F421134

General Info

Members Datasets Scaffolds Average Seq Length
358 301 248 426

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100079299|Ga0075428_1000792991
Length 471
Sequence MSPPKRQSVTRRDFIATMAAMSAAAGAFALSAGGVSAAPLSVXAPHDSLGSTTSTSDTAGVNPMIDQMTSAQAQNTAIRPFVVDIPDADLDDLRQRINATKWPEREQVSDSSQGVPLATMQKLARYWASDYDFRRLQAKLNAVPNLMTEIDGLDIHFIHVRSQHENALPIIVTHGWPGSIVEQLKIVEPLTNPTAYGGSASDAFDLVIPSLPGYGFSGKPTEPGWNPVRIARAWATLMQRLGYTRYVAQGGDWGNAVTEFMGVQEPAGLLGIHTNMPAAEPISISKALAANEAPPTNLTADELNAWNQLDFFNKNGLGYAIEMNNRPQTLYGIVDSPIGLASWMLDHDARSQEMIARVFDGEVQSGVLTRDDILDNVTLYWVTNTAISSARLYWDNAHHPTGGFFDPRGIKIPVAVSVFPDEIYAAPETWVRAAYPNLIYFNKLDRGGHFAAFEQPALFTQEMRAAFRSLR

Samples

Sample ID Description Type Environment
1 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
4 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
5 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
6 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
7 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
8 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
9 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
10 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
11 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
12 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
13 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
14 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
15 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
16 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
17 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
18 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
19 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2791355260 Rhizobium sp. L9 Isolate Nodule
22 2802429633 Rhizobium anhuiense J3 Isolate Nodule
23 2802429634 Rhizobium anhuiense S10 Isolate Nodule
24 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
25 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
26 2802429637 Rhizobium anhuiense C15 Isolate Nodule
27 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
28 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
29 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
30 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
31 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
32 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
33 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
34 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
35 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
36 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
37 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
38 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
39 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
40 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
41 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
42 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
43 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
44 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
45 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
46 2851182111 Bosea sp. Tri-44 Isolate Nodule
47 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
48 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
49 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
50 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
51 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
52 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
53 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
54 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
55 2922368715
56 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
57 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
58 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
59 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
60 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
61 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
62 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
63 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
64 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
65 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
66 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
67 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
68 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
69 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
70 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
71 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
72 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
73 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
74 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
75 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
76 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
77 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
78 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
79 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
80 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
81 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
82 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
83 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
84 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
85 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
86 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
87 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
88 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
89 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
90 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
91 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
92 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
93 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
94 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
95 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
98 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
99 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
100 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
101 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
102 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
103 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
104 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
105 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
106 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
107 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
108 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
109 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
110 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
111 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
112 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
113 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
114 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
121 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
122 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
123 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
124 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
125 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
126 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
127 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
128 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
171 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
172 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
175 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
200 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
201 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
274 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
277 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
281 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
284 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
285 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
286 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
287 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
288 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
289 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
290 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
291 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
292 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
293 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
294 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
295 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
296 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
297 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
298 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
299 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
300 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
301 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.47
Metatranscriptomes 0
Isolates 30.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.32
Nodule 26.26
Rhizoplane 8.1
Rhizosphere 38.27
Stem 0
Stem Tuber 0
Unclassified 10.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001028 3300003187 Bacteria 20920
2 JGI25153J46596_10006938 3300003215 Bacteria 5644
3 JGI25153J46596_10025843 3300003215 Bacteria 2090
4 JGI25160J50197_1003325 3300003354 Bacteria 7233
5 JGI25161J50226_1001432 3300003374 Bacteria 7181
6 Ga0055526_1000599 3300003771 Bacteria 28366
7 Ga0055526_1010046 3300003771 Bacteria 4459
8 Ga0055524_1001831 3300003775 Bacteria 11653
9 Ga0055524_1018123 3300003775 Bacteria 2456
10 Ga0055528_1000269 3300003790 Bacteria 44061
11 Ga0055528_1007602 3300003790 Bacteria 4768
12 Ga0055540_1006121 3300003792 Bacteria 4850
13 Ga0055543_1000329 3300004625 Bacteria 32613
14 Ga0065165_1003879 3300005262 Bacteria 9908
15 Ga0070680_100030578 3300005336 Bacteria 4326
16 Ga0070668_100081704 3300005347 Bacteria 2534
17 Ga0070709_10000426 3300005434 Bacteria 25549
18 Ga0070709_10013338 3300005434 Bacteria 4618
19 Ga0070714_100034288 3300005435 Bacteria 4250
20 Ga0070710_10000666 3300005437 Bacteria 16299
21 Ga0070711_100041713 3300005439 Bacteria 3101
22 Ga0070681_10288528 3300005458 Bacteria 1551
23 Ga0070681_10343586 3300005458 Bacteria 1402
24 Ga0070707_100290072 3300005468 Bacteria 1590
25 Ga0070707_100375288 3300005468 Bacteria 1382
26 Ga0070698_100102544 3300005471 Bacteria 2832
27 Ga0070679_100007488 3300005530 Bacteria 10209
28 Ga0070684_100012810 3300005535 Bacteria 6736
29 Ga0070665_100050529 3300005548 Bacteria 4172
30 Ga0068855_100000006 3300005563 Bacteria 298092
31 Ga0068852_100013252 3300005616 Bacteria 6304
32 Ga0068859_100132636 3300005617 Bacteria 2563
33 Ga0068860_100087567 3300005843 Bacteria 2964
34 Ga0081455_10057741 3300005937 Bacteria 3288
35 Ga0075365_10001474 3300006038 Bacteria 10699
36 Ga0075363_100018925 3300006048 Bacteria 3437
37 Ga0075363_100100834 3300006048 Bacteria 1598
38 Ga0075364_10019563 3300006051 Bacteria 4250
39 Ga0070716_100003639 3300006173 Bacteria 7290
40 Ga0070712_100020476 3300006175 Bacteria 4329
41 Ga0075362_10000395 3300006177 Bacteria 12551
42 Ga0075367_10021839 3300006178 Bacteria 3583
43 Ga0075369_10000652 3300006186 Bacteria 11053
44 Ga0075366_10001952 3300006195 Bacteria 10429
45 Ga0075370_10017710 3300006353 Bacteria 3852
46 Ga0075370_10020296 3300006353 Bacteria 3630
47 Ga0075370_10067795 3300006353 Bacteria 2037
48 Ga0075428_100079299 3300006844 Bacteria 3584
49 Ga0075430_100000150 3300006846 Bacteria 44915
50 Ga0075431_100000478 3300006847 Bacteria 33199
51 Ga0099823_1000042 3300006944 Bacteria 60927
52 Ga0075435_100157213 3300007076 Bacteria 1913
53 Ga0105240_10000080 3300009093 Bacteria 195633
54 Ga0105240_10125575 3300009093 Bacteria 3084
55 Ga0105238_10210396 3300009551 Bacteria 1921
56 Ga0105239_10001026 3300010375 Bacteria 39003
57 Ga0105239_10014353 3300010375 Bacteria 8789
58 Ga0105239_10188115 3300010375 Bacteria 2311
59 Ga0157370_10135032 3300013104 Bacteria 2300
60 Ga0157369_10076134 3300013105 Bacteria 3597
61 Ga0157374_10026169 3300013296 Bacteria 5247
62 Ga0157372_10201391 3300013307 Bacteria 2306
63 Ga0157375_10011244 3300013308 Bacteria 7899
64 Ga0163163_10026693 3300014325 Bacteria 5524
65 Ga0213876_10000618 3300021384 Bacteria 26166
66 Ga0213876_10004956 3300021384 Bacteria 7364
67 Ga0209148_1000647 3300025254 Bacteria 30166
68 Ga0209129_1002229 3300025258 Bacteria 9710
69 Ga0209673_1000013 3300025273 Bacteria 571633
70 Ga0209673_1000325 3300025273 Bacteria 87535
71 Ga0209675_1010007 3300025291 Bacteria 3282
72 Ga0209025_1000483 3300025294 Bacteria 77146
73 Ga0209564_1000264 3300025295 Bacteria 111404
74 Ga0209564_1002390 3300025295 Bacteria 15002
75 Ga0209758_1001861 3300025297 Bacteria 23130
76 Ga0209758_1017623 3300025297 Bacteria 3543
77 Ga0209758_1022250 3300025297 Bacteria 2917
78 Ga0209256_1000245 3300025299 Bacteria 96643
79 Ga0209256_1000369 3300025299 Bacteria 72557
80 Ga0209256_1023602 3300025299 Bacteria 1830
81 Ga0207426_1000039 3300025302 Bacteria 439937
82 Ga0207426_1006759 3300025302 Bacteria 4913
83 Ga0209051_1010056 3300025303 Bacteria 4814
84 Ga0207692_10002567 3300025898 Bacteria 6981
85 Ga0207699_10000472 3300025906 Bacteria 20441
86 Ga0207699_10088851 3300025906 Bacteria 1935
87 Ga0207707_10034051 3300025912 Bacteria 4457
88 Ga0207695_10000004 3300025913 Bacteria 1288665
89 Ga0207695_10038424 3300025913 Bacteria 5154
90 Ga0207693_10014865 3300025915 Bacteria 6253
91 Ga0207693_10035469 3300025915 Bacteria 3932
92 Ga0207663_10088706 3300025916 Bacteria 2046
93 Ga0207694_10000014 3300025924 Bacteria 374435
94 Ga0207700_10161479 3300025928 Bacteria 1861
95 Ga0207664_10024377 3300025929 Bacteria 4546
96 Ga0207664_10189361 3300025929 Bacteria 1770
97 Ga0207665_10007685 3300025939 Bacteria 7118
98 Ga0207667_10000202 3300025949 Bacteria 86408
99 Ga0207667_10192297 3300025949 Bacteria 2094
100 Ga0207703_10177599 3300026035 Bacteria 1877
101 Ga0207678_10006129 3300026067 Bacteria 10695
102 Ga0207678_10008930 3300026067 Bacteria 8824
103 Ga0207678_10070483 3300026067 Bacteria 2997
104 Ga0207698_10002106 3300026142 Bacteria 11733
105 Ga0209389_1000135 3300027296 Bacteria 64901
106 Ga0209489_100653 3300027361 Bacteria 67569
107 Ga0209700_100417 3300027363 Bacteria 77663
108 Ga0268266_10054393 3300028379 Bacteria 3439
109 Ga0268266_10087728 3300028379 Bacteria 2722
110 Ga0268266_10143283 3300028379 Bacteria 2146
111 Ga0268266_10164516 3300028379 Bacteria 2009
112 Ga0268266_10166490 3300028379 Bacteria 1997
113 Ga0268266_10295250 3300028379 Bacteria 1510
114 Ga0265337_1001144 3300028556 Bacteria 13549
115 Ga0265326_10000343 3300028558 Bacteria 19752
116 Ga0265319_1000708 3300028563 Bacteria 21771
117 Ga0265334_10000334 3300028573 Bacteria 25204
118 Ga0265323_10000353 3300028653 Bacteria 26349
119 Ga0265336_10000288 3300028666 Bacteria 34727
120 Ga0307515_10005688 3300028794 Bacteria 25165
121 Ga0265338_10001718 3300028800 Bacteria 34727
122 Ga0265324_10001490 3300029957 Bacteria 13283
123 Ga0265325_10063521 3300031241 Bacteria 1868
124 Ga0265340_10028759 3300031247 Bacteria 2794
125 Ga0307513_10011512 3300031456 Bacteria 10990
126 Ga0307406_10016529 3300031901 Bacteria 4290
127 Ga0307414_10037586 3300032004 Bacteria 3243
128 Ga0373942_0038183 3300035207 Bacteria 1301
129 Ga0373937_0001326 3300036401 Bacteria 20714
130 Ga0395899_0092973 3300037312 Bacteria 2183
131 Ga0395900_0018815 3300037418 Bacteria 7045
132 Ga0395900_0048938 3300037418 Bacteria 4354
133 Ga0395905_0035293 3300037471 Bacteria 4695
134 Ga0395905_0053913 3300037471 Bacteria 3763
135 Ga0395901_0002280 3300038443 Bacteria 19557
136 Ga0436365_0506456 3300039437 Bacteria 108332
137 Ga0436365_1279294 3300039437 Bacteria 2754
138 Ga0436362_0665260 3300039453 Bacteria 7311
139 Ga0451787_243528 3300041441 Bacteria 4332
140 Ga0451793_1805869 3300041452 Bacteria 1335
141 Ga0451833_0058585 3300041491 Bacteria 8618
142 Ga0451835_0213409 3300041492 Bacteria 3737
143 Ga0451841_0901789 3300041498 Bacteria 2461
144 Ga0451849_0701709 3300041505 Bacteria 2951
145 Ga0466965_0056172 3300044683 Bacteria 1960
146 Ga0466960_0069794 3300044901 Bacteria 1747
147 Ga0495592_0000014 3300046454 Bacteria 148128
148 Ga0495651_0000092 3300046462 Bacteria 66143
149 Ga0495653_0007693 3300046463 Bacteria 8819
150 Ga0495605_0026708 3300046474 Bacteria 2999
151 Ga0495662_0015328 3300046476 Bacteria 3723
152 Ga0495584_0032856 3300046491 Bacteria 2625
153 Ga0495585_0008348 3300046492 Bacteria 6282
154 Ga0495607_0030436 3300046501 Bacteria 3314
155 Ga0495606_0010303 3300046507 Bacteria 7777
156 Ga0495608_0000069 3300046511 Bacteria 77626
157 Ga0495610_0034967 3300046512 Bacteria 2584
158 Ga0495616_0026191 3300046513 Bacteria 3107
159 Ga0495618_0000367 3300046514 Bacteria 32598
160 Ga0495628_0000021 3300046516 Bacteria 148194
161 Ga0495643_0001054 3300046522 Bacteria 27796
162 Ga0495643_0045356 3300046522 Bacteria 2386
163 Ga0495648_0003811 3300046524 Bacteria 13096
164 Ga0495652_0000279 3300046529 Bacteria 60365
165 Ga0495587_0000057 3300046536 Bacteria 95361
166 Ga0495597_0018130 3300046542 Bacteria 3306
167 Ga0495645_0000019 3300046543 Bacteria 147666
168 Ga0495625_0049490 3300046660 Bacteria 3021
169 Ga0495599_0000151 3300046678 Bacteria 45548
170 Ga0495623_0000008 3300046679 Bacteria 128380
171 Ga0495646_0000851 3300046680 Bacteria 17283
172 Ga0495669_0062531 3300046684 Bacteria 1687
173 Ga0495600_0075919 3300046809 Bacteria 2194
174 Ga0495660_0043912 3300046810 Bacteria 2461
175 Ga0495604_0001891 3300047317 Bacteria 17007
176 Ga0495604_0027685 3300047317 Bacteria 4506
177 Ga0495680_0046883 3300047322 Bacteria 3405
178 Ga0495687_001535 3300047443 Bacteria 21035
179 Ga0495675_0000281 3300047444 Bacteria 36890
180 Ga0495602_0000262 3300048088 Bacteria 48336
181 Ga0496100_0000257 3300048903 Bacteria 27180
182 Ga0496101_0000780 3300048904 Bacteria 18852
183 Ga0496101_0055386 3300048904 Bacteria 2864
184 Ga0496102_0000601 3300048905 Bacteria 37653
185 Ga0496102_0001610 3300048905 Bacteria 19901
186 Ga0496102_0174491 3300048905 Bacteria 2024
187 Ga0496103_0000964 3300048906 Bacteria 20420
188 Ga0496104_0000973 3300048907 Bacteria 24535
189 Ga0496104_0216875 3300048907 Bacteria 1825
190 Ga0496105_0000354 3300048908 Bacteria 30235
191 Ga0496106_0004729 3300048909 Bacteria 10076
192 Ga0496106_0042611 3300048909 Bacteria 3404
193 Ga0496107_0012119 3300048910 Bacteria 6013
194 Ga0496107_0220606 3300048910 Bacteria 1410
195 Ga0496108_0015641 3300048911 Bacteria 6188
196 Ga0496109_0013288 3300048912 Bacteria 7133
197 Ga0496109_0016920 3300048912 Bacteria 6382
198 Ga0496110_0008992 3300048913 Bacteria 8058
199 Ga0496111_0035921 3300048914 Bacteria 3543
200 Ga0496112_0000233 3300048915 Bacteria 35609
201 Ga0496112_0165963 3300048915 Bacteria 2174
202 Ga0496112_0217594 3300048915 Bacteria 1866
203 Ga0496113_0002793 3300048916 Bacteria 10270
204 Ga0496114_0000503 3300048917 Bacteria 28593
205 Ga0496114_0050812 3300048917 Bacteria 3451
206 Ga0496115_0000321 3300048918 Bacteria 40923
207 Ga0496115_0099450 3300048918 Bacteria 2383
208 Ga0496116_0026215 3300048919 Bacteria 4269
209 Ga0496118_0031096 3300048921 Bacteria 4436
210 Ga0496118_0036061 3300048921 Bacteria 4004
211 Ga0496119_0086783 3300048922 Bacteria 1787
212 Ga0496120_0079822 3300048923 Bacteria 1775
213 Ga0496121_0031982 3300048924 Bacteria 4795
214 Ga0496121_0152658 3300048924 Bacteria 1698
215 Ga0496126_0000338 3300048929 Bacteria 98321
216 Ga0496126_0054634 3300048929 Bacteria 3616
217 Ga0496126_0080831 3300048929 Bacteria 2875
218 Ga0496126_0112396 3300048929 Bacteria 2372
219 Ga0496126_0150160 3300048929 Bacteria 1998
220 Ga0495682_0031462 3300049460 Bacteria 1960
221 nmdc:mga03683_1571_c1 3300050489 Bacteria 6817
222 nmdc:mga03n38_10810_c1 3300050490 Bacteria 3375
223 nmdc:mga0k408_16278_c1 3300050493 Bacteria 4124
224 nmdc:mga06z11_43660_c1 3300050494 Bacteria 2257
225 nmdc:mga07m45_1210_c1 3300050496 Bacteria 11689
226 nmdc:mga0qj67_97_c1 3300050509 Bacteria 58508
227 nmdc:mga06r32_569_c1 3300050510 Bacteria 32069
228 nmdc:mga0n895_266591_c1 3300050512 Bacteria 1737
229 nmdc:mga08x19_45196_c1 3300050514 Bacteria 2814
230 nmdc:mga0sz30_3468_c1 3300050516 Bacteria 5682
231 Ga0495601_0000167 3300053077 Bacteria 35185
232 Ga0495612_0056785 3300053078 Bacteria 1616
233 Ga0495595_0017253 3300053084 Bacteria 3106
234 Ga0495619_0000104 3300053085 Bacteria 63725
235 Ga0500569_000759 3300053109 Bacteria 5646
236 Ga0500595_000470 3300053119 Bacteria 24922
237 Ga0500595_001187 3300053119 Bacteria 14374
238 Ga0500658_0062799 3300053134 Bacteria 1549
239 Ga0500588_0020335 3300053146 Bacteria 1778
240 Ga0500590_000228 3300053148 Bacteria 17054
241 Ga0500616_0025908 3300053153 Bacteria 3251
242 Ga0500622_0043873 3300053156 Bacteria 2318
243 Ga0500622_0045023 3300053156 Bacteria 2285
244 Ga0500627_0012003 3300053158 Bacteria 3228
245 Ga0500636_0004998 3300053177 Bacteria 7526
246 Ga0500645_026789 3300053730 Bacteria 1752
247 Ga0500609_001054 3300053731 Bacteria 4119
248 Ga0500596_007219 3300053735 Bacteria 1833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0152658 Ga0496121_0152658_76_1224 382
2 3300053134 Ga0500658_0062799 Ga0500658_0062799_376_1530 382
3 3300005563 Ga0068855_100000006 Ga0068855_100000006206 392
4 3300005616 Ga0068852_100013252 Ga0068852_1000132524 392
5 3300025913 Ga0207695_10000004 Ga0207695_10000004669 392
6 3300025924 Ga0207694_10000014 Ga0207694_10000014276 392
7 3300025949 Ga0207667_10000202 Ga0207667_1000020270 392
8 3300026142 Ga0207698_10002106 Ga0207698_100021063 392
9 3300049460 Ga0495682_0031462 Ga0495682_0031462_28_1221 392
10 3300036401 Ga0373937_0001326 Ga0373937_0001326_12608_13810 393
11 3300046454 Ga0495592_0000014 Ga0495592_0000014_65268_66470 393
12 3300046462 Ga0495651_0000092 Ga0495651_0000092_26942_28144 393
13 3300046463 Ga0495653_0007693 Ga0495653_0007693_1211_2413 393
14 3300046511 Ga0495608_0000069 Ga0495608_0000069_44973_46175 393
15 3300046514 Ga0495618_0000367 Ga0495618_0000367_9495_10697 393
16 3300046516 Ga0495628_0000021 Ga0495628_0000021_81645_82847 393
17 3300046529 Ga0495652_0000279 Ga0495652_0000279_18979_20181 393
18 3300046536 Ga0495587_0000057 Ga0495587_0000057_87683_88885 393
19 3300046543 Ga0495645_0000019 Ga0495645_0000019_81663_82865 393
20 3300046678 Ga0495599_0000151 Ga0495599_0000151_37525_38727 393
21 3300046679 Ga0495623_0000008 Ga0495623_0000008_45529_46731 393
22 3300046680 Ga0495646_0000851 Ga0495646_0000851_10202_11404 393
23 3300046809 Ga0495600_0075919 Ga0495600_0075919_40_1242 393
24 3300047317 Ga0495604_0001891 Ga0495604_0001891_6605_7807 393
25 3300047322 Ga0495680_0046883 Ga0495680_0046883_164_1366 393
26 3300047444 Ga0495675_0000281 Ga0495675_0000281_7643_8845 393
27 3300048088 Ga0495602_0000262 Ga0495602_0000262_6822_8024 393
28 3300048903 Ga0496100_0000257 Ga0496100_0000257_6680_7873 393
29 3300048904 Ga0496101_0000780 Ga0496101_0000780_6533_7726 393
30 3300048905 Ga0496102_0001610 Ga0496102_0001610_10983_12176 393
31 3300048907 Ga0496104_0000973 Ga0496104_0000973_8076_9269 393
32 3300048908 Ga0496105_0000354 Ga0496105_0000354_17771_18964 393
33 3300048909 Ga0496106_0004729 Ga0496106_0004729_5345_6538 393
34 3300048910 Ga0496107_0012119 Ga0496107_0012119_1300_2493 393
35 3300048911 Ga0496108_0015641 Ga0496108_0015641_1377_2570 393
36 3300048912 Ga0496109_0013288 Ga0496109_0013288_1432_2625 393
37 3300048913 Ga0496110_0008992 Ga0496110_0008992_6177_7370 393
38 3300048917 Ga0496114_0000503 Ga0496114_0000503_10742_11935 393
39 3300048918 Ga0496115_0000321 Ga0496115_0000321_10978_12171 393
40 3300053077 Ga0495601_0000167 Ga0495601_0000167_24164_25366 393
41 3300053084 Ga0495595_0017253 Ga0495595_0017253_766_1968 393
42 3300053085 Ga0495619_0000104 Ga0495619_0000104_35780_36982 393
43 3300005336 Ga0070680_100030578 Ga0070680_1000305784 394
44 3300005434 Ga0070709_10013338 Ga0070709_100133381 394
45 3300005458 Ga0070681_10343586 Ga0070681_103435861 394
46 3300005468 Ga0070707_100290072 Ga0070707_1002900722 394
47 3300005530 Ga0070679_100007488 Ga0070679_1000074884 394
48 3300005535 Ga0070684_100012810 Ga0070684_1000128103 394
49 3300013296 Ga0157374_10026169 Ga0157374_100261694 394
50 3300025906 Ga0207699_10088851 Ga0207699_100888511 394
51 3300025929 Ga0207664_10189361 Ga0207664_101893612 394
52 3300048904 Ga0496101_0055386 Ga0496101_0055386_1366_2580 394
53 3300048910 Ga0496107_0220606 Ga0496107_0220606_145_1359 394
54 3300048914 Ga0496111_0035921 Ga0496111_0035921_445_1659 394
55 3300048915 Ga0496112_0217594 Ga0496112_0217594_86_1300 394
56 3300048917 Ga0496114_0050812 Ga0496114_0050812_43_1257 394
57 3300048918 Ga0496115_0099450 Ga0496115_0099450_498_1712 394
58 3300005458 Ga0070681_10288528 Ga0070681_102885281 395
59 3300048915 Ga0496112_0165963 Ga0496112_0165963_147_1346 398
60 3300026067 Ga0207678_10008930 Ga0207678_100089304 399
61 3300028379 Ga0268266_10164516 Ga0268266_101645161 399
62 3300035207 Ga0373942_0038183 Ga0373942_0038183_61_1263 399
63 3300039437 Ga0436365_1279294 Ga0436365_1279294_30_1232 400
64 3300005468 Ga0070707_100375288 Ga0070707_1003752881 401
65 3300005471 Ga0070698_100102544 Ga0070698_1001025442 401
66 3300031901 Ga0307406_10016529 Ga0307406_100165292 401
67 3300032004 Ga0307414_10037586 Ga0307414_100375862 401
68 3300053078 Ga0495612_0056785 Ga0495612_0056785_321_1544 403
69 3300031247 Ga0265340_10028759 Ga0265340_100287592 405
70 3300050512 nmdc:mga0n895_266591_c1 nmdc:mga0n895_266591_c1_191_1414 406
71 3300009093 Ga0105240_10125575 Ga0105240_101255752 407
72 3300013104 Ga0157370_10135032 Ga0157370_101350321 407
73 3300013105 Ga0157369_10076134 Ga0157369_100761342 407
74 3300013307 Ga0157372_10201391 Ga0157372_102013912 407
75 3300025912 Ga0207707_10034051 Ga0207707_100340513 407
76 3300044901 Ga0466960_0069794 Ga0466960_0069794_489_1736 408
77 3300046660 Ga0495625_0049490 Ga0495625_0049490_195_1508 408
78 3300048921 Ga0496118_0031096 Ga0496118_0031096_3078_4385 408
79 3300053156 Ga0500622_0043873 Ga0500622_0043873_1081_2307 408
80 3300050514 nmdc:mga08x19_45196_c1 nmdc:mga08x19_45196_c1_180_1505 409
81 3300028379 Ga0268266_10054393 Ga0268266_100543932 410
82 3300025913 Ga0207695_10038424 Ga0207695_100384245 411
83 3300053153 Ga0500616_0025908 Ga0500616_0025908_1663_2976 411
84 3300053156 Ga0500622_0045023 Ga0500622_0045023_375_1688 411
85 3300013308 Ga0157375_10011244 Ga0157375_100112448 412
86 3300014325 Ga0163163_10026693 Ga0163163_100266934 412
87 3300025949 Ga0207667_10192297 Ga0207667_101922972 412
88 3300046512 Ga0495610_0034967 Ga0495610_0034967_869_2182 412
89 3300048919 Ga0496116_0026215 Ga0496116_0026215_1774_3087 412
90 3300048923 Ga0496120_0079822 Ga0496120_0079822_298_1611 412
91 3300048929 Ga0496126_0112396 Ga0496126_0112396_919_2232 412
92 3300053119 Ga0500595_001187 Ga0500595_001187_71_1393 412
93 3300053177 Ga0500636_0004998 Ga0500636_0004998_5195_6508 412
94 iso_pu_bacteria 2851182111 2851186856 413
95 3300005937 Ga0081455_10057741 Ga0081455_100577412 415
96 3300053109 Ga0500569_000759 Ga0500569_000759_1546_2859 415
97 3300053730 Ga0500645_026789 Ga0500645_026789_30_1343 415
98 3300053731 Ga0500609_001054 Ga0500609_001054_1649_2962 415
99 3300005548 Ga0070665_100050529 Ga0070665_1000505292 416
100 3300028379 Ga0268266_10087728 Ga0268266_100877282 416
101 3300048929 Ga0496126_0054634 Ga0496126_0054634_145_1524 416
102 3300005617 Ga0068859_100132636 Ga0068859_1001326362 417
103 3300046507 Ga0495606_0010303 Ga0495606_0010303_4583_5845 420
104 iso_pu_bacteria 2921257292 2921261739 420
105 iso_pu_bacteria 2937023124 2937029578 420
106 iso_pu_bacteria 2937119839 2937124987 420
107 iso_pu_bacteria 2957395598 2957398810 420
108 iso_pu_bacteria 2957408893 2957409424 420
109 iso_pu_bacteria 2964615318 2964619197 420
110 iso_pu_bacteria 2967755722 2967760344 420
111 iso_pu_bacteria 2970102677 2970109108 420
112 iso_pu_bacteria 2977565890 2977568694 420
113 3300009551 Ga0105238_10210396 Ga0105238_102103961 421
114 3300046476 Ga0495662_0015328 Ga0495662_0015328_2315_3598 421
115 3300047317 Ga0495604_0027685 Ga0495604_0027685_2150_3433 421
116 iso_pu_bacteria 2582581867 2585402778 421
117 iso_pu_bacteria 2585427590 2585823559 421
118 iso_pu_bacteria 8019565922 8019568849 421
119 iso_pu_bacteria 2510917028 2511183051 422
120 iso_pu_bacteria 2513237138 2513868344 422
121 iso_pu_bacteria 2923556063 2923561025 422
122 3300048929 Ga0496126_0000338 Ga0496126_0000338_59654_61006 423
123 3300007076 Ga0075435_100157213 Ga0075435_1001572132 424
124 iso_pu_bacteria 2515154112 2515628029 424
125 iso_pu_bacteria 2791355196 2793062786 424
126 iso_pu_bacteria 2824661429 2824665771 424
127 iso_pu_bacteria 2824773399 2824775960 424
128 iso_pu_bacteria 2874645413 2874650124 424
129 iso_pu_bacteria 2879099564 2879105250 424
130 iso_pu_bacteria 2888388044 2888388833 424
131 iso_pu_bacteria 2903727486 2903730649 424
132 iso_pu_bacteria 2906602504 2906609402 424
133 iso_pu_bacteria 2906626472 2906630363 424
134 iso_pu_bacteria 2922368715 2922371760 424
135 iso_pu_bacteria 2932809354 2932811808 424
136 iso_pu_bacteria 2932818245 2932822706 424
137 iso_pu_bacteria 2935608549 2935616034 424
138 iso_pu_bacteria 2935616580 2935624847 424
139 iso_pu_bacteria 2935703347 2935704470 424
140 iso_pu_bacteria 2935810662 2935816545 424
141 iso_pu_bacteria 2935819856 2935819930 424
142 iso_pu_bacteria 2935837841 2935845821 424
143 iso_pu_bacteria 2935847175 2935850060 424
144 iso_pu_bacteria 2935855204 2935863478 424
145 iso_pu_bacteria 2935864058 2935872682 424
146 iso_pu_bacteria 2935873716 2935882587 424
147 iso_pu_bacteria 2935908558 2935915211 424
148 iso_pu_bacteria 2935916978 2935923937 424
149 iso_pu_bacteria 2935926038 2935932708 424
150 iso_pu_bacteria 2935934488 2935941208 424
151 iso_pu_bacteria 2935942939 2935949378 424
152 iso_pu_bacteria 2935951376 2935958073 424
153 iso_pu_bacteria 2935967501 2935974285 424
154 iso_pu_bacteria 2935975950 2935979483 424
155 iso_pu_bacteria 2936037263 2936042503 424
156 iso_pu_bacteria 2936055302 2936059277 424
157 iso_pu_bacteria 2941531003 2941536726 424
158 iso_pu_bacteria 2941538514 2941545995 424
159 iso_pu_bacteria 8016630954 8016633602 424
160 iso_pu_bacteria 8019576017 8019579996 424
161 iso_pu_bacteria 8019586578 8019587709 424
162 iso_pu_bacteria 8019597564 8019603620 424
163 iso_pu_bacteria 8019629233 8019636715 424
164 iso_pu_bacteria 8019638758 8019642910 424
165 iso_pu_bacteria 8019668869 8019674103 424
166 iso_pu_bacteria 8019678201 8019682020 424
167 iso_pu_bacteria 8019687851 8019693585 424
168 3300009093 Ga0105240_10000080 Ga0105240_1000008089 425
169 3300010375 Ga0105239_10014353 Ga0105239_100143539 425
170 iso_pu_bacteria 2824600985 2824601837 425
171 iso_pu_bacteria 2824609381 2824612849 425
172 iso_pu_bacteria 2824653114 2824653268 425
173 iso_pu_bacteria 2888419890 2888422440 425
174 3300006844 Ga0075428_100079299 Ga0075428_1000792991 426
175 3300006846 Ga0075430_100000150 Ga0075430_10000015038 426
176 3300006847 Ga0075431_100000478 Ga0075431_10000047828 426
177 3300046492 Ga0495585_0008348 Ga0495585_0008348_1797_3077 426
178 3300050509 nmdc:mga0qj67_97_c1 nmdc:mga0qj67_97_c1_6503_7951 426
179 3300050510 nmdc:mga06r32_569_c1 nmdc:mga06r32_569_c1_12963_14411 426
180 3300005347 Ga0070668_100081704 Ga0070668_1000817042 427
181 3300005434 Ga0070709_10000426 Ga0070709_1000042613 427
182 3300005435 Ga0070714_100034288 Ga0070714_1000342881 427
183 3300005437 Ga0070710_10000666 Ga0070710_100006666 427
184 3300005439 Ga0070711_100041713 Ga0070711_1000417131 427
185 3300006048 Ga0075363_100100834 Ga0075363_1001008341 427
186 3300006051 Ga0075364_10019563 Ga0075364_100195634 427
187 3300006173 Ga0070716_100003639 Ga0070716_1000036394 427
188 3300006175 Ga0070712_100020476 Ga0070712_1000204762 427
189 3300006353 Ga0075370_10017710 Ga0075370_100177102 427
190 3300006353 Ga0075370_10020296 Ga0075370_100202963 427
191 3300006944 Ga0099823_1000042 Ga0099823_100004237 427
192 3300010375 Ga0105239_10001026 Ga0105239_1000102620 427
193 3300010375 Ga0105239_10188115 Ga0105239_101881152 427
194 3300025254 Ga0209148_1000647 Ga0209148_100064725 427
195 3300025302 Ga0207426_1006759 Ga0207426_10067592 427
196 3300025898 Ga0207692_10002567 Ga0207692_100025674 427
197 3300025906 Ga0207699_10000472 Ga0207699_100004727 427
198 3300025915 Ga0207693_10014865 Ga0207693_100148652 427
199 3300025915 Ga0207693_10035469 Ga0207693_100354693 427
200 3300025916 Ga0207663_10088706 Ga0207663_100887061 427
201 3300025928 Ga0207700_10161479 Ga0207700_101614791 427
202 3300025929 Ga0207664_10024377 Ga0207664_100243773 427
203 3300025939 Ga0207665_10007685 Ga0207665_100076852 427
204 3300026035 Ga0207703_10177599 Ga0207703_101775992 427
205 3300026067 Ga0207678_10006129 Ga0207678_100061296 427
206 3300026067 Ga0207678_10070483 Ga0207678_100704832 427
207 3300027296 Ga0209389_1000135 Ga0209389_100013534 427
208 3300027361 Ga0209489_100653 Ga0209489_10065336 427
209 3300027363 Ga0209700_100417 Ga0209700_10041742 427
210 3300028379 Ga0268266_10143283 Ga0268266_101432832 427
211 3300028379 Ga0268266_10166490 Ga0268266_101664902 427
212 3300028379 Ga0268266_10295250 Ga0268266_102952502 427
213 3300028556 Ga0265337_1001144 Ga0265337_10011444 427
214 3300028558 Ga0265326_10000343 Ga0265326_1000034316 427
215 3300028563 Ga0265319_1000708 Ga0265319_100070816 427
216 3300028573 Ga0265334_10000334 Ga0265334_1000033420 427
217 3300028653 Ga0265323_10000353 Ga0265323_100003539 427
218 3300028666 Ga0265336_10000288 Ga0265336_1000028820 427
219 3300028800 Ga0265338_10001718 Ga0265338_1000171820 427
220 3300029957 Ga0265324_10001490 Ga0265324_100014902 427
221 3300037418 Ga0395900_0048938 Ga0395900_0048938_1978_3291 427
222 3300037471 Ga0395905_0053913 Ga0395905_0053913_2323_3636 427
223 3300044683 Ga0466965_0056172 Ga0466965_0056172_464_1777 427
224 3300046491 Ga0495584_0032856 Ga0495584_0032856_1208_2521 427
225 3300046522 Ga0495643_0001054 Ga0495643_0001054_16842_18155 427
226 3300046684 Ga0495669_0062531 Ga0495669_0062531_134_1447 427
227 3300047443 Ga0495687_001535 Ga0495687_001535_6023_7336 427
228 3300048905 Ga0496102_0000601 Ga0496102_0000601_18940_20253 427
229 3300048905 Ga0496102_0174491 Ga0496102_0174491_399_1712 427
230 3300048906 Ga0496103_0000964 Ga0496103_0000964_14771_16084 427
231 3300048907 Ga0496104_0216875 Ga0496104_0216875_48_1355 427
232 3300048909 Ga0496106_0042611 Ga0496106_0042611_1203_2516 427
233 3300048912 Ga0496109_0016920 Ga0496109_0016920_1586_2899 427
234 3300048915 Ga0496112_0000233 Ga0496112_0000233_15358_16671 427
235 3300048916 Ga0496113_0002793 Ga0496113_0002793_5348_6661 427
236 3300048921 Ga0496118_0036061 Ga0496118_0036061_2485_3798 427
237 3300048922 Ga0496119_0086783 Ga0496119_0086783_180_1493 427
238 3300048924 Ga0496121_0031982 Ga0496121_0031982_924_2237 427
239 3300048929 Ga0496126_0080831 Ga0496126_0080831_1226_2539 427
240 3300048929 Ga0496126_0150160 Ga0496126_0150160_321_1634 427
241 3300053119 Ga0500595_000470 Ga0500595_000470_13364_14770 427
242 3300053146 Ga0500588_0020335 Ga0500588_0020335_412_1725 427
243 3300053148 Ga0500590_000228 Ga0500590_000228_3269_4588 427
244 3300053735 Ga0500596_007219 Ga0500596_007219_489_1808 427
245 3300021384 Ga0213876_10000618 Ga0213876_100006185 428
246 3300037312 Ga0395899_0092973 Ga0395899_0092973_522_1895 428
247 3300037418 Ga0395900_0018815 Ga0395900_0018815_3346_4719 428
248 3300038443 Ga0395901_0002280 Ga0395901_0002280_8287_9660 428
249 3300039437 Ga0436365_0506456 Ga0436365_0506456_70124_71425 428
250 iso_pu_bacteria 2515154113 2515632902 428
251 iso_pu_bacteria 2510461076 2510894965 429
252 iso_pu_bacteria 2513237085 2513577535 429
253 iso_pu_bacteria 2513237162 2514022089 429
254 iso_pu_bacteria 2515154114 2515640046 429
255 iso_pu_bacteria 2515154116 2515655756 429
256 iso_pu_bacteria 2515154134 2515740208 429
257 iso_pu_bacteria 2516653085 2517076651 429
258 iso_pu_bacteria 2517093000 2517095426 429
259 iso_pu_bacteria 2517287029 2517407016 429
260 iso_pu_bacteria 2585427526 2585527044 429
261 iso_pu_bacteria 2585427528 2585537801 429
262 iso_pu_bacteria 2585427593 2585835751 429
263 iso_pu_bacteria 2738541333 2739032458 429
264 iso_pu_bacteria 2791355260 2793323006 429
265 iso_pu_bacteria 2802429633 2806043434 429
266 iso_pu_bacteria 2802429634 2806050633 429
267 iso_pu_bacteria 2802429635 2806057450 429
268 iso_pu_bacteria 2802429636 2806064831 429
269 iso_pu_bacteria 2802429637 2806072097 429
270 iso_pu_bacteria 2838686498 2838692038 429
271 iso_pu_bacteria 2838729681 2838732816 429
272 iso_pu_bacteria 2838742623 2838745694 429
273 iso_pu_bacteria 2841851746 2841855848 429
274 iso_pu_bacteria 2842110456 2842114141 429
275 iso_pu_bacteria 2842156927 2842157160 429
276 iso_pu_bacteria 2842163707 2842167821 429
277 iso_pu_bacteria 2842180545 2842181256 429
278 iso_pu_bacteria 2842229732 2842230693 429
279 iso_pu_bacteria 2842243621 2842245207 429
280 iso_pu_bacteria 2842257432 2842259020 429
281 iso_pu_bacteria 2842271015 2842276310 429
282 iso_pu_bacteria 2842304105 2842304547 429
283 iso_pu_bacteria 2844454524 2844458907 429
284 iso_pu_bacteria 2933570622 2933571820 429
285 iso_pu_bacteria 2933586486 2933590237 429
286 iso_pu_bacteria 2935901341 2935905431 429
287 iso_pu_bacteria 2936367885 2936372453 429
288 iso_pu_bacteria 2936375103 2936376557 429
289 iso_pu_bacteria 8005307578 8005312419 429
290 iso_pu_bacteria 8005376324 8005379470 429
291 iso_pu_bacteria 8005556819 8005557444 429
292 iso_pu_bacteria 8005563573 8005568623 429
293 iso_pu_bacteria 8005570704 8005574515 429
294 iso_pu_bacteria 8018163183 8018166534 429
295 iso_pu_bacteria 8023680758 8023685129 429
296 3300005843 Ga0068860_100087567 Ga0068860_1000875672 431
297 3300021384 Ga0213876_10004956 Ga0213876_100049562 431
298 3300037471 Ga0395905_0035293 Ga0395905_0035293_1650_3035 431
299 3300039453 Ga0436362_0665260 Ga0436362_0665260_238_1623 431
300 3300003771 Ga0055526_1010046 Ga0055526_10100463 432
301 3300003790 Ga0055528_1000269 Ga0055528_100026910 432
302 3300025273 Ga0209673_1000013 Ga0209673_1000013203 432
303 3300025295 Ga0209564_1000264 Ga0209564_100026494 432
304 3300025299 Ga0209256_1000369 Ga0209256_10003694 432
305 3300031241 Ga0265325_10063521 Ga0265325_100635211 432
306 3300003187 JGI25151J46595_10001028 JGI25151J46595_1000102815 433
307 3300003215 JGI25153J46596_10006938 JGI25153J46596_100069385 433
308 3300003215 JGI25153J46596_10025843 JGI25153J46596_100258433 433
309 3300003354 JGI25160J50197_1003325 JGI25160J50197_10033256 433
310 3300003374 JGI25161J50226_1001432 JGI25161J50226_10014327 433
311 3300003771 Ga0055526_1000599 Ga0055526_100059925 433
312 3300003775 Ga0055524_1001831 Ga0055524_10018314 433
313 3300003775 Ga0055524_1018123 Ga0055524_10181232 433
314 3300003790 Ga0055528_1007602 Ga0055528_10076024 433
315 3300003792 Ga0055540_1006121 Ga0055540_10061213 433
316 3300004625 Ga0055543_1000329 Ga0055543_100032923 433
317 3300005262 Ga0065165_1003879 Ga0065165_10038795 433
318 3300006038 Ga0075365_10001474 Ga0075365_100014743 433
319 3300006048 Ga0075363_100018925 Ga0075363_1000189252 433
320 3300006177 Ga0075362_10000395 Ga0075362_100003957 433
321 3300006178 Ga0075367_10021839 Ga0075367_100218393 433
322 3300006186 Ga0075369_10000652 Ga0075369_100006528 433
323 3300006195 Ga0075366_10001952 Ga0075366_1000195210 433
324 3300006353 Ga0075370_10067795 Ga0075370_100677952 433
325 3300025258 Ga0209129_1002229 Ga0209129_10022298 433
326 3300025273 Ga0209673_1000325 Ga0209673_100032556 433
327 3300025291 Ga0209675_1010007 Ga0209675_10100071 433
328 3300025294 Ga0209025_1000483 Ga0209025_100048317 433
329 3300025295 Ga0209564_1002390 Ga0209564_10023909 433
330 3300025297 Ga0209758_1001861 Ga0209758_10018615 433
331 3300025297 Ga0209758_1017623 Ga0209758_10176233 433
332 3300025297 Ga0209758_1022250 Ga0209758_10222503 433
333 3300025299 Ga0209256_1000245 Ga0209256_100024559 433
334 3300025299 Ga0209256_1023602 Ga0209256_10236021 433
335 3300025302 Ga0207426_1000039 Ga0207426_1000039383 433
336 3300025303 Ga0209051_1010056 Ga0209051_10100564 433
337 3300028794 Ga0307515_10005688 Ga0307515_100056883 433
338 3300031456 Ga0307513_10011512 Ga0307513_1001151211 433
339 3300041441 Ga0451787_243528 Ga0451787_243528_2474_3775 433
340 3300041452 Ga0451793_1805869 Ga0451793_1805869_18_1325 433
341 3300041491 Ga0451833_0058585 Ga0451833_0058585_4620_5921 433
342 3300041492 Ga0451835_0213409 Ga0451835_0213409_374_1675 433
343 3300041498 Ga0451841_0901789 Ga0451841_0901789_820_2121 433
344 3300041505 Ga0451849_0701709 Ga0451849_0701709_1570_2871 433
345 3300046474 Ga0495605_0026708 Ga0495605_0026708_1396_2721 433
346 3300046501 Ga0495607_0030436 Ga0495607_0030436_626_1927 433
347 3300046513 Ga0495616_0026191 Ga0495616_0026191_802_2103 433
348 3300046522 Ga0495643_0045356 Ga0495643_0045356_923_2224 433
349 3300046524 Ga0495648_0003811 Ga0495648_0003811_6624_7925 433
350 3300046542 Ga0495597_0018130 Ga0495597_0018130_828_2129 433
351 3300046810 Ga0495660_0043912 Ga0495660_0043912_440_1741 433
352 3300050489 nmdc:mga03683_1571_c1 nmdc:mga03683_1571_c1_5181_6482 433
353 3300050490 nmdc:mga03n38_10810_c1 nmdc:mga03n38_10810_c1_348_1649 433
354 3300050493 nmdc:mga0k408_16278_c1 nmdc:mga0k408_16278_c1_1952_3253 433
355 3300050494 nmdc:mga06z11_43660_c1 nmdc:mga06z11_43660_c1_464_1765 433
356 3300050496 nmdc:mga07m45_1210_c1 nmdc:mga07m45_1210_c1_5477_6778 433
357 3300050516 nmdc:mga0sz30_3468_c1 nmdc:mga0sz30_3468_c1_3338_4639 433
358 3300053158 Ga0500627_0012003 Ga0500627_0012003_922_2223 433

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06441

EHN

Epoxide hydrolase N terminus

78

183

0.97

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

169

313

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f4z-assembly3.cif.gz_E the crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus 0.8882 42 432
4qa9-assembly1.cif.gz_A ensemble refinement of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus. 0.8846 40 432
6ix4-assembly1.cif.gz_A structure of an epoxide hydrolase from aspergillus usamii e001 (aueh2) at 1.51 angstroms resolution 0.8837 41 430
5f4z-assembly3.cif.gz_E the crystal structure of an epoxide hydrolase from streptomyces carzinostaticus subsp. neocarzinostaticus 0.875 42 432
6ix2-assembly1.cif.gz_B structure of the a214c/a250i mutant of an epoxide hydrolase from aspergillus usamii e001 (aueh2) at 1.48 angstroms resolution 0.8726 41 430
ID Description Score Start End Superfamily
4qa9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8846 40 432 3.40.50.1820
af_Q9D379_48_454_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.876 42 432 3.40.50.1820
4qa9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8714 40 432 3.40.50.1820
af_Q23068_49_452_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.861 42 431 3.40.50.1820
3g02B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8597 42 430 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6S7BQI6-F1-model_v4 Epoxide hydrolase 0.9809 239 431 GO:0004301
GO:0097176
AF-A0A3B4CDG2-F1-model_v4 deleted 0.9763 224 433
AF-A0A2V8PGR5-F1-model_v4 Multidrug MFS transporter 0.9761 166 432 GO:0004301
GO:0097176
AF-A0A2V9HKC8-F1-model_v4 Multidrug MFS transporter 0.9752 40 431 GO:0004301
GO:0009056
GO:0097176
AF-A0A2V6EM52-F1-model_v4 Multidrug MFS transporter 0.9752 208 431 GO:0004301
GO:0097176

Feature Viewer

pLDDT pTM Quality
87.27 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map