga0157372_10001839 Ga0157372_100018392 150
189 3300013307 Ga0157372_10002319 Ga0157372_100023196 150
190 3300013308 Ga0157375_10250437 Ga0157375_102504373 150
191 3300014325 Ga0163163_10168544 Ga0163163_101685442 150
192 3300014326 Ga0157380_11274298 Ga0157380_112742981 150
193 3300014969 Ga0157376_10544455 Ga0157376_105444551 150
194 3300015261 Ga0182006_1002791 Ga0182006_10027918 150
195 3300017792 Ga0163161_10932229 Ga0163161_109322292 150
196 3300025230 Ga0209563_115289 Ga0209563_1152892 150
197 3300025231 Ga0207427_100025 Ga0207427_10002527 150
198 3300025233 Ga0209437_100010 Ga0209437_100010289 150
199 3300025245 Ga0207425_1000023 Ga0207425_100002341 150
200 3300025258 Ga0209129_1000032 Ga0209129_1000032232 150
201 3300025261 Ga0209233_1000017 Ga0209233_1000017302 150
202 3300025261 Ga0209233_1008486 Ga0209233_10084862 150
203 3300025294 Ga0209025_1000047 Ga0209025_1000047232 150
204 3300025297 Ga0209758_1000145 Ga0209758_100014541 150
205 3300025907 Ga0207645_10000151 Ga0207645_1000015148 150
206 3300025908 Ga0207643_10290442 Ga0207643_102904422 150
207 3300025909 Ga0207705_10087314 Ga0207705_100873141 150
208 3300025912 Ga0207707_10005461 Ga0207707_100054618 150
209 3300025913 Ga0207695_10008283 Ga0207695_100082833 150
210 3300025913 Ga0207695_10018922 Ga0207695_100189223 150
211 3300025913 Ga0207695_10046570 Ga0207695_100465705 150
212 3300025914 Ga0207671_10011028 Ga0207671_100110283 150
213 3300025914 Ga0207671_10026560 Ga0207671_100265604 150
214 3300025917 Ga0207660_10006965 Ga0207660_100069654 150
215 3300025921 Ga0207652_10066856 Ga0207652_100668563 150
216 3300025921 Ga0207652_10154826 Ga0207652_101548262 150
217 3300025924 Ga0207694_10018165 Ga0207694_100181652 150
218 3300025934 Ga0207686_10107006 Ga0207686_101070063 150
219 3300025934 Ga0207686_10109125 Ga0207686_101091252 150
220 3300025934 Ga0207686_10220432 Ga0207686_102204322 150
221 3300025938 Ga0207704_10000077 Ga0207704_1000007743 150
222 3300025940 Ga0207691_10889652 Ga0207691_108896521 150
223 3300025944 Ga0207661_10244444 Ga0207661_102444442 150
224 3300025949 Ga0207667_10000015 Ga0207667_10000015322 150
225 3300025949 Ga0207667_10001998 Ga0207667_100019987 150
226 3300025960 Ga0207651_10025271 Ga0207651_100252712 150
227 3300025986 Ga0207658_10519662 Ga0207658_105196621 150
228 3300026041 Ga0207639_10006130 Ga0207639_100061305 150
229 3300026078 Ga0207702_10010544 Ga0207702_100105447 150
230 3300026078 Ga0207702_10392507 Ga0207702_103925072 150
231 3300026078 Ga0207702_10415007 Ga0207702_104150071 150
232 3300026089 Ga0207648_10001095 Ga0207648_1000109523 150
233 3300026121 Ga0207683_10005179 Ga0207683_100051794 150
234 3300026142 Ga0207698_10022714 Ga0207698_100227142 150
235 3300026142 Ga0207698_10239102 Ga0207698_102391022 150
236 3300028794 Ga0307515_10041837 Ga0307515_100418373 150
237 3300028800 Ga0265338_10043008 Ga0265338_100430082 150
238 3300030744 Ga0316181_1052441 Ga0316181_10524411 150
239 3300031251 Ga0265327_10019584 Ga0265327_100195843 150
240 3300031507 Ga0307509_10062346 Ga0307509_100623462 150
241 3300032004 Ga0307414_10025723 Ga0307414_100257232 150
242 3300032004 Ga0307414_10046040 Ga0307414_100460402 150
243 3300032004 Ga0307414_10091575 Ga0307414_100915751 150
244 3300032004 Ga0307414_10153981 Ga0307414_101539813 150
245 3300035111 Ga0373923_0290361 Ga0373923_0290361_201_656 150
246 3300035115 Ga0373941_0074133 Ga0373941_0074133_251_706 150
247 3300035172 Ga0373955_0425243 Ga0373955_0425243_304_783 150
248 3300036401 Ga0373937_0050811 Ga0373937_0050811_1363_1842 150
249 3300036401 Ga0373937_0347916 Ga0373937_0347916_394_870 150
250 3300037312 Ga0395899_0000021 Ga0395899_0000021_229754_230221 150
251 3300037312 Ga0395899_0000749 Ga0395899_0000749_27715_28182 150
252 3300037418 Ga0395900_0000406 Ga0395900_0000406_7468_7935 150
253 3300037418 Ga0395900_0027830 Ga0395900_0027830_3544_4011 150
254 3300037418 Ga0395900_0032777 Ga0395900_0032777_622_1086 150
255 3300037418 Ga0395900_0056520 Ga0395900_0056520_1827_2291 150
256 3300037418 Ga0395900_0242336 Ga0395900_0242336_1116_1580 150
257 3300037466 Ga0395898_0003004 Ga0395898_0003004_2493_2960 150
258 3300037471 Ga0395905_0000001 Ga0395905_0000001_1269594_1270070 150
259 3300037471 Ga0395905_0000175 Ga0395905_0000175_58249_58716 150
260 3300037471 Ga0395905_0000981 Ga0395905_0000981_35242_35706 150
261 3300037471 Ga0395905_0426298 Ga0395905_0426298_497_964 150
262 3300038443 Ga0395901_0000313 Ga0395901_0000313_55133_55600 150
263 3300038443 Ga0395901_0158398 Ga0395901_0158398_791_1258 150
264 3300038443 Ga0395901_0274631 Ga0395901_0274631_70_534 150
265 3300046454 Ga0495592_0103326 Ga0495592_0103326_101_577 150
266 3300046462 Ga0495651_0076728 Ga0495651_0076728_92_559 150
267 3300046525 Ga0495663_0060424 Ga0495663_0060424_193_654 150
268 3300046536 Ga0495587_0224485 Ga0495587_0224485_165_641 150
269 3300046642 Ga0495634_0118216 Ga0495634_0118216_499_975 150
270 3300047444 Ga0495675_0755446 Ga0495675_0755446_14_490 150
271 3300047471 Ga0495684_0054703 Ga0495684_0054703_737_1213 150
272 3300047472 Ga0495686_0001086 Ga0495686_0001086_9940_10401 150
273 3300048918 Ga0496115_0053918 Ga0496115_0053918_720_1181 150
274 3300049758 Ga0501241_001051 Ga0501241_001051_2946_3398 150
275 3300050496 nmdc:mga07m45_34229_c1 nmdc:mga07m45_34229_c1_1459_1932 150
276 3300053077 Ga0495601_0824374 Ga0495601_0824374_61_537 150
277 3300053090 Ga0500646_0151029 Ga0500646_0151029_132_599 150
278 iso_pu_bacteria 2522125168 2522551135 150
279 iso_pu_bacteria 2738543023 2739303239 150
280 3300003781 Ga0055536_1000019 Ga0055536_1000019144 151
281 3300003791 Ga0055530_10001246 Ga0055530_100012467 151
282 3300005288 Ga0065714_10184564 Ga0065714_101845641 151
283 3300005339 Ga0070660_100290705 Ga0070660_1002907051 151
284 3300005340 Ga0070689_100198483 Ga0070689_1001984832 151
285 3300005616 Ga0068852_100055048 Ga0068852_1000550483 151
286 3300005616 Ga0068852_100597844 Ga0068852_1005978442 151
287 3300005617 Ga0068859_101792169 Ga0068859_1017921691 151
288 3300006931 Ga0097620_101791768 Ga0097620_1017917682 151
289 3300009036 Ga0105244_10416614 Ga0105244_104166141 151
290 3300009093 Ga0105240_10194574 Ga0105240_101945742 151
291 3300009093 Ga0105240_10788472 Ga0105240_107884722 151
292 3300009545 Ga0105237_10000578 Ga0105237_100005788 151
293 3300013100 Ga0157373_10006735 Ga0157373_100067354 151
294 3300013102 Ga0157371_10000918 Ga0157371_1000091814 151
295 3300013102 Ga0157371_10017950 Ga0157371_100179503 151
296 3300013104 Ga0157370_10143654 Ga0157370_101436542 151
297 3300013104 Ga0157370_10143766 Ga0157370_101437662 151
298 3300013104 Ga0157370_10158839 Ga0157370_101588392 151
299 3300013105 Ga0157369_10000031 Ga0157369_1000003116 151
300 3300013296 Ga0157374_10686684 Ga0157374_106866842 151
301 3300013306 Ga0163162_10000093 Ga0163162_1000009361 151
302 3300013306 Ga0163162_10035771 Ga0163162_100357715 151
303 3300013307 Ga0157372_10037713 Ga0157372_100377134 151
304 3300013307 Ga0157372_10175028 Ga0157372_101750282 151
305 3300014497 Ga0182008_10000082 Ga0182008_1000008240 151
306 3300014497 Ga0182008_10000503 Ga0182008_1000050320 151
307 3300015261 Ga0182006_1000424 Ga0182006_100042425 151
308 3300015261 Ga0182006_1001382 Ga0182006_10013828 151
309 3300015261 Ga0182006_1003339 Ga0182006_10033398 151
310 3300015262 Ga0182007_10000002 Ga0182007_1000000247 151
311 3300015682 Ga0183373_1004 Ga0183373_1004424 151
312 3300025250 Ga0209026_1000805 Ga0209026_100080515 151
313 3300025250 Ga0209026_1016149 Ga0209026_10161492 151
314 3300025292 Ga0209676_1000009 Ga0209676_100000941 151
315 3300025298 Ga0209050_1000094 Ga0209050_100009441 151
316 3300025728 Ga0207655_1057709 Ga0207655_10577093 151
317 3300025913 Ga0207695_10273487 Ga0207695_102734872 151
318 3300025913 Ga0207695_10659425 Ga0207695_106594252 151
319 3300026142 Ga0207698_10576028 Ga0207698_105760282 151
320 3300030745 Ga0316182_1346660 Ga0316182_13466602 151
321 3300031731 Ga0307405_11061359 Ga0307405_110613592 151
322 3300032005 Ga0307411_10700754 Ga0307411_107007541 151
323 3300044712 Ga0453684_0008451 Ga0453684_0008451_15645_16178 151
324 3300046507 Ga0495606_0029375 Ga0495606_0029375_1908_2366 151
325 3300046512 Ga0495610_0009337 Ga0495610_0009337_4656_5114 151
326 3300046512 Ga0495610_0011497 Ga0495610_0011497_290_769 151
327 3300046520 Ga0495637_0065417 Ga0495637_0065417_665_1123 151
328 3300046558 Ga0495633_0065525 Ga0495633_0065525_796_1254 151
329 3300047470 Ga0495681_0085159 Ga0495681_0085159_253_711 151
330 3300048918 Ga0496115_0309179 Ga0496115_0309179_202_681 151
331 3300048925 Ga0496122_0000869 Ga0496122_0000869_38731_39186 151
332 3300048926 Ga0496123_0009832 Ga0496123_0009832_7445_7900 151
333 3300048928 Ga0496125_0086359 Ga0496125_0086359_1109_1564 151
334 3300049663 Ga0501223_000187 Ga0501223_000187_11762_12220 151
335 3300049766 Ga0501269_008758 Ga0501269_008758_153_617 151
336 3300059639 Ga0587062_002509 Ga0587062_002509_1090_1584 151
337 2162886007 SwRhRL2b_contig_928690 SwRhRL2b_0974.00003340 152
338 3300003781 Ga0055536_1007821 Ga0055536_10078214 152
339 3300005262 Ga0065165_1000169 Ga0065165_100016933 152
340 3300005578 Ga0068854_100756677 Ga0068854_1007566772 152
341 3300013102 Ga0157371_10021981 Ga0157371_100219812 152
342 3300013102 Ga0157371_10420053 Ga0157371_104200532 152
343 3300013102 Ga0157371_10528245 Ga0157371_105282452 152
344 3300013104 Ga0157370_10112781 Ga0157370_101127812 152
345 3300013104 Ga0157370_10411582 Ga0157370_104115821 152
346 3300017792 Ga0163161_11680749 Ga0163161_116807491 152
347 3300025292 Ga0209676_1000329 Ga0209676_100032947 152
348 3300025298 Ga0209050_1032930 Ga0209050_10329302 152
349 3300028573 Ga0265334_10007918 Ga0265334_100079185 152
350 3300031548 Ga0307408_101076052 Ga0307408_1010760522 152
351 3300031731 Ga0307405_10004464 Ga0307405_100044643 152
352 3300032004 Ga0307414_10093544 Ga0307414_100935442 152
353 3300037418 Ga0395900_0812632 Ga0395900_0812632_370_852 152
354 3300041456 Ga0451795_1706276 Ga0451795_1706276_165_695 152
355 3300045051 Ga0451576_0000002 Ga0451576_0000002_315814_316371 152
356 3300047472 Ga0495686_0442680 Ga0495686_0442680_101_634 152
357 3300049758 Ga0501241_009103 Ga0501241_009103_845_1303 152
358 3300053158 Ga0500627_0199007 Ga0500627_0199007_153_635 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

35

153

0.96

PF14437

MafB19-deam

MafB19-like deaminase

36

177

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p9e-assembly1.cif.gz_A crystal structure of dcmp deaminase from the cyanophage s-tim5 in apo form 0.8904 4 151
4p9e-assembly1.cif.gz_A crystal structure of dcmp deaminase from the cyanophage s-tim5 in apo form 0.8837 4 151
2obc-assembly1.cif.gz_A the crystal structure of ribd from escherichia coli in complex with a substrate analogue, ribose 5-phosphate (beta form), bound to the active site of the reductase domain 0.86 10 150
2hvv-assembly1.cif.gz_A crystal structure of dcmp deaminase from streptococcus mutans 0.8596 6 152
4p9c-assembly1.cif.gz_J crystal structure of dcmp deaminase from the cyanophage s-tim5 in complex with dcmp and dump 0.8508 3 151
ID Description Score Start End Superfamily
4p9eA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8904 4 151 3.40.140.10
4p9eA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8837 4 151 3.40.140.10
af_A0A0R4J5D0_79_182_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.8744 30 45 2.60.40.150
2hvvA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8596 6 152 3.40.140.10
2hvvA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.821 6 152 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A4Q3TH58-F1-model_v4 deleted 1.004 84 152
AF-A0A4Q3LGC6-F1-model_v4 deleted 0.9916 88 152
AF-A0A3D9KVU5-F1-model_v4 Cytidine/deoxycytidylate deaminase-like protein 0.9718 76 152 GO:0004132
GO:0005737
GO:0009972
AF-A0A4Q3LGC6-F1-model_v4 deleted 0.9622 88 152
AF-A0A497RHL0-F1-model_v4 Cytidine deaminase 0.9608 76 151 GO:0004132
GO:0004519
GO:0005737
GO:0008270
GO:0009972
GO:0016539

Feature Viewer

pLDDT pTM Quality
83.53 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map