F420506
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 356 | 167 | 712 | 79 |
Family's Representative Sequence
| Representative Sequence | 3300017792|Ga0163161_10783605|Ga0163161_107836052 |
| Length | 78 |
| Sequence | MATGETGFDDVTFDLISVQYHSLKAGHYGQYVRDAENARQDEIAQFFRDVMQQDSDRAQRCHKLLAQLGGTDNTSPQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 20 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 22 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 32 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 35 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 36 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 37 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 38 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 39 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 40 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 43 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 44 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 54 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 55 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 56 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 57 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 58 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 59 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 60 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 61 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 62 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 63 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 64 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 65 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 66 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 67 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 68 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 69 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 70 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 71 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 72 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 73 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 74 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 75 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 76 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 77 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 78 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 79 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 80 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 81 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 82 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 83 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 84 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 85 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 86 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 87 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 88 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 89 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 90 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 91 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 92 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 93 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 94 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 95 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 96 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 97 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 98 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 99 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 100 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 101 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 102 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 114 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 115 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 116 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 117 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 119 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 120 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 121 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 122 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 123 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 124 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 125 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 126 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 130 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 131 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 132 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 133 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 134 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 135 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 136 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 137 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 138 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 140 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 141 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 142 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 143 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 145 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 146 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 149 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 150 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 151 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 152 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 153 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 154 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 155 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 156 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 157 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 158 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 159 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 160 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 161 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 162 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 163 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 164 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 165 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 166 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 167 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.18 |
| Metatranscriptomes | 13.48 |
| Isolates | 5.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0.56 |
| Rhizoplane | 5.9 |
| Rhizosphere | 84.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163161_10783605 | 3300017792 | Bacteria | 800 |
| 2 | Ga0006777J48905_1012971 | 3300003308 | Bacteria | 615 |
| 3 | Ga0007427J51700_135608 | 3300003559 | Bacteria | 699 |
| 4 | Ga0007410J51695_1032705 | 3300003574 | Bacteria | 510 |
| 5 | Ga0007409J51694_1028529 | 3300003575 | Bacteria | 952 |
| 6 | Ga0007416J51690_1033240 | 3300003577 | Bacteria | 707 |
| 7 | Ga0007416J51690_1046851 | 3300003577 | Bacteria | 644 |
| 8 | Ga0007429J51699_1024987 | 3300003579 | Bacteria | 769 |
| 9 | Ga0007429J51699_1073064 | 3300003579 | Bacteria | 1340 |
| 10 | Ga0007429J51699_1086128 | 3300003579 | Bacteria | 564 |
| 11 | Ga0032354_1028505 | 3300003693 | Bacteria | 966 |
| 12 | Ga0006780_1033381 | 3300003735 | Bacteria | 780 |
| 13 | Ga0070683_101315818 | 3300005329 | Bacteria | 694 |
| 14 | Ga0070683_101331249 | 3300005329 | Bacteria | 690 |
| 15 | Ga0070682_100980789 | 3300005337 | Bacteria | 700 |
| 16 | Ga0068868_100124958 | 3300005338 | Bacteria | 2101 |
| 17 | Ga0068868_102132843 | 3300005338 | Bacteria | 533 |
| 18 | Ga0070661_101244321 | 3300005344 | Bacteria | 623 |
| 19 | Ga0070671_101096705 | 3300005355 | Bacteria | 699 |
| 20 | Ga0070688_101496383 | 3300005365 | Bacteria | 549 |
| 21 | Ga0068855_100978543 | 3300005563 | Bacteria | 890 |
| 22 | Ga0068854_100667905 | 3300005578 | Bacteria | 894 |
| 23 | Ga0068856_100329405 | 3300005614 | Bacteria | 1545 |
| 24 | Ga0068856_102632560 | 3300005614 | Bacteria | 509 |
| 25 | Ga0068864_100606202 | 3300005618 | Bacteria | 1063 |
| 26 | Ga0068864_101438569 | 3300005618 | Bacteria | 692 |
| 27 | Ga0097621_101560872 | 3300006237 | Bacteria | 627 |
| 28 | Ga0097621_101584953 | 3300006237 | Bacteria | 622 |
| 29 | Ga0075434_101748720 | 3300006871 | Bacteria | 629 |
| 30 | Ga0105245_10588529 | 3300009098 | Bacteria | 1138 |
| 31 | Ga0105237_10782195 | 3300009545 | Bacteria | 961 |
| 32 | Ga0105246_10051335 | 3300011119 | Bacteria | 2832 |
| 33 | Ga0157369_10551334 | 3300013105 | Bacteria | 1192 |
| 34 | Ga0157374_10247676 | 3300013296 | Bacteria | 1753 |
| 35 | Ga0163162_10229618 | 3300013306 | Bacteria | 1986 |
| 36 | Ga0157372_10624460 | 3300013307 | Bacteria | 1255 |
| 37 | Ga0157372_11566619 | 3300013307 | Bacteria | 759 |
| 38 | Ga0157372_11861279 | 3300013307 | Bacteria | 692 |
| 39 | Ga0157375_10147443 | 3300013308 | Bacteria | 2485 |
| 40 | Ga0163163_10585390 | 3300014325 | Bacteria | 1179 |
| 41 | Ga0182008_10451835 | 3300014497 | Bacteria | 699 |
| 42 | Ga0157377_10334829 | 3300014745 | Bacteria | 1010 |
| 43 | Ga0157376_11189573 | 3300014969 | Bacteria | 790 |
| 44 | Ga0197907_10215006 | 3300020069 | Bacteria | 550 |
| 45 | Ga0197907_10231261 | 3300020069 | Bacteria | 510 |
| 46 | Ga0197907_10997384 | 3300020069 | Bacteria | 1815 |
| 47 | Ga0197907_11004878 | 3300020069 | Bacteria | 758 |
| 48 | Ga0206349_1274444 | 3300020075 | Bacteria | 757 |
| 49 | Ga0206349_1418511 | 3300020075 | Bacteria | 796 |
| 50 | Ga0206349_1644728 | 3300020075 | Bacteria | 573 |
| 51 | Ga0206349_1788777 | 3300020075 | Bacteria | 1450 |
| 52 | Ga0206355_1672558 | 3300020076 | Bacteria | 530 |
| 53 | Ga0206351_10474257 | 3300020077 | Bacteria | 767 |
| 54 | Ga0206351_10850191 | 3300020077 | Bacteria | 555 |
| 55 | Ga0206352_10876225 | 3300020078 | Bacteria | 655 |
| 56 | Ga0206350_10369670 | 3300020080 | Bacteria | 827 |
| 57 | Ga0206350_10900548 | 3300020080 | Bacteria | 1851 |
| 58 | Ga0206350_11440882 | 3300020080 | Bacteria | 524 |
| 59 | Ga0206350_11507101 | 3300020080 | Bacteria | 561 |
| 60 | Ga0206354_10431226 | 3300020081 | Bacteria | 785 |
| 61 | Ga0206353_10536024 | 3300020082 | Bacteria | 729 |
| 62 | Ga0206353_11932622 | 3300020082 | Bacteria | 847 |
| 63 | Ga0206353_11991166 | 3300020082 | Bacteria | 1752 |
| 64 | Ga0213876_10099023 | 3300021384 | Bacteria | 1545 |
| 65 | Ga0213876_10802240 | 3300021384 | Bacteria | 501 |
| 66 | Ga0224712_10049581 | 3300022467 | Bacteria | 1627 |
| 67 | Ga0224712_10053440 | 3300022467 | Bacteria | 1582 |
| 68 | Ga0224712_10069835 | 3300022467 | Bacteria | 1423 |
| 69 | Ga0224712_10106479 | 3300022467 | Bacteria | 1197 |
| 70 | Ga0224712_10173691 | 3300022467 | Bacteria | 968 |
| 71 | Ga0224712_10417184 | 3300022467 | Bacteria | 641 |
| 72 | Ga0224712_10433165 | 3300022467 | Bacteria | 630 |
| 73 | Ga0224712_10514796 | 3300022467 | Bacteria | 579 |
| 74 | Ga0224712_10529909 | 3300022467 | Bacteria | 571 |
| 75 | Ga0224712_10649759 | 3300022467 | Bacteria | 517 |
| 76 | Ga0224712_10678346 | 3300022467 | Bacteria | 506 |
| 77 | Ga0224712_10685096 | 3300022467 | Bacteria | 504 |
| 78 | Ga0207647_10563860 | 3300025904 | Bacteria | 631 |
| 79 | Ga0207687_11701272 | 3300025927 | Bacteria | 541 |
| 80 | Ga0207667_10835350 | 3300025949 | Bacteria | 916 |
| 81 | Ga0207640_10358791 | 3300025981 | Bacteria | 1174 |
| 82 | Ga0207677_11030959 | 3300026023 | Bacteria | 747 |
| 83 | Ga0207702_10140178 | 3300026078 | Bacteria | 2187 |
| 84 | Ga0207676_10459701 | 3300026095 | Bacteria | 1202 |
| 85 | Ga0207683_10390903 | 3300026121 | Bacteria | 1279 |
| 86 | Ga0268266_11636525 | 3300028379 | Bacteria | 619 |
| 87 | Ga0311001_1095520 | 3300029277 | Bacteria | 525 |
| 88 | Ga0307511_10314623 | 3300030521 | Bacteria | 697 |
| 89 | Ga0307408_100349640 | 3300031548 | Bacteria | 1254 |
| 90 | Ga0307405_10052106 | 3300031731 | Bacteria | 2543 |
| 91 | Ga0307405_10256564 | 3300031731 | Unclassified | 1303 |
| 92 | Ga0307405_10684272 | 3300031731 | Unclassified | 847 |
| 93 | Ga0307405_11973783 | 3300031731 | Bacteria | 522 |
| 94 | Ga0307413_10018118 | 3300031824 | Unclassified | 3686 |
| 95 | Ga0307413_10021622 | 3300031824 | Unclassified | 3449 |
| 96 | Ga0307413_10544189 | 3300031824 | Bacteria | 940 |
| 97 | Ga0307413_11745289 | 3300031824 | Bacteria | 556 |
| 98 | Ga0307410_10019299 | 3300031852 | Bacteria | 4143 |
| 99 | Ga0307410_10083612 | 3300031852 | Bacteria | 2248 |
| 100 | Ga0307410_10162266 | 3300031852 | Bacteria | 1676 |
| 101 | Ga0307410_11545785 | 3300031852 | Bacteria | 585 |
| 102 | Ga0307406_10039971 | 3300031901 | Bacteria | 2913 |
| 103 | Ga0307406_10719359 | 3300031901 | Bacteria | 835 |
| 104 | Ga0307407_10016647 | 3300031903 | Bacteria | 3665 |
| 105 | Ga0307407_10016987 | 3300031903 | Bacteria | 3638 |
| 106 | Ga0307407_10120139 | 3300031903 | Bacteria | 1664 |
| 107 | Ga0307407_10472940 | 3300031903 | Bacteria | 914 |
| 108 | Ga0307412_10204684 | 3300031911 | Unclassified | 1501 |
| 109 | Ga0307412_11330727 | 3300031911 | Bacteria | 648 |
| 110 | Ga0307409_100086672 | 3300031995 | Bacteria | 2549 |
| 111 | Ga0307409_100110205 | 3300031995 | Bacteria | 2306 |
| 112 | Ga0307409_100155024 | 3300031995 | Bacteria | 1994 |
| 113 | Ga0307409_100719833 | 3300031995 | Bacteria | 999 |
| 114 | Ga0307416_100020096 | 3300032002 | Bacteria | 4756 |
| 115 | Ga0307416_100032634 | 3300032002 | Bacteria | 3937 |
| 116 | Ga0307416_100058903 | 3300032002 | Unclassified | 3118 |
| 117 | Ga0307416_100652958 | 3300032002 | Bacteria | 1137 |
| 118 | Ga0307416_100919322 | 3300032002 | Bacteria | 976 |
| 119 | Ga0307416_101673840 | 3300032002 | Bacteria | 741 |
| 120 | Ga0307416_102241999 | 3300032002 | Bacteria | 647 |
| 121 | Ga0307414_10047664 | 3300032004 | Bacteria | 2951 |
| 122 | Ga0307414_10086574 | 3300032004 | Bacteria | 2312 |
| 123 | Ga0307414_10212773 | 3300032004 | Unclassified | 1581 |
| 124 | Ga0307411_10015091 | 3300032005 | Bacteria | 4325 |
| 125 | Ga0307411_10039695 | 3300032005 | Bacteria | 2979 |
| 126 | Ga0307411_10343548 | 3300032005 | Bacteria | 1214 |
| 127 | Ga0307415_100054842 | 3300032126 | Bacteria | 2723 |
| 128 | Ga0307415_100139448 | 3300032126 | Unclassified | 1849 |
| 129 | Ga0307415_100173136 | 3300032126 | Bacteria | 1685 |
| 130 | Ga0307415_100946506 | 3300032126 | Bacteria | 797 |
| 131 | Ga0307415_101176506 | 3300032126 | Bacteria | 721 |
| 132 | Ga0307415_101349645 | 3300032126 | Bacteria | 677 |
| 133 | Ga0307415_101912904 | 3300032126 | Bacteria | 576 |
| 134 | Ga0373943_0343179 | 3300035170 | Unclassified | 855 |
| 135 | Ga0373946_0155717 | 3300035171 | Bacteria | 1069 |
| 136 | Ga0373935_1325908 | 3300035692 | Bacteria | 537 |
| 137 | Ga0373947_0113911 | 3300035725 | Bacteria | 1712 |
| 138 | Ga0373937_0247546 | 3300036401 | Bacteria | 1680 |
| 139 | Ga0373925_0967249 | 3300037068 | Bacteria | 701 |
| 140 | Ga0373925_1003184 | 3300037068 | Unclassified | 687 |
| 141 | Ga0395900_0108161 | 3300037418 | Bacteria | 2857 |
| 142 | Ga0395898_1072958 | 3300037466 | Bacteria | 739 |
| 143 | Ga0395905_0776787 | 3300037471 | Bacteria | 861 |
| 144 | Ga0436364_0391027 | 3300037853 | Bacteria | 2504 |
| 145 | Ga0436364_0768850 | 3300037853 | Bacteria | 743 |
| 146 | Ga0436364_1216700 | 3300037853 | Bacteria | 4856 |
| 147 | Ga0436364_1229031 | 3300037853 | Bacteria | 607 |
| 148 | Ga0395901_1936138 | 3300038443 | Bacteria | 536 |
| 149 | Ga0436365_0038758 | 3300039437 | Bacteria | 951 |
| 150 | Ga0436365_1626427 | 3300039437 | Bacteria | 29734 |
| 151 | Ga0451789_0334500 | 3300041443 | Unclassified | 564 |
| 152 | Ga0451797_0250112 | 3300041453 | Unclassified | 562 |
| 153 | Ga0451797_0937024 | 3300041453 | Bacteria | 757 |
| 154 | Ga0451798_1117127 | 3300041458 | Bacteria | 646 |
| 155 | Ga0451833_0271230 | 3300041491 | Bacteria | 570 |
| 156 | Ga0451841_0637372 | 3300041498 | Unclassified | 705 |
| 157 | Ga0451843_0393116 | 3300041509 | Bacteria | 814 |
| 158 | Ga0451853_0531365 | 3300041512 | Bacteria | 537 |
| 159 | Ga0451853_1503949 | 3300041512 | Bacteria | 638 |
| 160 | Ga0451853_3439068 | 3300041512 | Bacteria | 577 |
| 161 | Ga0439449_0140326 | 3300042007 | Bacteria | 899 |
| 162 | Ga0466969_0093538 | 3300044656 | Bacteria | 1422 |
| 163 | Ga0466969_0188045 | 3300044656 | Bacteria | 944 |
| 164 | Ga0466972_0117074 | 3300044658 | Bacteria | 1257 |
| 165 | Ga0466965_0061775 | 3300044683 | Bacteria | 1873 |
| 166 | Ga0466965_0093145 | 3300044683 | Bacteria | 1534 |
| 167 | Ga0466965_0102662 | 3300044683 | Bacteria | 1463 |
| 168 | Ga0466965_0248697 | 3300044683 | Bacteria | 953 |
| 169 | Ga0466965_0602984 | 3300044683 | Bacteria | 624 |
| 170 | Ga0466966_0081642 | 3300044684 | Bacteria | 2012 |
| 171 | Ga0466966_0101106 | 3300044684 | Bacteria | 1783 |
| 172 | Ga0466966_0105388 | 3300044684 | Bacteria | 1741 |
| 173 | Ga0466966_0436041 | 3300044684 | Bacteria | 788 |
| 174 | Ga0466966_0576665 | 3300044684 | Bacteria | 677 |
| 175 | Ga0466961_0054069 | 3300044693 | Bacteria | 2561 |
| 176 | Ga0466961_0061571 | 3300044693 | Bacteria | 2385 |
| 177 | Ga0466961_0065893 | 3300044693 | Bacteria | 2301 |
| 178 | Ga0466961_0095369 | 3300044693 | Bacteria | 1876 |
| 179 | Ga0466961_0221723 | 3300044693 | Bacteria | 1165 |
| 180 | Ga0466961_0271905 | 3300044693 | Bacteria | 1038 |
| 181 | Ga0466961_0321993 | 3300044693 | Bacteria | 943 |
| 182 | Ga0466961_0536456 | 3300044693 | Bacteria | 705 |
| 183 | Ga0466961_0977664 | 3300044693 | Bacteria | 503 |
| 184 | Ga0466963_0016067 | 3300044694 | Bacteria | 4648 |
| 185 | Ga0466963_0187959 | 3300044694 | Bacteria | 1443 |
| 186 | Ga0466963_0201215 | 3300044694 | Bacteria | 1393 |
| 187 | Ga0466963_0247641 | 3300044694 | Bacteria | 1250 |
| 188 | Ga0466963_0353205 | 3300044694 | Bacteria | 1035 |
| 189 | Ga0466963_0564522 | 3300044694 | Bacteria | 804 |
| 190 | Ga0466963_0994754 | 3300044694 | Bacteria | 590 |
| 191 | Ga0466964_0026658 | 3300044706 | Bacteria | 2263 |
| 192 | Ga0466964_0059096 | 3300044706 | Bacteria | 1591 |
| 193 | Ga0466964_0307398 | 3300044706 | Bacteria | 801 |
| 194 | Ga0466964_0407367 | 3300044706 | Bacteria | 712 |
| 195 | Ga0466971_0001523 | 3300044719 | Bacteria | 9778 |
| 196 | Ga0466971_0015983 | 3300044719 | Bacteria | 3307 |
| 197 | Ga0466971_0021234 | 3300044719 | Bacteria | 2889 |
| 198 | Ga0466971_0051690 | 3300044719 | Bacteria | 1850 |
| 199 | Ga0466971_0100997 | 3300044719 | Bacteria | 1326 |
| 200 | Ga0466971_0515472 | 3300044719 | Bacteria | 591 |
| 201 | Ga0466971_0648491 | 3300044719 | Bacteria | 529 |
| 202 | Ga0466968_0276194 | 3300044735 | Bacteria | 803 |
| 203 | Ga0466970_0024373 | 3300044765 | Bacteria | 3163 |
| 204 | Ga0466970_0037926 | 3300044765 | Bacteria | 2556 |
| 205 | Ga0466970_0045211 | 3300044765 | Bacteria | 2344 |
| 206 | Ga0466970_0053774 | 3300044765 | Bacteria | 2151 |
| 207 | Ga0466970_0156672 | 3300044765 | Bacteria | 1259 |
| 208 | Ga0466970_0347364 | 3300044765 | Bacteria | 841 |
| 209 | Ga0466970_0546465 | 3300044765 | Bacteria | 669 |
| 210 | Ga0466970_0555016 | 3300044765 | Bacteria | 664 |
| 211 | Ga0466970_0659458 | 3300044765 | Bacteria | 609 |
| 212 | Ga0466970_0818009 | 3300044765 | Bacteria | 546 |
| 213 | Ga0466970_0843734 | 3300044765 | Bacteria | 538 |
| 214 | Ga0466970_0894286 | 3300044765 | Bacteria | 522 |
| 215 | Ga0466957_0005184 | 3300044842 | Bacteria | 7289 |
| 216 | Ga0466957_0032126 | 3300044842 | Bacteria | 3142 |
| 217 | Ga0466957_0052574 | 3300044842 | Bacteria | 2481 |
| 218 | Ga0466957_0086066 | 3300044842 | Bacteria | 1964 |
| 219 | Ga0466957_0195623 | 3300044842 | Bacteria | 1326 |
| 220 | Ga0466957_0452944 | 3300044842 | Bacteria | 884 |
| 221 | Ga0466957_0479433 | 3300044842 | Bacteria | 860 |
| 222 | Ga0466957_0810892 | 3300044842 | Bacteria | 665 |
| 223 | Ga0466960_0003045 | 3300044901 | Bacteria | 6406 |
| 224 | Ga0466960_0005215 | 3300044901 | Bacteria | 5137 |
| 225 | Ga0466960_0005803 | 3300044901 | Bacteria | 4919 |
| 226 | Ga0466960_0009657 | 3300044901 | Bacteria | 3985 |
| 227 | Ga0466960_0074839 | 3300044901 | Bacteria | 1693 |
| 228 | Ga0466960_0084745 | 3300044901 | Bacteria | 1604 |
| 229 | Ga0466960_0129266 | 3300044901 | Bacteria | 1331 |
| 230 | Ga0466960_0235731 | 3300044901 | Bacteria | 1011 |
| 231 | Ga0466960_0272082 | 3300044901 | Bacteria | 947 |
| 232 | Ga0466960_0335767 | 3300044901 | Bacteria | 859 |
| 233 | Ga0466960_0367384 | 3300044901 | Bacteria | 824 |
| 234 | Ga0466960_0453080 | 3300044901 | Bacteria | 746 |
| 235 | Ga0466960_0503219 | 3300044901 | Bacteria | 710 |
| 236 | Ga0466960_0821500 | 3300044901 | Bacteria | 564 |
| 237 | Ga0466959_0061753 | 3300045049 | Bacteria | 2725 |
| 238 | Ga0466959_0075185 | 3300045049 | Bacteria | 2441 |
| 239 | Ga0466959_0276030 | 3300045049 | Bacteria | 1154 |
| 240 | Ga0466959_0403715 | 3300045049 | Bacteria | 929 |
| 241 | Ga0466959_0493198 | 3300045049 | Bacteria | 828 |
| 242 | Ga0466959_0499133 | 3300045049 | Bacteria | 822 |
| 243 | Ga0466958_0022290 | 3300045836 | Bacteria | 3708 |
| 244 | Ga0466958_0024253 | 3300045836 | Bacteria | 3568 |
| 245 | Ga0466958_0058236 | 3300045836 | Bacteria | 2349 |
| 246 | Ga0466958_0070542 | 3300045836 | Bacteria | 2138 |
| 247 | Ga0466958_0077640 | 3300045836 | Bacteria | 2040 |
| 248 | Ga0466958_0143092 | 3300045836 | Bacteria | 1506 |
| 249 | Ga0466958_0263480 | 3300045836 | Bacteria | 1103 |
| 250 | Ga0466958_0355841 | 3300045836 | Bacteria | 943 |
| 251 | Ga0466958_0577287 | 3300045836 | Bacteria | 731 |
| 252 | Ga0466958_0953753 | 3300045836 | Bacteria | 560 |
| 253 | Ga0466967_0002392 | 3300045976 | Bacteria | 11638 |
| 254 | Ga0466967_0008572 | 3300045976 | Bacteria | 7511 |
| 255 | Ga0466967_0026394 | 3300045976 | Bacteria | 4811 |
| 256 | Ga0466967_0026907 | 3300045976 | Bacteria | 4775 |
| 257 | Ga0466967_0033984 | 3300045976 | Bacteria | 4322 |
| 258 | Ga0466967_0082539 | 3300045976 | Bacteria | 2905 |
| 259 | Ga0466967_0101769 | 3300045976 | Bacteria | 2627 |
| 260 | Ga0466967_0128482 | 3300045976 | Bacteria | 2350 |
| 261 | Ga0466967_0138550 | 3300045976 | Bacteria | 2265 |
| 262 | Ga0466967_0162634 | 3300045976 | Bacteria | 2096 |
| 263 | Ga0466967_0197831 | 3300045976 | Bacteria | 1902 |
| 264 | Ga0466967_0346319 | 3300045976 | Bacteria | 1438 |
| 265 | Ga0466967_0435877 | 3300045976 | Bacteria | 1279 |
| 266 | Ga0466967_0501701 | 3300045976 | Bacteria | 1191 |
| 267 | Ga0466967_0555485 | 3300045976 | Bacteria | 1130 |
| 268 | Ga0466967_0618816 | 3300045976 | Bacteria | 1069 |
| 269 | Ga0466967_0674999 | 3300045976 | Bacteria | 1023 |
| 270 | Ga0466967_1175071 | 3300045976 | Bacteria | 764 |
| 271 | Ga0466967_1253924 | 3300045976 | Bacteria | 738 |
| 272 | Ga0466967_1794867 | 3300045976 | Bacteria | 610 |
| 273 | Ga0466967_1880039 | 3300045976 | Bacteria | 595 |
| 274 | Ga0495580_1107454 | 3300046472 | Unclassified | 501 |
| 275 | Ga0495620_0192622 | 3300046515 | Bacteria | 786 |
| 276 | Ga0495620_0403132 | 3300046515 | Bacteria | 518 |
| 277 | Ga0495628_0652560 | 3300046516 | Unclassified | 747 |
| 278 | Ga0495631_0300146 | 3300046518 | Bacteria | 683 |
| 279 | Ga0495621_0272165 | 3300046539 | Bacteria | 696 |
| 280 | Ga0495667_0595226 | 3300046559 | Unclassified | 689 |
| 281 | Ga0495624_0701467 | 3300046690 | Unclassified | 601 |
| 282 | Ga0495680_0126763 | 3300047322 | Bacteria | 1879 |
| 283 | Ga0495684_0474208 | 3300047471 | Unclassified | 865 |
| 284 | Ga0495602_0733001 | 3300048088 | Unclassified | 668 |
| 285 | Ga0496101_0139435 | 3300048904 | Bacteria | 1847 |
| 286 | Ga0496102_0075321 | 3300048905 | Bacteria | 3102 |
| 287 | Ga0496102_0104704 | 3300048905 | Bacteria | 2632 |
| 288 | Ga0496102_0377627 | 3300048905 | Bacteria | 1334 |
| 289 | Ga0496103_0372320 | 3300048906 | Bacteria | 918 |
| 290 | Ga0496103_0421694 | 3300048906 | Bacteria | 857 |
| 291 | Ga0496105_0056265 | 3300048908 | Bacteria | 3246 |
| 292 | Ga0496108_0230481 | 3300048911 | Bacteria | 1610 |
| 293 | Ga0496109_0054571 | 3300048912 | Bacteria | 3646 |
| 294 | Ga0496109_0162205 | 3300048912 | Bacteria | 2094 |
| 295 | Ga0496110_0162075 | 3300048913 | Bacteria | 2027 |
| 296 | Ga0496110_0862481 | 3300048913 | Bacteria | 811 |
| 297 | Ga0496111_0088358 | 3300048914 | Bacteria | 2269 |
| 298 | Ga0496113_0221005 | 3300048916 | Bacteria | 1509 |
| 299 | Ga0496113_1570110 | 3300048916 | Bacteria | 507 |
| 300 | Ga0496114_0376039 | 3300048917 | Bacteria | 1257 |
| 301 | Ga0496114_0778359 | 3300048917 | Bacteria | 835 |
| 302 | Ga0496117_0049279 | 3300048920 | Bacteria | 2998 |
| 303 | Ga0496118_0000029 | 3300048921 | Bacteria | 340978 |
| 304 | Ga0496124_0288355 | 3300048927 | Bacteria | 1193 |
| 305 | Ga0501291_041154 | 3300049514 | Bacteria | 813 |
| 306 | Ga0501317_091732 | 3300049533 | Bacteria | 538 |
| 307 | Ga0501047_0146090 | 3300049581 | Bacteria | 2242 |
| 308 | Ga0501070_0618847 | 3300049586 | Bacteria | 862 |
| 309 | Ga0501207_086423 | 3300049654 | Bacteria | 611 |
| 310 | Ga0501209_242799 | 3300049656 | Bacteria | 562 |
| 311 | Ga0501217_055582 | 3300049661 | Bacteria | 1045 |
| 312 | Ga0501223_136058 | 3300049663 | Bacteria | 526 |
| 313 | Ga0501249_190313 | 3300049679 | Unclassified | 534 |
| 314 | Ga0501251_089472 | 3300049681 | Unclassified | 551 |
| 315 | Ga0501261_025358 | 3300049690 | Bacteria | 872 |
| 316 | Ga0501225_0264763 | 3300049705 | Unclassified | 570 |
| 317 | Ga0501245_046445 | 3300049708 | Bacteria | 759 |
| 318 | Ga0501080_1137225 | 3300049742 | Bacteria | 673 |
| 319 | Ga0501264_029253 | 3300049761 | Unclassified | 626 |
| 320 | Ga0501270_059938 | 3300049767 | Bacteria | 711 |
| 321 | Ga0501271_007692 | 3300049768 | Bacteria | 1091 |
| 322 | Ga0501271_012727 | 3300049768 | Unclassified | 914 |
| 323 | Ga0501280_094877 | 3300049776 | Bacteria | 567 |
| 324 | Ga0501044_0089997 | 3300049823 | Bacteria | 3097 |
| 325 | Ga0501212_071775 | 3300049851 | Bacteria | 614 |
| 326 | Ga0500616_0074789 | 3300053153 | Bacteria | 1716 |
| 327 | Ga0587122_062789 | 3300059628 | Bacteria | 502 |
| 328 | Ga0587114_035518 | 3300059655 | Unclassified | 784 |
| 329 | Ga0587114_105234 | 3300059655 | Bacteria | 555 |
| 330 | Ga0466962_0014273 | 3300061719 | Bacteria | 3828 |
| 331 | Ga0466962_0050316 | 3300061719 | Bacteria | 1991 |
| 332 | Ga0466962_0095479 | 3300061719 | Bacteria | 1425 |
| 333 | Ga0466962_0114903 | 3300061719 | Bacteria | 1297 |
| 334 | Ga0466962_0191971 | 3300061719 | Bacteria | 997 |
| 335 | Ga0466962_0257829 | 3300061719 | Bacteria | 858 |
| 336 | Ga0466962_0391160 | 3300061719 | Bacteria | 695 |
| 337 | Ga0466962_0589823 | 3300061719 | Bacteria | 566 |
| 338 | 2753034663 | 2751185725 | Bacteria | 5740550 |
| 339 | 2753074768 | 2751185734 | Bacteria | 8863695 |
| 340 | 2753323180 | 2751185792 | Bacteria | 5739090 |
| 341 | 2835190081 | 2835188231 | Bacteria | 3476928 |
| 342 | 2839989705 | 2839986021 | Bacteria | 3685650 |
| 343 | 2855675572 | 2855670206 | Bacteria | 7120389 |
| 344 | 2855677552 | 2855676851 | Bacteria | 7063653 |
| 345 | 2857293199 | 2857288857 | Bacteria | 7189066 |
| 346 | 2858852946 | 2858848962 | Bacteria | 6963058 |
| 347 | 2858883281 | 2858882152 | Bacteria | 7230291 |
| 348 | 2858891387 | 2858888857 | Bacteria | 7060307 |
| 349 | 2858901554 | 2858895516 | Bacteria | 7378898 |
| 350 | 2869053705 | 2869048445 | Bacteria | 6875584 |
| 351 | 2869067900 | 2869061728 | Bacteria | 7112407 |
| 352 | 2869071506 | 2869068681 | Bacteria | 7205615 |
| 353 | 2870725308 | 2870721527 | Bacteria | 9689237 |
| 354 | 2902842030 | 2902837492 | Bacteria | 6697721 |
| 355 | 2935892606 | 2935890801 | Bacteria | 4593001 |
| 356 | 8003874400 | 8003870546 | Bacteria | 7396674 |
| 357 | Ga0163161_10783605 | |||
| 358 | Ga0006777J48905_1012971 | |||
| 359 | Ga0007427J51700_135608 | |||
| 360 | Ga0007410J51695_1032705 | |||
| 361 | Ga0007409J51694_1028529 | |||
| 362 | Ga0007416J51690_1033240 | |||
| 363 | Ga0007416J51690_1046851 | |||
| 364 | Ga0007429J51699_1024987 | |||
| 365 | Ga0007429J51699_1073064 | |||
| 366 | Ga0007429J51699_1086128 | |||
| 367 | Ga0032354_1028505 | |||
| 368 | Ga0006780_1033381 | |||
| 369 | Ga0070683_101315818 | |||
| 370 | Ga0070683_101331249 | |||
| 371 | Ga0070682_100980789 | |||
| 372 | Ga0068868_100124958 | |||
| 373 | Ga0068868_102132843 | |||
| 374 | Ga0070661_101244321 | |||
| 375 | Ga0070671_101096705 | |||
| 376 | Ga0070688_101496383 | |||
| 377 | Ga0068855_100978543 | |||
| 378 | Ga0068854_100667905 | |||
| 379 | Ga0068856_100329405 | |||
| 380 | Ga0068856_102632560 | |||
| 381 | Ga0068864_100606202 | |||
| 382 | Ga0068864_101438569 | |||
| 383 | Ga0097621_101560872 | |||
| 384 | Ga0097621_101584953 | |||
| 385 | Ga0075434_101748720 | |||
| 386 | Ga0105245_10588529 | |||
| 387 | Ga0105237_10782195 | |||
| 388 | Ga0105246_10051335 | |||
| 389 | Ga0157369_10551334 | |||
| 390 | Ga0157374_10247676 | |||
| 391 | Ga0163162_10229618 | |||
| 392 | Ga0157372_10624460 | |||
| 393 | Ga0157372_11566619 | |||
| 394 | Ga0157372_11861279 | |||
| 395 | Ga0157375_10147443 | |||
| 396 | Ga0163163_10585390 | |||
| 397 | Ga0182008_10451835 | |||
| 398 | Ga0157377_10334829 | |||
| 399 | Ga0157376_11189573 | |||
| 400 | Ga0197907_10215006 | |||
| 401 | Ga0197907_10231261 | |||
| 402 | Ga0197907_10997384 | |||
| 403 | Ga0197907_11004878 | |||
| 404 | Ga0206349_1274444 | |||
| 405 | Ga0206349_1418511 | |||
| 406 | Ga0206349_1644728 | |||
| 407 | Ga0206349_1788777 | |||
| 408 | Ga0206355_1672558 | |||
| 409 | Ga0206351_10474257 | |||
| 410 | Ga0206351_10850191 | |||
| 411 | Ga0206352_10876225 | |||
| 412 | Ga0206350_10369670 | |||
| 413 | Ga0206350_10900548 | |||
| 414 | Ga0206350_11440882 | |||
| 415 | Ga0206350_11507101 | |||
| 416 | Ga0206354_10431226 | |||
| 417 | Ga0206353_10536024 | |||
| 418 | Ga0206353_11932622 | |||
| 419 | Ga0206353_11991166 | |||
| 420 | Ga0213876_10099023 | |||
| 421 | Ga0213876_10802240 | |||
| 422 | Ga0224712_10049581 | |||
| 423 | Ga0224712_10053440 | |||
| 424 | Ga0224712_10069835 | |||
| 425 | Ga0224712_10106479 | |||
| 426 | Ga0224712_10173691 | |||
| 427 | Ga0224712_10417184 | |||
| 428 | Ga0224712_10433165 | |||
| 429 | Ga0224712_10514796 | |||
| 430 | Ga0224712_10529909 | |||
| 431 | Ga0224712_10649759 | |||
| 432 | Ga0224712_10678346 | |||
| 433 | Ga0224712_10685096 | |||
| 434 | Ga0207647_10563860 | |||
| 435 | Ga0207687_11701272 | |||
| 436 | Ga0207667_10835350 | |||
| 437 | Ga0207640_10358791 | |||
| 438 | Ga0207677_11030959 | |||
| 439 | Ga0207702_10140178 | |||
| 440 | Ga0207676_10459701 | |||
| 441 | Ga0207683_10390903 | |||
| 442 | Ga0268266_11636525 | |||
| 443 | Ga0311001_1095520 | |||
| 444 | Ga0307511_10314623 | |||
| 445 | Ga0307408_100349640 | |||
| 446 | Ga0307405_10052106 | |||
| 447 | Ga0307405_10256564 | |||
| 448 | Ga0307405_10684272 | |||
| 449 | Ga0307405_11973783 | |||
| 450 | Ga0307413_10018118 | |||
| 451 | Ga0307413_10021622 | |||
| 452 | Ga0307413_10544189 | |||
| 453 | Ga0307413_11745289 | |||
| 454 | Ga0307410_10019299 | |||
| 455 | Ga0307410_10083612 | |||
| 456 | Ga0307410_10162266 | |||
| 457 | Ga0307410_11545785 | |||
| 458 | Ga0307406_10039971 | |||
| 459 | Ga0307406_10719359 | |||
| 460 | Ga0307407_10016647 | |||
| 461 | Ga0307407_10016987 | |||
| 462 | Ga0307407_10120139 | |||
| 463 | Ga0307407_10472940 | |||
| 464 | Ga0307412_10204684 | |||
| 465 | Ga0307412_11330727 | |||
| 466 | Ga0307409_100086672 | |||
| 467 | Ga0307409_100110205 | |||
| 468 | Ga0307409_100155024 | |||
| 469 | Ga0307409_100719833 | |||
| 470 | Ga0307416_100020096 | |||
| 471 | Ga0307416_100032634 | |||
| 472 | Ga0307416_100058903 | |||
| 473 | Ga0307416_100652958 | |||
| 474 | Ga0307416_100919322 | |||
| 475 | Ga0307416_101673840 | |||
| 476 | Ga0307416_102241999 | |||
| 477 | Ga0307414_10047664 | |||
| 478 | Ga0307414_10086574 | |||
| 479 | Ga0307414_10212773 | |||
| 480 | Ga0307411_10015091 | |||
| 481 | Ga0307411_10039695 | |||
| 482 | Ga0307411_10343548 | |||
| 483 | Ga0307415_100054842 | |||
| 484 | Ga0307415_100139448 | |||
| 485 | Ga0307415_100173136 | |||
| 486 | Ga0307415_100946506 | |||
| 487 | Ga0307415_101176506 | |||
| 488 | Ga0307415_101349645 | |||
| 489 | Ga0307415_101912904 | |||
| 490 | Ga0373943_0343179 | |||
| 491 | Ga0373946_0155717 | |||
| 492 | Ga0373935_1325908 | |||
| 493 | Ga0373947_0113911 | |||
| 494 | Ga0373937_0247546 | |||
| 495 | Ga0373925_0967249 | |||
| 496 | Ga0373925_1003184 | |||
| 497 | Ga0395900_0108161 | |||
| 498 | Ga0395898_1072958 | |||
| 499 | Ga0395905_0776787 | |||
| 500 | Ga0436364_0391027 | |||
| 501 | Ga0436364_0768850 | |||
| 502 | Ga0436364_1216700 | |||
| 503 | Ga0436364_1229031 | |||
| 504 | Ga0395901_1936138 | |||
| 505 | Ga0436365_0038758 | |||
| 506 | Ga0436365_1626427 | |||
| 507 | Ga0451789_0334500 | |||
| 508 | Ga0451797_0250112 | |||
| 509 | Ga0451797_0937024 | |||
| 510 | Ga0451798_1117127 | |||
| 511 | Ga0451833_0271230 | |||
| 512 | Ga0451841_0637372 | |||
| 513 | Ga0451843_0393116 | |||
| 514 | Ga0451853_0531365 | |||
| 515 | Ga0451853_1503949 | |||
| 516 | Ga0451853_3439068 | |||
| 517 | Ga0439449_0140326 | |||
| 518 | Ga0466969_0093538 | |||
| 519 | Ga0466969_0188045 | |||
| 520 | Ga0466972_0117074 | |||
| 521 | Ga0466965_0061775 | |||
| 522 | Ga0466965_0093145 | |||
| 523 | Ga0466965_0102662 | |||
| 524 | Ga0466965_0248697 | |||
| 525 | Ga0466965_0602984 | |||
| 526 | Ga0466966_0081642 | |||
| 527 | Ga0466966_0101106 | |||
| 528 | Ga0466966_0105388 | |||
| 529 | Ga0466966_0436041 | |||
| 530 | Ga0466966_0576665 | |||
| 531 | Ga0466961_0054069 | |||
| 532 | Ga0466961_0061571 | |||
| 533 | Ga0466961_0065893 | |||
| 534 | Ga0466961_0095369 | |||
| 535 | Ga0466961_0221723 | |||
| 536 | Ga0466961_0271905 | |||
| 537 | Ga0466961_0321993 | |||
| 538 | Ga0466961_0536456 | |||
| 539 | Ga0466961_0977664 | |||
| 540 | Ga0466963_0016067 | |||
| 541 | Ga0466963_0187959 | |||
| 542 | Ga0466963_0201215 | |||
| 543 | Ga0466963_0247641 | |||
| 544 | Ga0466963_0353205 | |||
| 545 | Ga0466963_0564522 | |||
| 546 | Ga0466963_0994754 | |||
| 547 | Ga0466964_0026658 | |||
| 548 | Ga0466964_0059096 | |||
| 549 | Ga0466964_0307398 | |||
| 550 | Ga0466964_0407367 | |||
| 551 | Ga0466971_0001523 | |||
| 552 | Ga0466971_0015983 | |||
| 553 | Ga0466971_0021234 | |||
| 554 | Ga0466971_0051690 | |||
| 555 | Ga0466971_0100997 | |||
| 556 | Ga0466971_0515472 | |||
| 557 | Ga0466971_0648491 | |||
| 558 | Ga0466968_0276194 | |||
| 559 | Ga0466970_0024373 | |||
| 560 | Ga0466970_0037926 | |||
| 561 | Ga0466970_0045211 | |||
| 562 | Ga0466970_0053774 | |||
| 563 | Ga0466970_0156672 | |||
| 564 | Ga0466970_0347364 | |||
| 565 | Ga0466970_0546465 | |||
| 566 | Ga0466970_0555016 | |||
| 567 | Ga0466970_0659458 | |||
| 568 | Ga0466970_0818009 | |||
| 569 | Ga0466970_0843734 | |||
| 570 | Ga0466970_0894286 | |||
| 571 | Ga0466957_0005184 | |||
| 572 | Ga0466957_0032126 | |||
| 573 | Ga0466957_0052574 | |||
| 574 | Ga0466957_0086066 | |||
| 575 | Ga0466957_0195623 | |||
| 576 | Ga0466957_0452944 | |||
| 577 | Ga0466957_0479433 | |||
| 578 | Ga0466957_0810892 | |||
| 579 | Ga0466960_0003045 | |||
| 580 | Ga0466960_0005215 | |||
| 581 | Ga0466960_0005803 | |||
| 582 | Ga0466960_0009657 | |||
| 583 | Ga0466960_0074839 | |||
| 584 | Ga0466960_0084745 | |||
| 585 | Ga0466960_0129266 | |||
| 586 | Ga0466960_0235731 | |||
| 587 | Ga0466960_0272082 | |||
| 588 | Ga0466960_0335767 | |||
| 589 | Ga0466960_0367384 | |||
| 590 | Ga0466960_0453080 | |||
| 591 | Ga0466960_0503219 | |||
| 592 | Ga0466960_0821500 | |||
| 593 | Ga0466959_0061753 | |||
| 594 | Ga0466959_0075185 | |||
| 595 | Ga0466959_0276030 | |||
| 596 | Ga0466959_0403715 | |||
| 597 | Ga0466959_0493198 | |||
| 598 | Ga0466959_0499133 | |||
| 599 | Ga0466958_0022290 | |||
| 600 | Ga0466958_0024253 | |||
| 601 | Ga0466958_0058236 | |||
| 602 | Ga0466958_0070542 | |||
| 603 | Ga0466958_0077640 | |||
| 604 | Ga0466958_0143092 | |||
| 605 | Ga0466958_0263480 | |||
| 606 | Ga0466958_0355841 | |||
| 607 | Ga0466958_0577287 | |||
| 608 | Ga0466958_0953753 | |||
| 609 | Ga0466967_0002392 | |||
| 610 | Ga0466967_0008572 | |||
| 611 | Ga0466967_0026394 | |||
| 612 | Ga0466967_0026907 | |||
| 613 | Ga0466967_0033984 | |||
| 614 | Ga0466967_0082539 | |||
| 615 | Ga0466967_0101769 | |||
| 616 | Ga0466967_0128482 | |||
| 617 | Ga0466967_0138550 | |||
| 618 | Ga0466967_0162634 | |||
| 619 | Ga0466967_0197831 | |||
| 620 | Ga0466967_0346319 | |||
| 621 | Ga0466967_0435877 | |||
| 622 | Ga0466967_0501701 | |||
| 623 | Ga0466967_0555485 | |||
| 624 | Ga0466967_0618816 | |||
| 625 | Ga0466967_0674999 | |||
| 626 | Ga0466967_1175071 | |||
| 627 | Ga0466967_1253924 | |||
| 628 | Ga0466967_1794867 | |||
| 629 | Ga0466967_1880039 | |||
| 630 | Ga0495580_1107454 | |||
| 631 | Ga0495620_0192622 | |||
| 632 | Ga0495620_0403132 | |||
| 633 | Ga0495628_0652560 | |||
| 634 | Ga0495631_0300146 | |||
| 635 | Ga0495621_0272165 | |||
| 636 | Ga0495667_0595226 | |||
| 637 | Ga0495624_0701467 | |||
| 638 | Ga0495680_0126763 | |||
| 639 | Ga0495684_0474208 | |||
| 640 | Ga0495602_0733001 | |||
| 641 | Ga0496101_0139435 | |||
| 642 | Ga0496102_0075321 | |||
| 643 | Ga0496102_0104704 | |||
| 644 | Ga0496102_0377627 | |||
| 645 | Ga0496103_0372320 | |||
| 646 | Ga0496103_0421694 | |||
| 647 | Ga0496105_0056265 | |||
| 648 | Ga0496108_0230481 | |||
| 649 | Ga0496109_0054571 | |||
| 650 | Ga0496109_0162205 | |||
| 651 | Ga0496110_0162075 | |||
| 652 | Ga0496110_0862481 | |||
| 653 | Ga0496111_0088358 | |||
| 654 | Ga0496113_0221005 | |||
| 655 | Ga0496113_1570110 | |||
| 656 | Ga0496114_0376039 | |||
| 657 | Ga0496114_0778359 | |||
| 658 | Ga0496117_0049279 | |||
| 659 | Ga0496118_0000029 | |||
| 660 | Ga0496124_0288355 | |||
| 661 | Ga0501291_041154 | |||
| 662 | Ga0501317_091732 | |||
| 663 | Ga0501047_0146090 | |||
| 664 | Ga0501070_0618847 | |||
| 665 | Ga0501207_086423 | |||
| 666 | Ga0501209_242799 | |||
| 667 | Ga0501217_055582 | |||
| 668 | Ga0501223_136058 | |||
| 669 | Ga0501249_190313 | |||
| 670 | Ga0501251_089472 | |||
| 671 | Ga0501261_025358 | |||
| 672 | Ga0501225_0264763 | |||
| 673 | Ga0501245_046445 | |||
| 674 | Ga0501080_1137225 | |||
| 675 | Ga0501264_029253 | |||
| 676 | Ga0501270_059938 | |||
| 677 | Ga0501271_007692 | |||
| 678 | Ga0501271_012727 | |||
| 679 | Ga0501280_094877 | |||
| 680 | Ga0501044_0089997 | |||
| 681 | Ga0501212_071775 | |||
| 682 | Ga0500616_0074789 | |||
| 683 | Ga0587122_062789 | |||
| 684 | Ga0587114_035518 | |||
| 685 | Ga0587114_105234 | |||
| 686 | Ga0466962_0014273 | |||
| 687 | Ga0466962_0050316 | |||
| 688 | Ga0466962_0095479 | |||
| 689 | Ga0466962_0114903 | |||
| 690 | Ga0466962_0191971 | |||
| 691 | Ga0466962_0257829 | |||
| 692 | Ga0466962_0391160 | |||
| 693 | Ga0466962_0589823 | |||
| 694 | 2753034663 | |||
| 695 | 2753074768 | |||
| 696 | 2753323180 | |||
| 697 | 2835190081 | |||
| 698 | 2839989705 | |||
| 699 | 2855675572 | |||
| 700 | 2855677552 | |||
| 701 | 2857293199 | |||
| 702 | 2858852946 | |||
| 703 | 2858883281 | |||
| 704 | 2858891387 | |||
| 705 | 2858901554 | |||
| 706 | 2869053705 | |||
| 707 | 2869067900 | |||
| 708 | 2869071506 | |||
| 709 | 2870725308 | |||
| 710 | 2902842030 | |||
| 711 | 2935892606 | |||
| 712 | 8003874400 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6tz5-assembly1.cif.gz_AA | cryoem reconstruction of membrane-bound escrt-iii filament composed of chmp1b+ist1 (left-handed) | 0.9584 | 12 | 70 |
| 1f4m-assembly3.cif.gz_E | p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. | 0.9573 | 17 | 65 |
| 2chp-assembly1.cif.gz_A | crystal structure of the dodecameric ferritin mrga from b. subtilis 168 | 0.9537 | 12 | 66 |
| 6tz4-assembly1.cif.gz_JB | cryoem reconstruction of membrane-bound escrt-iii filament composed of chmp1b+ist1 (right-handed) | 0.9483 | 12 | 70 |
| 1f4n-assembly1.cif.gz_B | c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. | 0.9451 | 18 | 63 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1f4mE00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9573 | 17 | 65 | 1.10.287.230 |
| 2chpA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9537 | 12 | 66 | 1.20.1260.10 |
| 1yuzA01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9509 | 9 | 69 | 1.20.1260.10 |
| 1f4nB00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9451 | 18 | 63 | 1.10.287.230 |
| 4cvpA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9439 | 11 | 71 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0JPX1-F1-model_v4 | deleted | 0.9725 | 10 | 70 |
|
| AF-A0A350X514-F1-model_v4 | Rubrerythrin family protein | 0.9724 | 12 | 70 |
|
| AF-A0A2X2BWU6-F1-model_v4 | protein-glutamate methylesterase (EC 3.1.1.61) | 0.9633 | 11 | 70 |
GO:0000156
GO:0005737 GO:0006935 GO:0008984 |
| AF-A0A7C5BUW2-F1-model_v4 | Sensor histidine kinase | 0.9608 | 8 | 70 |
GO:0016020
|
| AF-A0A5B8CHC9-F1-model_v4 | protein-glutamate methylesterase (EC 3.1.1.61) | 0.9604 | 8 | 70 |
GO:0000156
GO:0005737 GO:0006935 GO:0008984 |