F420759

General Info

Members Datasets Scaffolds Average Seq Length
357 228 714 393

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100339786|Ga0070679_1003397861
Length 446
Sequence MTKILVNAASACVCKSRAVGIVPAVQVLILGGDGYLGWPTALRFSARGHDVAIVDNFARRYWHLQQSTDSLTPIASLEERISAWEEHSGRRIKAYVGSVDEGDFLDRVVAEVLPDVVIHFAEQPSAPFSMKSREHAVLTQRTNVIGTLNLMFAIREHVPDCHIVKLGTMGEYGTPNIDIEEGYIEIHHKGRSDVLPYPKLPGSLYHLSKVHDSHNLHFACRVWGLRATDLNQGVVYGIETDETSLDPRLVTRFDYDEVFGTALNRFCVQALVGHPITVYGEGGQTRGFLNIRDTLQCVEIAATHPAAAGEFRVFNQFTEQFSVLELAHLVQRCAQEVGLDATVRHYPNPRVEAEQHYYHAVNEKLLELGLEPHYLGDELIFSMLNVIRKYGDRVSLGQVEPKTRWRPGELGDEPEVPAPAETNGSGTRSGPDDDILGEEGVPGAAV

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
133 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
134 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
135 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
136 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
137 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
138 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
139 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 7
Rhizosphere 78.71
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100339786 3300005530 Bacteria 1450
2 Ga0065712_10105054 3300005290 Bacteria 1947
3 Ga0065715_10106477 3300005293 Bacteria 2812
4 Ga0070658_10011888 3300005327 Bacteria 6990
5 Ga0070683_100007357 3300005329 Bacteria 9302
6 Ga0070683_100056493 3300005329 Bacteria 3646
7 Ga0070666_10120153 3300005335 Bacteria 1822
8 Ga0070680_100009311 3300005336 Bacteria 7542
9 Ga0070682_100000171 3300005337 Bacteria 48470
10 Ga0070682_100008431 3300005337 Bacteria 5816
11 Ga0070682_100111778 3300005337 Bacteria 1822
12 Ga0070691_10009007 3300005341 Unclassified 4566
13 Ga0070687_100073171 3300005343 Bacteria 1846
14 Ga0070692_10107280 3300005345 Bacteria 1540
15 Ga0070669_100063889 3300005353 Bacteria 2710
16 Ga0070675_100000341 3300005354 Bacteria 31572
17 Ga0070674_100041897 3300005356 Bacteria 3107
18 Ga0070688_100000285 3300005365 Bacteria 26015
19 Ga0070667_100016180 3300005367 Bacteria 6170
20 Ga0070667_100024887 3300005367 Bacteria 4973
21 Ga0070714_100073519 3300005435 Bacteria 2962
22 Ga0070713_100000010 3300005436 Bacteria 151790
23 Ga0070713_100014344 3300005436 Bacteria 5882
24 Ga0070710_10114747 3300005437 Bacteria 1623
25 Ga0070705_100008172 3300005440 Bacteria 5175
26 Ga0070708_100008799 3300005445 Bacteria 8120
27 Ga0070678_100302921 3300005456 Bacteria 1359
28 Ga0070681_10004125 3300005458 Bacteria 13740
29 Ga0070685_10000159 3300005466 Bacteria 43951
30 Ga0070706_100000331 3300005467 Bacteria 57599
31 Ga0070706_100001497 3300005467 Bacteria 24526
32 Ga0070706_100020840 3300005467 Bacteria 6036
33 Ga0070707_100000639 3300005468 Bacteria 34971
34 Ga0070707_100011077 3300005468 Bacteria 8398
35 Ga0070707_100143308 3300005468 Bacteria 2325
36 Ga0070707_100183501 3300005468 Bacteria 2040
37 Ga0070698_100002365 3300005471 Bacteria 20808
38 Ga0070698_100005999 3300005471 Bacteria 13237
39 Ga0070699_100089781 3300005518 Unclassified 2685
40 Ga0070679_100002715 3300005530 Bacteria 16115
41 Ga0070679_100065930 3300005530 Bacteria 3609
42 Ga0070679_100200332 3300005530 Unclassified 1963
43 Ga0070684_100123223 3300005535 Bacteria 2333
44 Ga0070684_100176805 3300005535 Bacteria 1940
45 Ga0070684_100211519 3300005535 Bacteria 1767
46 Ga0070697_100016933 3300005536 Bacteria 5730
47 Ga0068853_100062235 3300005539 Bacteria 3229
48 Ga0070686_100104038 3300005544 Bacteria 1922
49 Ga0070695_100038203 3300005545 Bacteria 3028
50 Ga0070696_100155100 3300005546 Bacteria 1683
51 Ga0070704_100153608 3300005549 Bacteria 1813
52 Ga0068857_100003211 3300005577 Bacteria 13557
53 Ga0068854_100001200 3300005578 Bacteria 15539
54 Ga0068861_100244040 3300005719 Bacteria 1529
55 Ga0068851_10053092 3300005834 Bacteria 2063
56 Ga0068858_100101815 3300005842 Bacteria 2679
57 Ga0068862_100012408 3300005844 Bacteria 7047
58 Ga0081455_10022898 3300005937 Bacteria 5825
59 Ga0081455_10120069 3300005937 Bacteria 2072
60 Ga0081455_10210480 3300005937 Bacteria 1449
61 Ga0081538_10024410 3300005981 Bacteria 4306
62 Ga0081538_10060437 3300005981 Bacteria 2179
63 Ga0081540_1001415 3300005983 Bacteria 20755
64 Ga0081539_10000479 3300005985 Bacteria 84481
65 Ga0081539_10015896 3300005985 Bacteria 5425
66 Ga0081539_10028240 3300005985 Bacteria 3532
67 Ga0081539_10056185 3300005985 Bacteria 2186
68 Ga0070717_10002612 3300006028 Bacteria 12705
69 Ga0070717_10019504 3300006028 Bacteria 5319
70 Ga0070717_10143134 3300006028 Bacteria 2064
71 Ga0070717_10203673 3300006028 Bacteria 1734
72 Ga0075365_10027714 3300006038 Bacteria 3607
73 Ga0075365_10142843 3300006038 Bacteria 1662
74 Ga0075364_10022048 3300006051 Bacteria 4018
75 Ga0075364_10150071 3300006051 Bacteria 1571
76 Ga0075428_100113221 3300006844 Bacteria 2956
77 Ga0075430_100000001 3300006846 Bacteria 185803
78 Ga0075430_100003119 3300006846 Bacteria 13863
79 Ga0075430_100129179 3300006846 Bacteria 2106
80 Ga0075431_100001038 3300006847 Bacteria 24774
81 Ga0075431_100006132 3300006847 Bacteria 11927
82 Ga0075431_100119541 3300006847 Bacteria 2719
83 Ga0075433_10055435 3300006852 Bacteria 3460
84 Ga0075434_100327103 3300006871 Bacteria 1553
85 Ga0075434_100445439 3300006871 Bacteria 1316
86 Ga0075429_100007049 3300006880 Bacteria 9759
87 Ga0068865_100092488 3300006881 Bacteria 2197
88 Ga0075436_100070699 3300006914 Bacteria 2413
89 Ga0105240_10121609 3300009093 Bacteria 3143
90 Ga0111539_10005086 3300009094 Bacteria 17075
91 Ga0111539_10047560 3300009094 Bacteria 5127
92 Ga0105245_10002713 3300009098 Bacteria 15936
93 Ga0105245_10005396 3300009098 Bacteria 11235
94 Ga0114129_10026714 3300009147 Bacteria 8177
95 Ga0114129_10028412 3300009147 Bacteria 7926
96 Ga0114129_10106543 3300009147 Bacteria 3872
97 Ga0114129_10245783 3300009147 Bacteria 2404
98 Ga0114129_10419043 3300009147 Bacteria 1761
99 Ga0105243_10051863 3300009148 Bacteria 3246
100 Ga0105248_10033607 3300009177 Bacteria 5730
101 Ga0105238_10018741 3300009551 Bacteria 7048
102 Ga0105249_10016459 3300009553 Bacteria 6561
103 Ga0105249_10161201 3300009553 Bacteria 2168
104 Ga0105249_10177676 3300009553 Bacteria 2069
105 Ga0105033_101672 3300009986 Bacteria 1823
106 Ga0105239_10117453 3300010375 Bacteria 2952
107 Ga0157370_10002228 3300013104 Bacteria 23588
108 Ga0157370_10073087 3300013104 Bacteria 3235
109 Ga0157369_10031160 3300013105 Bacteria 5876
110 Ga0157378_10243020 3300013297 Bacteria 1720
111 Ga0157372_10055951 3300013307 Bacteria 4407
112 Ga0157375_10095022 3300013308 Bacteria 3051
113 Ga0157379_10355771 3300014968 Bacteria 1341
114 Ga0206350_11331909 3300020080 Bacteria 1465
115 Ga0206353_11612718 3300020082 Bacteria 5496
116 Ga0213874_10020197 3300021377 Bacteria 1823
117 Ga0213876_10004255 3300021384 Bacteria 8026
118 Ga0213876_10032715 3300021384 Bacteria 2742
119 Ga0207656_10017479 3300025321 Bacteria 2811
120 Ga0207656_10037665 3300025321 Bacteria 2036
121 Ga0207710_10000243 3300025900 Bacteria 46286
122 Ga0207680_10027495 3300025903 Bacteria 3168
123 Ga0207684_10000116 3300025910 Bacteria 148590
124 Ga0207684_10028072 3300025910 Bacteria 4794
125 Ga0207684_10028918 3300025910 Bacteria 4721
126 Ga0207707_10018431 3300025912 Bacteria 6086
127 Ga0207707_10179188 3300025912 Bacteria 1850
128 Ga0207671_10214708 3300025914 Bacteria 1506
129 Ga0207649_10037905 3300025920 Bacteria 2915
130 Ga0207652_10000720 3300025921 Bacteria 32059
131 Ga0207652_10039512 3300025921 Bacteria 4004
132 Ga0207652_10166440 3300025921 Unclassified 1977
133 Ga0207646_10002044 3300025922 Bacteria 24252
134 Ga0207646_10003661 3300025922 Bacteria 17175
135 Ga0207646_10040645 3300025922 Bacteria 4181
136 Ga0207646_10198923 3300025922 Bacteria 1810
137 Ga0207681_10031962 3300025923 Bacteria 3442
138 Ga0207659_10006949 3300025926 Bacteria 6953
139 Ga0207687_10002187 3300025927 Bacteria 13356
140 Ga0207700_10000007 3300025928 Bacteria 345720
141 Ga0207700_10023845 3300025928 Bacteria 4228
142 Ga0207664_10004759 3300025929 Bacteria 9226
143 Ga0207690_10046930 3300025932 Bacteria 2864
144 Ga0207709_10005831 3300025935 Bacteria 6962
145 Ga0207709_10054393 3300025935 Bacteria 2468
146 Ga0207669_10033048 3300025937 Bacteria 2914
147 Ga0207689_10084591 3300025942 Bacteria 2607
148 Ga0207661_10010061 3300025944 Bacteria 6797
149 Ga0207712_10017829 3300025961 Bacteria 4617
150 Ga0207640_10000248 3300025981 Bacteria 36585
151 Ga0207658_10009308 3300025986 Bacteria 6663
152 Ga0207703_10191047 3300026035 Bacteria 1813
153 Ga0207641_10194366 3300026088 Bacteria 1867
154 Ga0207674_10007296 3300026116 Bacteria 12888
155 Ga0207674_10045922 3300026116 Bacteria 4489
156 Ga0207683_10043016 3300026121 Bacteria 3945
157 Ga0207683_10163599 3300026121 Bacteria 2013
158 Ga0207698_10010713 3300026142 Bacteria 5914
159 Ga0268265_10006856 3300028380 Bacteria 7709
160 Ga0268264_10283772 3300028381 Bacteria 1552
161 Ga0265337_1000287 3300028556 Bacteria 27334
162 Ga0265326_10000084 3300028558 Bacteria 50129
163 Ga0265322_10000020 3300028654 Bacteria 108805
164 Ga0265338_10013540 3300028800 Bacteria 9195
165 Ga0265338_10031832 3300028800 Bacteria 5162
166 Ga0265324_10004241 3300029957 Bacteria 6553
167 Ga0265320_10000035 3300031240 Bacteria 137855
168 Ga0265325_10008864 3300031241 Bacteria 5908
169 Ga0265339_10022602 3300031249 Bacteria 3643
170 Ga0265331_10001640 3300031250 Bacteria 16295
171 Ga0265327_10000015 3300031251 Bacteria 496677
172 Ga0265316_10019543 3300031344 Bacteria 5789
173 Ga0265313_10002601 3300031595 Bacteria 15371
174 Ga0316575_10027561 3300031665 Bacteria 2211
175 Ga0265314_10000690 3300031711 Bacteria 40955
176 Ga0316576_10023405 3300031727 Bacteria 4302
177 Ga0316576_10034386 3300031727 Bacteria 3612
178 Ga0316577_10056940 3300031733 Unclassified 2182
179 Ga0326468_10001714 3300031889 Bacteria 1888
180 Ga0307406_10094312 3300031901 Bacteria 2023
181 Ga0373933_0000020 3300035724 Bacteria 97124
182 Ga0316582_0042034 3300036647 Unclassified 2861
183 Ga0316582_0145014 3300036647 Bacteria 1602
184 Ga0316584_0032286 3300036712 Bacteria 3875
185 Ga0395899_0064929 3300037312 Bacteria 2683
186 Ga0395898_0082604 3300037466 Bacteria 3097
187 Ga0395898_0085622 3300037466 Bacteria 3038
188 Ga0395905_0102847 3300037471 Bacteria 2682
189 Ga0436364_0180133 3300037853 Bacteria 79051
190 Ga0395901_0102723 3300038443 Bacteria 3000
191 Ga0400484_35250 3300038725 Bacteria 3052
192 Ga0400490_00712 3300038726 Bacteria 5329
193 Ga0400490_05086 3300038726 Bacteria 13799
194 Ga0400490_36540 3300038726 Bacteria 22080
195 Ga0400490_38974 3300038726 Bacteria 3844
196 Ga0400490_40791 3300038726 Bacteria 3110
197 Ga0400490_44480 3300038726 Bacteria 1497
198 Ga0400490_46433 3300038726 Bacteria 1830
199 Ga0400490_51133 3300038726 Bacteria 17448
200 Ga0400490_54433 3300038726 Bacteria 2476
201 Ga0400491_05406 3300038727 Bacteria 1539
202 Ga0400485_22071 3300038735 Bacteria 2874
203 Ga0400488_37626 3300038741 Bacteria 12712
204 Ga0400486_10724 3300038742 Bacteria 6162
205 Ga0400486_13190 3300038742 Bacteria 1709
206 Ga0400486_24588 3300038742 Bacteria 7778
207 Ga0400486_29797 3300038742 Bacteria 8273
208 Ga0400483_011478 3300039062 Bacteria 1435
209 Ga0400483_027936 3300039062 Bacteria 6935
210 Ga0400483_052537 3300039062 Bacteria 4119
211 Ga0400483_064632 3300039062 Bacteria 149376
212 Ga0400483_077694 3300039062 Bacteria 17282
213 Ga0400483_095539 3300039062 Bacteria 26062
214 Ga0400483_111670 3300039062 Unclassified 2736
215 Ga0400483_180109 3300039062 Unclassified 4060
216 Ga0400483_180499 3300039062 Bacteria 14955
217 Ga0400483_185206 3300039062 Bacteria 144624
218 Ga0400483_186342 3300039062 Bacteria 1863
219 Ga0400489_09453 3300039093 Unclassified 2951
220 Ga0400489_48106 3300039093 Bacteria 36044
221 Ga0436365_0334111 3300039437 Bacteria 16639
222 Ga0436365_0831542 3300039437 Bacteria 9356
223 Ga0436365_0954180 3300039437 Bacteria 4210
224 Ga0436363_1218761 3300039450 Bacteria 6662
225 Ga0436362_0485792 3300039453 Bacteria 9082
226 Ga0436362_0708824 3300039453 Bacteria 3494
227 Ga0466969_0029432 3300044656 Bacteria 2804
228 Ga0466963_0038236 3300044694 Bacteria 3137
229 Ga0466964_0053181 3300044706 Bacteria 1666
230 Ga0453684_0006075 3300044712 Bacteria 23337
231 Ga0466971_0066053 3300044719 Bacteria 1638
232 Ga0466967_0000017 3300045976 Bacteria 89904
233 Ga0466967_0021372 3300045976 Bacteria 5254
234 Ga0466967_0086748 3300045976 Bacteria 2836
235 Ga0495629_0000691 3300046459 Bacteria 27311
236 Ga0495653_0055854 3300046463 Bacteria 3012
237 Ga0495582_0080525 3300046473 Bacteria 1808
238 Ga0495606_0000108 3300046507 Bacteria 140473
239 Ga0495628_0001800 3300046516 Bacteria 19452
240 Ga0495630_0000175 3300046517 Bacteria 49924
241 Ga0495630_0264672 3300046517 Bacteria 1313
242 Ga0495587_0020730 3300046536 Bacteria 4055
243 Ga0495634_0000028 3300046642 Bacteria 114075
244 Ga0495635_0019339 3300046663 Bacteria 4750
245 Ga0495659_0053543 3300046664 Bacteria 1475
246 Ga0495613_0000481 3300046689 Bacteria 34000
247 Ga0495600_0004480 3300046809 Bacteria 8368
248 Ga0495604_0000122 3300047317 Bacteria 65938
249 Ga0495676_0026759 3300047321 Bacteria 4959
250 Ga0495676_0121192 3300047321 Bacteria 1902
251 Ga0495680_0005918 3300047322 Bacteria 11429
252 Ga0495686_0072467 3300047472 Bacteria 2118
253 Ga0495602_0000166 3300048088 Bacteria 61220
254 Ga0495602_0001156 3300048088 Bacteria 25832
255 Ga0496100_0031292 3300048903 Bacteria 3307
256 Ga0496101_0001718 3300048904 Bacteria 13120
257 Ga0496102_0003627 3300048905 Bacteria 13059
258 Ga0496103_0003148 3300048906 Bacteria 10138
259 Ga0496105_0011107 3300048908 Bacteria 7102
260 Ga0496105_0012799 3300048908 Bacteria 6649
261 Ga0496105_0093553 3300048908 Bacteria 2482
262 Ga0496106_0011022 3300048909 Bacteria 6682
263 Ga0496106_0210526 3300048909 Bacteria 1549
264 Ga0496107_0085826 3300048910 Bacteria 2297
265 Ga0496109_0207868 3300048912 Bacteria 1841
266 Ga0496110_0009662 3300048913 Bacteria 7811
267 Ga0496110_0048077 3300048913 Bacteria 3739
268 Ga0496110_0069451 3300048913 Bacteria 3120
269 Ga0496110_0158671 3300048913 Bacteria 2050
270 Ga0496111_0046768 3300048914 Bacteria 3116
271 Ga0496111_0151080 3300048914 Bacteria 1722
272 Ga0496111_0152343 3300048914 Bacteria 1715
273 Ga0496112_0022051 3300048915 Bacteria 6064
274 Ga0496112_0046535 3300048915 Bacteria 4255
275 Ga0496113_0001670 3300048916 Bacteria 12555
276 Ga0496114_0038385 3300048917 Bacteria 3962
277 Ga0496115_0000010 3300048918 Bacteria 227112
278 Ga0496115_0012675 3300048918 Bacteria 6353
279 Ga0496115_0054905 3300048918 Bacteria 3199
280 Ga0496120_0052961 3300048923 Bacteria 2307
281 Ga0496121_0072335 3300048924 Bacteria 2768
282 Ga0496126_0025584 3300048929 Bacteria 5674
283 Ga0501031_0002574 3300049568 Bacteria 11552
284 Ga0501032_0003498 3300049569 Bacteria 12009
285 Ga0501033_0000488 3300049570 Bacteria 37325
286 Ga0501034_0020789 3300049571 Bacteria 6699
287 Ga0501034_0107439 3300049571 Bacteria 2782
288 Ga0501036_0001828 3300049572 Bacteria 16516
289 Ga0501036_0020709 3300049572 Bacteria 5525
290 Ga0501036_0117492 3300049572 Bacteria 2246
291 Ga0501037_0000372 3300049573 Bacteria 37292
292 Ga0501038_0000101 3300049574 Bacteria 72459
293 Ga0501038_0037299 3300049574 Bacteria 4262
294 Ga0501039_0006156 3300049575 Bacteria 9112
295 Ga0501039_0045876 3300049575 Bacteria 3377
296 Ga0501040_0040808 3300049576 Bacteria 3159
297 Ga0501040_0109283 3300049576 Bacteria 1933
298 Ga0501041_0021553 3300049577 Bacteria 3860
299 Ga0501043_0002245 3300049579 Bacteria 16445
300 Ga0501046_0002736 3300049580 Bacteria 16409
301 Ga0501047_0042227 3300049581 Bacteria 4407
302 Ga0501048_0001775 3300049582 Bacteria 16409
303 Ga0501048_0007121 3300049582 Bacteria 8499
304 Ga0501070_0000346 3300049586 Bacteria 42122
305 Ga0501071_0031889 3300049587 Bacteria 3739
306 Ga0501071_0045025 3300049587 Bacteria 3167
307 Ga0501072_0004681 3300049588 Bacteria 10423
308 Ga0501073_0009260 3300049589 Bacteria 7264
309 Ga0501074_0019035 3300049590 Bacteria 4987
310 Ga0501075_0105171 3300049591 Bacteria 2145
311 Ga0501076_0032258 3300049592 Bacteria 4087
312 Ga0501079_0004948 3300049741 Bacteria 9878
313 Ga0501079_0010422 3300049741 Bacteria 7066
314 Ga0501080_0007980 3300049742 Bacteria 9591
315 Ga0501083_0006143 3300049744 Bacteria 8520
316 Ga0501035_0000534 3300049822 Bacteria 42484
317 Ga0501044_0000820 3300049823 Bacteria 37419
318 Ga0501044_0020045 3300049823 Bacteria 7140
319 Ga0501044_0220538 3300049823 Bacteria 1847
320 Ga0501045_0023501 3300049824 Bacteria 4420
321 Ga0501045_0047927 3300049824 Bacteria 3113
322 Ga0501045_0092859 3300049824 Bacteria 2232
323 nmdc:mga00v17_41421_c1 3300050491 Bacteria 2766
324 nmdc:mga00v17_45568_c1 3300050491 Bacteria 2650
325 nmdc:mga00v17_63338_c1 3300050491 Bacteria 2277
326 nmdc:mga0yw44_4651_c1 3300050492 Bacteria 6338
327 nmdc:mga05p37_171210_c1 3300050507 Bacteria 2648
328 nmdc:mga05p37_398340_c1 3300050507 Bacteria 1608
329 nmdc:mga09592_12021_c1 3300050508 Bacteria 7043
330 nmdc:mga09592_178463_c1 3300050508 Bacteria 1837
331 nmdc:mga0qj67_17910_c1 3300050509 Bacteria 5393
332 nmdc:mga0qj67_47_c1 3300050509 Bacteria 86979
333 nmdc:mga06r32_40677_c1 3300050510 Bacteria 4415
334 nmdc:mga06r32_9116_c1 3300050510 Bacteria 8945
335 nmdc:mga08y16_3666_c1 3300050511 Bacteria 15985
336 nmdc:mga08y16_39020_c1 3300050511 Bacteria 4984
337 nmdc:mga0n895_8286_c1 3300050512 Bacteria 8990
338 nmdc:mga0n895_96859_c1 3300050512 Bacteria 2955
339 nmdc:mga0a205_228175_c1 3300050515 Bacteria 1746
340 Ga0495601_0000034 3300053077 Bacteria 93719
341 Ga0495601_0029984 3300053077 Bacteria 3376
342 Ga0495612_0000217 3300053078 Bacteria 24406
343 Ga0495612_0029252 3300053078 Bacteria 2219
344 Ga0495655_0003911 3300053083 Bacteria 2503
345 Ga0495655_0011431 3300053083 Bacteria 1784
346 Ga0495619_0000037 3300053085 Bacteria 124007
347 Ga0495619_0000674 3300053085 Bacteria 22363
348 Ga0495619_0001501 3300053085 Bacteria 15370
349 Ga0495619_0081275 3300053085 Bacteria 2182
350 Ga0500641_0008230 3300053096 Bacteria 3718
351 Ga0500616_0001250 3300053153 Bacteria 25463
352 Ga0501084_0035062 3300054114 Bacteria 4194
353 Ga0501084_0042487 3300054114 Bacteria 3803
354 Ga0501082_0005606 3300060353 Bacteria 10896
355 Ga0501082_0005753 3300060353 Bacteria 10757
356 Ga0466962_0026371 3300061719 Bacteria 2791
357 Ga0530510_0016072 3300061734 Bacteria 5291
358 Ga0070679_100339786
359 Ga0065712_10105054
360 Ga0065715_10106477
361 Ga0070658_10011888
362 Ga0070683_100007357
363 Ga0070683_100056493
364 Ga0070666_10120153
365 Ga0070680_100009311
366 Ga0070682_100000171
367 Ga0070682_100008431
368 Ga0070682_100111778
369 Ga0070691_10009007
370 Ga0070687_100073171
371 Ga0070692_10107280
372 Ga0070669_100063889
373 Ga0070675_100000341
374 Ga0070674_100041897
375 Ga0070688_100000285
376 Ga0070667_100016180
377 Ga0070667_100024887
378 Ga0070714_100073519
379 Ga0070713_100000010
380 Ga0070713_100014344
381 Ga0070710_10114747
382 Ga0070705_100008172
383 Ga0070708_100008799
384 Ga0070678_100302921
385 Ga0070681_10004125
386 Ga0070685_10000159
387 Ga0070706_100000331
388 Ga0070706_100001497
389 Ga0070706_100020840
390 Ga0070707_100000639
391 Ga0070707_100011077
392 Ga0070707_100143308
393 Ga0070707_100183501
394 Ga0070698_100002365
395 Ga0070698_100005999
396 Ga0070699_100089781
397 Ga0070679_100002715
398 Ga0070679_100065930
399 Ga0070679_100200332
400 Ga0070684_100123223
401 Ga0070684_100176805
402 Ga0070684_100211519
403 Ga0070697_100016933
404 Ga0068853_100062235
405 Ga0070686_100104038
406 Ga0070695_100038203
407 Ga0070696_100155100
408 Ga0070704_100153608
409 Ga0068857_100003211
410 Ga0068854_100001200
411 Ga0068861_100244040
412 Ga0068851_10053092
413 Ga0068858_100101815
414 Ga0068862_100012408
415 Ga0081455_10022898
416 Ga0081455_10120069
417 Ga0081455_10210480
418 Ga0081538_10024410
419 Ga0081538_10060437
420 Ga0081540_1001415
421 Ga0081539_10000479
422 Ga0081539_10015896
423 Ga0081539_10028240
424 Ga0081539_10056185
425 Ga0070717_10002612
426 Ga0070717_10019504
427 Ga0070717_10143134
428 Ga0070717_10203673
429 Ga0075365_10027714
430 Ga0075365_10142843
431 Ga0075364_10022048
432 Ga0075364_10150071
433 Ga0075428_100113221
434 Ga0075430_100000001
435 Ga0075430_100003119
436 Ga0075430_100129179
437 Ga0075431_100001038
438 Ga0075431_100006132
439 Ga0075431_100119541
440 Ga0075433_10055435
441 Ga0075434_100327103
442 Ga0075434_100445439
443 Ga0075429_100007049
444 Ga0068865_100092488
445 Ga0075436_100070699
446 Ga0105240_10121609
447 Ga0111539_10005086
448 Ga0111539_10047560
449 Ga0105245_10002713
450 Ga0105245_10005396
451 Ga0114129_10026714
452 Ga0114129_10028412
453 Ga0114129_10106543
454 Ga0114129_10245783
455 Ga0114129_10419043
456 Ga0105243_10051863
457 Ga0105248_10033607
458 Ga0105238_10018741
459 Ga0105249_10016459
460 Ga0105249_10161201
461 Ga0105249_10177676
462 Ga0105033_101672
463 Ga0105239_10117453
464 Ga0157370_10002228
465 Ga0157370_10073087
466 Ga0157369_10031160
467 Ga0157378_10243020
468 Ga0157372_10055951
469 Ga0157375_10095022
470 Ga0157379_10355771
471 Ga0206350_11331909
472 Ga0206353_11612718
473 Ga0213874_10020197
474 Ga0213876_10004255
475 Ga0213876_10032715
476 Ga0207656_10017479
477 Ga0207656_10037665
478 Ga0207710_10000243
479 Ga0207680_10027495
480 Ga0207684_10000116
481 Ga0207684_10028072
482 Ga0207684_10028918
483 Ga0207707_10018431
484 Ga0207707_10179188
485 Ga0207671_10214708
486 Ga0207649_10037905
487 Ga0207652_10000720
488 Ga0207652_10039512
489 Ga0207652_10166440
490 Ga0207646_10002044
491 Ga0207646_10003661
492 Ga0207646_10040645
493 Ga0207646_10198923
494 Ga0207681_10031962
495 Ga0207659_10006949
496 Ga0207687_10002187
497 Ga0207700_10000007
498 Ga0207700_10023845
499 Ga0207664_10004759
500 Ga0207690_10046930
501 Ga0207709_10005831
502 Ga0207709_10054393
503 Ga0207669_10033048
504 Ga0207689_10084591
505 Ga0207661_10010061
506 Ga0207712_10017829
507 Ga0207640_10000248
508 Ga0207658_10009308
509 Ga0207703_10191047
510 Ga0207641_10194366
511 Ga0207674_10007296
512 Ga0207674_10045922
513 Ga0207683_10043016
514 Ga0207683_10163599
515 Ga0207698_10010713
516 Ga0268265_10006856
517 Ga0268264_10283772
518 Ga0265337_1000287
519 Ga0265326_10000084
520 Ga0265322_10000020
521 Ga0265338_10013540
522 Ga0265338_10031832
523 Ga0265324_10004241
524 Ga0265320_10000035
525 Ga0265325_10008864
526 Ga0265339_10022602
527 Ga0265331_10001640
528 Ga0265327_10000015
529 Ga0265316_10019543
530 Ga0265313_10002601
531 Ga0316575_10027561
532 Ga0265314_10000690
533 Ga0316576_10023405
534 Ga0316576_10034386
535 Ga0316577_10056940
536 Ga0326468_10001714
537 Ga0307406_10094312
538 Ga0373933_0000020
539 Ga0316582_0042034
540 Ga0316582_0145014
541 Ga0316584_0032286
542 Ga0395899_0064929
543 Ga0395898_0082604
544 Ga0395898_0085622
545 Ga0395905_0102847
546 Ga0436364_0180133
547 Ga0395901_0102723
548 Ga0400484_35250
549 Ga0400490_00712
550 Ga0400490_05086
551 Ga0400490_36540
552 Ga0400490_38974
553 Ga0400490_40791
554 Ga0400490_44480
555 Ga0400490_46433
556 Ga0400490_51133
557 Ga0400490_54433
558 Ga0400491_05406
559 Ga0400485_22071
560 Ga0400488_37626
561 Ga0400486_10724
562 Ga0400486_13190
563 Ga0400486_24588
564 Ga0400486_29797
565 Ga0400483_011478
566 Ga0400483_027936
567 Ga0400483_052537
568 Ga0400483_064632
569 Ga0400483_077694
570 Ga0400483_095539
571 Ga0400483_111670
572 Ga0400483_180109
573 Ga0400483_180499
574 Ga0400483_185206
575 Ga0400483_186342
576 Ga0400489_09453
577 Ga0400489_48106
578 Ga0436365_0334111
579 Ga0436365_0831542
580 Ga0436365_0954180
581 Ga0436363_1218761
582 Ga0436362_0485792
583 Ga0436362_0708824
584 Ga0466969_0029432
585 Ga0466963_0038236
586 Ga0466964_0053181
587 Ga0453684_0006075
588 Ga0466971_0066053
589 Ga0466967_0000017
590 Ga0466967_0021372
591 Ga0466967_0086748
592 Ga0495629_0000691
593 Ga0495653_0055854
594 Ga0495582_0080525
595 Ga0495606_0000108
596 Ga0495628_0001800
597 Ga0495630_0000175
598 Ga0495630_0264672
599 Ga0495587_0020730
600 Ga0495634_0000028
601 Ga0495635_0019339
602 Ga0495659_0053543
603 Ga0495613_0000481
604 Ga0495600_0004480
605 Ga0495604_0000122
606 Ga0495676_0026759
607 Ga0495676_0121192
608 Ga0495680_0005918
609 Ga0495686_0072467
610 Ga0495602_0000166
611 Ga0495602_0001156
612 Ga0496100_0031292
613 Ga0496101_0001718
614 Ga0496102_0003627
615 Ga0496103_0003148
616 Ga0496105_0011107
617 Ga0496105_0012799
618 Ga0496105_0093553
619 Ga0496106_0011022
620 Ga0496106_0210526
621 Ga0496107_0085826
622 Ga0496109_0207868
623 Ga0496110_0009662
624 Ga0496110_0048077
625 Ga0496110_0069451
626 Ga0496110_0158671
627 Ga0496111_0046768
628 Ga0496111_0151080
629 Ga0496111_0152343
630 Ga0496112_0022051
631 Ga0496112_0046535
632 Ga0496113_0001670
633 Ga0496114_0038385
634 Ga0496115_0000010
635 Ga0496115_0012675
636 Ga0496115_0054905
637 Ga0496120_0052961
638 Ga0496121_0072335
639 Ga0496126_0025584
640 Ga0501031_0002574
641 Ga0501032_0003498
642 Ga0501033_0000488
643 Ga0501034_0020789
644 Ga0501034_0107439
645 Ga0501036_0001828
646 Ga0501036_0020709
647 Ga0501036_0117492
648 Ga0501037_0000372
649 Ga0501038_0000101
650 Ga0501038_0037299
651 Ga0501039_0006156
652 Ga0501039_0045876
653 Ga0501040_0040808
654 Ga0501040_0109283
655 Ga0501041_0021553
656 Ga0501043_0002245
657 Ga0501046_0002736
658 Ga0501047_0042227
659 Ga0501048_0001775
660 Ga0501048_0007121
661 Ga0501070_0000346
662 Ga0501071_0031889
663 Ga0501071_0045025
664 Ga0501072_0004681
665 Ga0501073_0009260
666 Ga0501074_0019035
667 Ga0501075_0105171
668 Ga0501076_0032258
669 Ga0501079_0004948
670 Ga0501079_0010422
671 Ga0501080_0007980
672 Ga0501083_0006143
673 Ga0501035_0000534
674 Ga0501044_0000820
675 Ga0501044_0020045
676 Ga0501044_0220538
677 Ga0501045_0023501
678 Ga0501045_0047927
679 Ga0501045_0092859
680 nmdc:mga00v17_41421_c1
681 nmdc:mga00v17_45568_c1
682 nmdc:mga00v17_63338_c1
683 nmdc:mga0yw44_4651_c1
684 nmdc:mga05p37_171210_c1
685 nmdc:mga05p37_398340_c1
686 nmdc:mga09592_12021_c1
687 nmdc:mga09592_178463_c1
688 nmdc:mga0qj67_17910_c1
689 nmdc:mga0qj67_47_c1
690 nmdc:mga06r32_40677_c1
691 nmdc:mga06r32_9116_c1
692 nmdc:mga08y16_3666_c1
693 nmdc:mga08y16_39020_c1
694 nmdc:mga0n895_8286_c1
695 nmdc:mga0n895_96859_c1
696 nmdc:mga0a205_228175_c1
697 Ga0495601_0000034
698 Ga0495601_0029984
699 Ga0495612_0000217
700 Ga0495612_0029252
701 Ga0495655_0003911
702 Ga0495655_0011431
703 Ga0495619_0000037
704 Ga0495619_0000674
705 Ga0495619_0001501
706 Ga0495619_0081275
707 Ga0500641_0008230
708 Ga0500616_0001250
709 Ga0501084_0035062
710 Ga0501084_0042487
711 Ga0501082_0005606
712 Ga0501082_0005753
713 Ga0466962_0026371
714 Ga0530510_0016072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

27

315

0.85

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

28

383

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i2b-assembly1.cif.gz_A crystal structure of mutant t145a sqd1 protein complex with nad and udp-sulfoquinovose/udp-glucose 0.986 1 381
1i24-assembly1.cif.gz_A high resolution crystal structure of the wild-type protein sqd1, with nad and udp-glucose 0.9857 1 383
1qrr-assembly1.cif.gz_A-2 crystal structure of sqd1 protein complex with nad and udp-glucose 0.9856 1 381
1i24-assembly1.cif.gz_A high resolution crystal structure of the wild-type protein sqd1, with nad and udp-glucose 0.9756 1 383
1i2b-assembly1.cif.gz_A crystal structure of mutant t145a sqd1 protein complex with nad and udp-sulfoquinovose/udp-glucose 0.9708 1 381
ID Description Score Start End Superfamily
1qrrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9819 1 293 3.40.50.720
1qrrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9778 1 293 3.40.50.720
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9709 2 31 3.50.50.60
1i2bA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9633 209 377 3.90.25.10
1i2bA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9567 209 377 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A351AZY0-F1-model_v4 deleted 0.9937 1 382
AF-B4VZZ1-F1-model_v4 NAD dependent epimerase/dehydratase family 0.9925 1 382
AF-A0A496UH07-F1-model_v4 NAD-dependent dehydratase 0.992 3 381
AF-A0A351AZY0-F1-model_v4 deleted 0.9911 1 382
AF-A0A396RUI1-F1-model_v4 NAD-dependent dehydratase 0.9908 1 381

Map