F420506

General Info

Members Datasets Scaffolds Average Seq Length
356 167 712 79

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10783605|Ga0163161_107836052
Length 78
Sequence MATGETGFDDVTFDLISVQYHSLKAGHYGQYVRDAENARQDEIAQFFRDVMQQDSDRAQRCHKLLAQLGGTDNTSPQR

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
37 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
54 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
80 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
81 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
82 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
83 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
84 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
126 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
130 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
131 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
135 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
136 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
137 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
140 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
141 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
142 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
150 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
151 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
152 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
153 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
154 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
155 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
156 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
157 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
158 2858882152 Micromonospora noduli MED15 Isolate Nodule
159 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
160 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
161 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
162 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
163 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
164 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
165 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
166 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
167 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.18
Metatranscriptomes 13.48
Isolates 5.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0.56
Rhizoplane 5.9
Rhizosphere 84.55
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10783605 3300017792 Bacteria 800
2 Ga0006777J48905_1012971 3300003308 Bacteria 615
3 Ga0007427J51700_135608 3300003559 Bacteria 699
4 Ga0007410J51695_1032705 3300003574 Bacteria 510
5 Ga0007409J51694_1028529 3300003575 Bacteria 952
6 Ga0007416J51690_1033240 3300003577 Bacteria 707
7 Ga0007416J51690_1046851 3300003577 Bacteria 644
8 Ga0007429J51699_1024987 3300003579 Bacteria 769
9 Ga0007429J51699_1073064 3300003579 Bacteria 1340
10 Ga0007429J51699_1086128 3300003579 Bacteria 564
11 Ga0032354_1028505 3300003693 Bacteria 966
12 Ga0006780_1033381 3300003735 Bacteria 780
13 Ga0070683_101315818 3300005329 Bacteria 694
14 Ga0070683_101331249 3300005329 Bacteria 690
15 Ga0070682_100980789 3300005337 Bacteria 700
16 Ga0068868_100124958 3300005338 Bacteria 2101
17 Ga0068868_102132843 3300005338 Bacteria 533
18 Ga0070661_101244321 3300005344 Bacteria 623
19 Ga0070671_101096705 3300005355 Bacteria 699
20 Ga0070688_101496383 3300005365 Bacteria 549
21 Ga0068855_100978543 3300005563 Bacteria 890
22 Ga0068854_100667905 3300005578 Bacteria 894
23 Ga0068856_100329405 3300005614 Bacteria 1545
24 Ga0068856_102632560 3300005614 Bacteria 509
25 Ga0068864_100606202 3300005618 Bacteria 1063
26 Ga0068864_101438569 3300005618 Bacteria 692
27 Ga0097621_101560872 3300006237 Bacteria 627
28 Ga0097621_101584953 3300006237 Bacteria 622
29 Ga0075434_101748720 3300006871 Bacteria 629
30 Ga0105245_10588529 3300009098 Bacteria 1138
31 Ga0105237_10782195 3300009545 Bacteria 961
32 Ga0105246_10051335 3300011119 Bacteria 2832
33 Ga0157369_10551334 3300013105 Bacteria 1192
34 Ga0157374_10247676 3300013296 Bacteria 1753
35 Ga0163162_10229618 3300013306 Bacteria 1986
36 Ga0157372_10624460 3300013307 Bacteria 1255
37 Ga0157372_11566619 3300013307 Bacteria 759
38 Ga0157372_11861279 3300013307 Bacteria 692
39 Ga0157375_10147443 3300013308 Bacteria 2485
40 Ga0163163_10585390 3300014325 Bacteria 1179
41 Ga0182008_10451835 3300014497 Bacteria 699
42 Ga0157377_10334829 3300014745 Bacteria 1010
43 Ga0157376_11189573 3300014969 Bacteria 790
44 Ga0197907_10215006 3300020069 Bacteria 550
45 Ga0197907_10231261 3300020069 Bacteria 510
46 Ga0197907_10997384 3300020069 Bacteria 1815
47 Ga0197907_11004878 3300020069 Bacteria 758
48 Ga0206349_1274444 3300020075 Bacteria 757
49 Ga0206349_1418511 3300020075 Bacteria 796
50 Ga0206349_1644728 3300020075 Bacteria 573
51 Ga0206349_1788777 3300020075 Bacteria 1450
52 Ga0206355_1672558 3300020076 Bacteria 530
53 Ga0206351_10474257 3300020077 Bacteria 767
54 Ga0206351_10850191 3300020077 Bacteria 555
55 Ga0206352_10876225 3300020078 Bacteria 655
56 Ga0206350_10369670 3300020080 Bacteria 827
57 Ga0206350_10900548 3300020080 Bacteria 1851
58 Ga0206350_11440882 3300020080 Bacteria 524
59 Ga0206350_11507101 3300020080 Bacteria 561
60 Ga0206354_10431226 3300020081 Bacteria 785
61 Ga0206353_10536024 3300020082 Bacteria 729
62 Ga0206353_11932622 3300020082 Bacteria 847
63 Ga0206353_11991166 3300020082 Bacteria 1752
64 Ga0213876_10099023 3300021384 Bacteria 1545
65 Ga0213876_10802240 3300021384 Bacteria 501
66 Ga0224712_10049581 3300022467 Bacteria 1627
67 Ga0224712_10053440 3300022467 Bacteria 1582
68 Ga0224712_10069835 3300022467 Bacteria 1423
69 Ga0224712_10106479 3300022467 Bacteria 1197
70 Ga0224712_10173691 3300022467 Bacteria 968
71 Ga0224712_10417184 3300022467 Bacteria 641
72 Ga0224712_10433165 3300022467 Bacteria 630
73 Ga0224712_10514796 3300022467 Bacteria 579
74 Ga0224712_10529909 3300022467 Bacteria 571
75 Ga0224712_10649759 3300022467 Bacteria 517
76 Ga0224712_10678346 3300022467 Bacteria 506
77 Ga0224712_10685096 3300022467 Bacteria 504
78 Ga0207647_10563860 3300025904 Bacteria 631
79 Ga0207687_11701272 3300025927 Bacteria 541
80 Ga0207667_10835350 3300025949 Bacteria 916
81 Ga0207640_10358791 3300025981 Bacteria 1174
82 Ga0207677_11030959 3300026023 Bacteria 747
83 Ga0207702_10140178 3300026078 Bacteria 2187
84 Ga0207676_10459701 3300026095 Bacteria 1202
85 Ga0207683_10390903 3300026121 Bacteria 1279
86 Ga0268266_11636525 3300028379 Bacteria 619
87 Ga0311001_1095520 3300029277 Bacteria 525
88 Ga0307511_10314623 3300030521 Bacteria 697
89 Ga0307408_100349640 3300031548 Bacteria 1254
90 Ga0307405_10052106 3300031731 Bacteria 2543
91 Ga0307405_10256564 3300031731 Unclassified 1303
92 Ga0307405_10684272 3300031731 Unclassified 847
93 Ga0307405_11973783 3300031731 Bacteria 522
94 Ga0307413_10018118 3300031824 Unclassified 3686
95 Ga0307413_10021622 3300031824 Unclassified 3449
96 Ga0307413_10544189 3300031824 Bacteria 940
97 Ga0307413_11745289 3300031824 Bacteria 556
98 Ga0307410_10019299 3300031852 Bacteria 4143
99 Ga0307410_10083612 3300031852 Bacteria 2248
100 Ga0307410_10162266 3300031852 Bacteria 1676
101 Ga0307410_11545785 3300031852 Bacteria 585
102 Ga0307406_10039971 3300031901 Bacteria 2913
103 Ga0307406_10719359 3300031901 Bacteria 835
104 Ga0307407_10016647 3300031903 Bacteria 3665
105 Ga0307407_10016987 3300031903 Bacteria 3638
106 Ga0307407_10120139 3300031903 Bacteria 1664
107 Ga0307407_10472940 3300031903 Bacteria 914
108 Ga0307412_10204684 3300031911 Unclassified 1501
109 Ga0307412_11330727 3300031911 Bacteria 648
110 Ga0307409_100086672 3300031995 Bacteria 2549
111 Ga0307409_100110205 3300031995 Bacteria 2306
112 Ga0307409_100155024 3300031995 Bacteria 1994
113 Ga0307409_100719833 3300031995 Bacteria 999
114 Ga0307416_100020096 3300032002 Bacteria 4756
115 Ga0307416_100032634 3300032002 Bacteria 3937
116 Ga0307416_100058903 3300032002 Unclassified 3118
117 Ga0307416_100652958 3300032002 Bacteria 1137
118 Ga0307416_100919322 3300032002 Bacteria 976
119 Ga0307416_101673840 3300032002 Bacteria 741
120 Ga0307416_102241999 3300032002 Bacteria 647
121 Ga0307414_10047664 3300032004 Bacteria 2951
122 Ga0307414_10086574 3300032004 Bacteria 2312
123 Ga0307414_10212773 3300032004 Unclassified 1581
124 Ga0307411_10015091 3300032005 Bacteria 4325
125 Ga0307411_10039695 3300032005 Bacteria 2979
126 Ga0307411_10343548 3300032005 Bacteria 1214
127 Ga0307415_100054842 3300032126 Bacteria 2723
128 Ga0307415_100139448 3300032126 Unclassified 1849
129 Ga0307415_100173136 3300032126 Bacteria 1685
130 Ga0307415_100946506 3300032126 Bacteria 797
131 Ga0307415_101176506 3300032126 Bacteria 721
132 Ga0307415_101349645 3300032126 Bacteria 677
133 Ga0307415_101912904 3300032126 Bacteria 576
134 Ga0373943_0343179 3300035170 Unclassified 855
135 Ga0373946_0155717 3300035171 Bacteria 1069
136 Ga0373935_1325908 3300035692 Bacteria 537
137 Ga0373947_0113911 3300035725 Bacteria 1712
138 Ga0373937_0247546 3300036401 Bacteria 1680
139 Ga0373925_0967249 3300037068 Bacteria 701
140 Ga0373925_1003184 3300037068 Unclassified 687
141 Ga0395900_0108161 3300037418 Bacteria 2857
142 Ga0395898_1072958 3300037466 Bacteria 739
143 Ga0395905_0776787 3300037471 Bacteria 861
144 Ga0436364_0391027 3300037853 Bacteria 2504
145 Ga0436364_0768850 3300037853 Bacteria 743
146 Ga0436364_1216700 3300037853 Bacteria 4856
147 Ga0436364_1229031 3300037853 Bacteria 607
148 Ga0395901_1936138 3300038443 Bacteria 536
149 Ga0436365_0038758 3300039437 Bacteria 951
150 Ga0436365_1626427 3300039437 Bacteria 29734
151 Ga0451789_0334500 3300041443 Unclassified 564
152 Ga0451797_0250112 3300041453 Unclassified 562
153 Ga0451797_0937024 3300041453 Bacteria 757
154 Ga0451798_1117127 3300041458 Bacteria 646
155 Ga0451833_0271230 3300041491 Bacteria 570
156 Ga0451841_0637372 3300041498 Unclassified 705
157 Ga0451843_0393116 3300041509 Bacteria 814
158 Ga0451853_0531365 3300041512 Bacteria 537
159 Ga0451853_1503949 3300041512 Bacteria 638
160 Ga0451853_3439068 3300041512 Bacteria 577
161 Ga0439449_0140326 3300042007 Bacteria 899
162 Ga0466969_0093538 3300044656 Bacteria 1422
163 Ga0466969_0188045 3300044656 Bacteria 944
164 Ga0466972_0117074 3300044658 Bacteria 1257
165 Ga0466965_0061775 3300044683 Bacteria 1873
166 Ga0466965_0093145 3300044683 Bacteria 1534
167 Ga0466965_0102662 3300044683 Bacteria 1463
168 Ga0466965_0248697 3300044683 Bacteria 953
169 Ga0466965_0602984 3300044683 Bacteria 624
170 Ga0466966_0081642 3300044684 Bacteria 2012
171 Ga0466966_0101106 3300044684 Bacteria 1783
172 Ga0466966_0105388 3300044684 Bacteria 1741
173 Ga0466966_0436041 3300044684 Bacteria 788
174 Ga0466966_0576665 3300044684 Bacteria 677
175 Ga0466961_0054069 3300044693 Bacteria 2561
176 Ga0466961_0061571 3300044693 Bacteria 2385
177 Ga0466961_0065893 3300044693 Bacteria 2301
178 Ga0466961_0095369 3300044693 Bacteria 1876
179 Ga0466961_0221723 3300044693 Bacteria 1165
180 Ga0466961_0271905 3300044693 Bacteria 1038
181 Ga0466961_0321993 3300044693 Bacteria 943
182 Ga0466961_0536456 3300044693 Bacteria 705
183 Ga0466961_0977664 3300044693 Bacteria 503
184 Ga0466963_0016067 3300044694 Bacteria 4648
185 Ga0466963_0187959 3300044694 Bacteria 1443
186 Ga0466963_0201215 3300044694 Bacteria 1393
187 Ga0466963_0247641 3300044694 Bacteria 1250
188 Ga0466963_0353205 3300044694 Bacteria 1035
189 Ga0466963_0564522 3300044694 Bacteria 804
190 Ga0466963_0994754 3300044694 Bacteria 590
191 Ga0466964_0026658 3300044706 Bacteria 2263
192 Ga0466964_0059096 3300044706 Bacteria 1591
193 Ga0466964_0307398 3300044706 Bacteria 801
194 Ga0466964_0407367 3300044706 Bacteria 712
195 Ga0466971_0001523 3300044719 Bacteria 9778
196 Ga0466971_0015983 3300044719 Bacteria 3307
197 Ga0466971_0021234 3300044719 Bacteria 2889
198 Ga0466971_0051690 3300044719 Bacteria 1850
199 Ga0466971_0100997 3300044719 Bacteria 1326
200 Ga0466971_0515472 3300044719 Bacteria 591
201 Ga0466971_0648491 3300044719 Bacteria 529
202 Ga0466968_0276194 3300044735 Bacteria 803
203 Ga0466970_0024373 3300044765 Bacteria 3163
204 Ga0466970_0037926 3300044765 Bacteria 2556
205 Ga0466970_0045211 3300044765 Bacteria 2344
206 Ga0466970_0053774 3300044765 Bacteria 2151
207 Ga0466970_0156672 3300044765 Bacteria 1259
208 Ga0466970_0347364 3300044765 Bacteria 841
209 Ga0466970_0546465 3300044765 Bacteria 669
210 Ga0466970_0555016 3300044765 Bacteria 664
211 Ga0466970_0659458 3300044765 Bacteria 609
212 Ga0466970_0818009 3300044765 Bacteria 546
213 Ga0466970_0843734 3300044765 Bacteria 538
214 Ga0466970_0894286 3300044765 Bacteria 522
215 Ga0466957_0005184 3300044842 Bacteria 7289
216 Ga0466957_0032126 3300044842 Bacteria 3142
217 Ga0466957_0052574 3300044842 Bacteria 2481
218 Ga0466957_0086066 3300044842 Bacteria 1964
219 Ga0466957_0195623 3300044842 Bacteria 1326
220 Ga0466957_0452944 3300044842 Bacteria 884
221 Ga0466957_0479433 3300044842 Bacteria 860
222 Ga0466957_0810892 3300044842 Bacteria 665
223 Ga0466960_0003045 3300044901 Bacteria 6406
224 Ga0466960_0005215 3300044901 Bacteria 5137
225 Ga0466960_0005803 3300044901 Bacteria 4919
226 Ga0466960_0009657 3300044901 Bacteria 3985
227 Ga0466960_0074839 3300044901 Bacteria 1693
228 Ga0466960_0084745 3300044901 Bacteria 1604
229 Ga0466960_0129266 3300044901 Bacteria 1331
230 Ga0466960_0235731 3300044901 Bacteria 1011
231 Ga0466960_0272082 3300044901 Bacteria 947
232 Ga0466960_0335767 3300044901 Bacteria 859
233 Ga0466960_0367384 3300044901 Bacteria 824
234 Ga0466960_0453080 3300044901 Bacteria 746
235 Ga0466960_0503219 3300044901 Bacteria 710
236 Ga0466960_0821500 3300044901 Bacteria 564
237 Ga0466959_0061753 3300045049 Bacteria 2725
238 Ga0466959_0075185 3300045049 Bacteria 2441
239 Ga0466959_0276030 3300045049 Bacteria 1154
240 Ga0466959_0403715 3300045049 Bacteria 929
241 Ga0466959_0493198 3300045049 Bacteria 828
242 Ga0466959_0499133 3300045049 Bacteria 822
243 Ga0466958_0022290 3300045836 Bacteria 3708
244 Ga0466958_0024253 3300045836 Bacteria 3568
245 Ga0466958_0058236 3300045836 Bacteria 2349
246 Ga0466958_0070542 3300045836 Bacteria 2138
247 Ga0466958_0077640 3300045836 Bacteria 2040
248 Ga0466958_0143092 3300045836 Bacteria 1506
249 Ga0466958_0263480 3300045836 Bacteria 1103
250 Ga0466958_0355841 3300045836 Bacteria 943
251 Ga0466958_0577287 3300045836 Bacteria 731
252 Ga0466958_0953753 3300045836 Bacteria 560
253 Ga0466967_0002392 3300045976 Bacteria 11638
254 Ga0466967_0008572 3300045976 Bacteria 7511
255 Ga0466967_0026394 3300045976 Bacteria 4811
256 Ga0466967_0026907 3300045976 Bacteria 4775
257 Ga0466967_0033984 3300045976 Bacteria 4322
258 Ga0466967_0082539 3300045976 Bacteria 2905
259 Ga0466967_0101769 3300045976 Bacteria 2627
260 Ga0466967_0128482 3300045976 Bacteria 2350
261 Ga0466967_0138550 3300045976 Bacteria 2265
262 Ga0466967_0162634 3300045976 Bacteria 2096
263 Ga0466967_0197831 3300045976 Bacteria 1902
264 Ga0466967_0346319 3300045976 Bacteria 1438
265 Ga0466967_0435877 3300045976 Bacteria 1279
266 Ga0466967_0501701 3300045976 Bacteria 1191
267 Ga0466967_0555485 3300045976 Bacteria 1130
268 Ga0466967_0618816 3300045976 Bacteria 1069
269 Ga0466967_0674999 3300045976 Bacteria 1023
270 Ga0466967_1175071 3300045976 Bacteria 764
271 Ga0466967_1253924 3300045976 Bacteria 738
272 Ga0466967_1794867 3300045976 Bacteria 610
273 Ga0466967_1880039 3300045976 Bacteria 595
274 Ga0495580_1107454 3300046472 Unclassified 501
275 Ga0495620_0192622 3300046515 Bacteria 786
276 Ga0495620_0403132 3300046515 Bacteria 518
277 Ga0495628_0652560 3300046516 Unclassified 747
278 Ga0495631_0300146 3300046518 Bacteria 683
279 Ga0495621_0272165 3300046539 Bacteria 696
280 Ga0495667_0595226 3300046559 Unclassified 689
281 Ga0495624_0701467 3300046690 Unclassified 601
282 Ga0495680_0126763 3300047322 Bacteria 1879
283 Ga0495684_0474208 3300047471 Unclassified 865
284 Ga0495602_0733001 3300048088 Unclassified 668
285 Ga0496101_0139435 3300048904 Bacteria 1847
286 Ga0496102_0075321 3300048905 Bacteria 3102
287 Ga0496102_0104704 3300048905 Bacteria 2632
288 Ga0496102_0377627 3300048905 Bacteria 1334
289 Ga0496103_0372320 3300048906 Bacteria 918
290 Ga0496103_0421694 3300048906 Bacteria 857
291 Ga0496105_0056265 3300048908 Bacteria 3246
292 Ga0496108_0230481 3300048911 Bacteria 1610
293 Ga0496109_0054571 3300048912 Bacteria 3646
294 Ga0496109_0162205 3300048912 Bacteria 2094
295 Ga0496110_0162075 3300048913 Bacteria 2027
296 Ga0496110_0862481 3300048913 Bacteria 811
297 Ga0496111_0088358 3300048914 Bacteria 2269
298 Ga0496113_0221005 3300048916 Bacteria 1509
299 Ga0496113_1570110 3300048916 Bacteria 507
300 Ga0496114_0376039 3300048917 Bacteria 1257
301 Ga0496114_0778359 3300048917 Bacteria 835
302 Ga0496117_0049279 3300048920 Bacteria 2998
303 Ga0496118_0000029 3300048921 Bacteria 340978
304 Ga0496124_0288355 3300048927 Bacteria 1193
305 Ga0501291_041154 3300049514 Bacteria 813
306 Ga0501317_091732 3300049533 Bacteria 538
307 Ga0501047_0146090 3300049581 Bacteria 2242
308 Ga0501070_0618847 3300049586 Bacteria 862
309 Ga0501207_086423 3300049654 Bacteria 611
310 Ga0501209_242799 3300049656 Bacteria 562
311 Ga0501217_055582 3300049661 Bacteria 1045
312 Ga0501223_136058 3300049663 Bacteria 526
313 Ga0501249_190313 3300049679 Unclassified 534
314 Ga0501251_089472 3300049681 Unclassified 551
315 Ga0501261_025358 3300049690 Bacteria 872
316 Ga0501225_0264763 3300049705 Unclassified 570
317 Ga0501245_046445 3300049708 Bacteria 759
318 Ga0501080_1137225 3300049742 Bacteria 673
319 Ga0501264_029253 3300049761 Unclassified 626
320 Ga0501270_059938 3300049767 Bacteria 711
321 Ga0501271_007692 3300049768 Bacteria 1091
322 Ga0501271_012727 3300049768 Unclassified 914
323 Ga0501280_094877 3300049776 Bacteria 567
324 Ga0501044_0089997 3300049823 Bacteria 3097
325 Ga0501212_071775 3300049851 Bacteria 614
326 Ga0500616_0074789 3300053153 Bacteria 1716
327 Ga0587122_062789 3300059628 Bacteria 502
328 Ga0587114_035518 3300059655 Unclassified 784
329 Ga0587114_105234 3300059655 Bacteria 555
330 Ga0466962_0014273 3300061719 Bacteria 3828
331 Ga0466962_0050316 3300061719 Bacteria 1991
332 Ga0466962_0095479 3300061719 Bacteria 1425
333 Ga0466962_0114903 3300061719 Bacteria 1297
334 Ga0466962_0191971 3300061719 Bacteria 997
335 Ga0466962_0257829 3300061719 Bacteria 858
336 Ga0466962_0391160 3300061719 Bacteria 695
337 Ga0466962_0589823 3300061719 Bacteria 566
338 2753034663 2751185725 Bacteria 5740550
339 2753074768 2751185734 Bacteria 8863695
340 2753323180 2751185792 Bacteria 5739090
341 2835190081 2835188231 Bacteria 3476928
342 2839989705 2839986021 Bacteria 3685650
343 2855675572 2855670206 Bacteria 7120389
344 2855677552 2855676851 Bacteria 7063653
345 2857293199 2857288857 Bacteria 7189066
346 2858852946 2858848962 Bacteria 6963058
347 2858883281 2858882152 Bacteria 7230291
348 2858891387 2858888857 Bacteria 7060307
349 2858901554 2858895516 Bacteria 7378898
350 2869053705 2869048445 Bacteria 6875584
351 2869067900 2869061728 Bacteria 7112407
352 2869071506 2869068681 Bacteria 7205615
353 2870725308 2870721527 Bacteria 9689237
354 2902842030 2902837492 Bacteria 6697721
355 2935892606 2935890801 Bacteria 4593001
356 8003874400 8003870546 Bacteria 7396674
357 Ga0163161_10783605
358 Ga0006777J48905_1012971
359 Ga0007427J51700_135608
360 Ga0007410J51695_1032705
361 Ga0007409J51694_1028529
362 Ga0007416J51690_1033240
363 Ga0007416J51690_1046851
364 Ga0007429J51699_1024987
365 Ga0007429J51699_1073064
366 Ga0007429J51699_1086128
367 Ga0032354_1028505
368 Ga0006780_1033381
369 Ga0070683_101315818
370 Ga0070683_101331249
371 Ga0070682_100980789
372 Ga0068868_100124958
373 Ga0068868_102132843
374 Ga0070661_101244321
375 Ga0070671_101096705
376 Ga0070688_101496383
377 Ga0068855_100978543
378 Ga0068854_100667905
379 Ga0068856_100329405
380 Ga0068856_102632560
381 Ga0068864_100606202
382 Ga0068864_101438569
383 Ga0097621_101560872
384 Ga0097621_101584953
385 Ga0075434_101748720
386 Ga0105245_10588529
387 Ga0105237_10782195
388 Ga0105246_10051335
389 Ga0157369_10551334
390 Ga0157374_10247676
391 Ga0163162_10229618
392 Ga0157372_10624460
393 Ga0157372_11566619
394 Ga0157372_11861279
395 Ga0157375_10147443
396 Ga0163163_10585390
397 Ga0182008_10451835
398 Ga0157377_10334829
399 Ga0157376_11189573
400 Ga0197907_10215006
401 Ga0197907_10231261
402 Ga0197907_10997384
403 Ga0197907_11004878
404 Ga0206349_1274444
405 Ga0206349_1418511
406 Ga0206349_1644728
407 Ga0206349_1788777
408 Ga0206355_1672558
409 Ga0206351_10474257
410 Ga0206351_10850191
411 Ga0206352_10876225
412 Ga0206350_10369670
413 Ga0206350_10900548
414 Ga0206350_11440882
415 Ga0206350_11507101
416 Ga0206354_10431226
417 Ga0206353_10536024
418 Ga0206353_11932622
419 Ga0206353_11991166
420 Ga0213876_10099023
421 Ga0213876_10802240
422 Ga0224712_10049581
423 Ga0224712_10053440
424 Ga0224712_10069835
425 Ga0224712_10106479
426 Ga0224712_10173691
427 Ga0224712_10417184
428 Ga0224712_10433165
429 Ga0224712_10514796
430 Ga0224712_10529909
431 Ga0224712_10649759
432 Ga0224712_10678346
433 Ga0224712_10685096
434 Ga0207647_10563860
435 Ga0207687_11701272
436 Ga0207667_10835350
437 Ga0207640_10358791
438 Ga0207677_11030959
439 Ga0207702_10140178
440 Ga0207676_10459701
441 Ga0207683_10390903
442 Ga0268266_11636525
443 Ga0311001_1095520
444 Ga0307511_10314623
445 Ga0307408_100349640
446 Ga0307405_10052106
447 Ga0307405_10256564
448 Ga0307405_10684272
449 Ga0307405_11973783
450 Ga0307413_10018118
451 Ga0307413_10021622
452 Ga0307413_10544189
453 Ga0307413_11745289
454 Ga0307410_10019299
455 Ga0307410_10083612
456 Ga0307410_10162266
457 Ga0307410_11545785
458 Ga0307406_10039971
459 Ga0307406_10719359
460 Ga0307407_10016647
461 Ga0307407_10016987
462 Ga0307407_10120139
463 Ga0307407_10472940
464 Ga0307412_10204684
465 Ga0307412_11330727
466 Ga0307409_100086672
467 Ga0307409_100110205
468 Ga0307409_100155024
469 Ga0307409_100719833
470 Ga0307416_100020096
471 Ga0307416_100032634
472 Ga0307416_100058903
473 Ga0307416_100652958
474 Ga0307416_100919322
475 Ga0307416_101673840
476 Ga0307416_102241999
477 Ga0307414_10047664
478 Ga0307414_10086574
479 Ga0307414_10212773
480 Ga0307411_10015091
481 Ga0307411_10039695
482 Ga0307411_10343548
483 Ga0307415_100054842
484 Ga0307415_100139448
485 Ga0307415_100173136
486 Ga0307415_100946506
487 Ga0307415_101176506
488 Ga0307415_101349645
489 Ga0307415_101912904
490 Ga0373943_0343179
491 Ga0373946_0155717
492 Ga0373935_1325908
493 Ga0373947_0113911
494 Ga0373937_0247546
495 Ga0373925_0967249
496 Ga0373925_1003184
497 Ga0395900_0108161
498 Ga0395898_1072958
499 Ga0395905_0776787
500 Ga0436364_0391027
501 Ga0436364_0768850
502 Ga0436364_1216700
503 Ga0436364_1229031
504 Ga0395901_1936138
505 Ga0436365_0038758
506 Ga0436365_1626427
507 Ga0451789_0334500
508 Ga0451797_0250112
509 Ga0451797_0937024
510 Ga0451798_1117127
511 Ga0451833_0271230
512 Ga0451841_0637372
513 Ga0451843_0393116
514 Ga0451853_0531365
515 Ga0451853_1503949
516 Ga0451853_3439068
517 Ga0439449_0140326
518 Ga0466969_0093538
519 Ga0466969_0188045
520 Ga0466972_0117074
521 Ga0466965_0061775
522 Ga0466965_0093145
523 Ga0466965_0102662
524 Ga0466965_0248697
525 Ga0466965_0602984
526 Ga0466966_0081642
527 Ga0466966_0101106
528 Ga0466966_0105388
529 Ga0466966_0436041
530 Ga0466966_0576665
531 Ga0466961_0054069
532 Ga0466961_0061571
533 Ga0466961_0065893
534 Ga0466961_0095369
535 Ga0466961_0221723
536 Ga0466961_0271905
537 Ga0466961_0321993
538 Ga0466961_0536456
539 Ga0466961_0977664
540 Ga0466963_0016067
541 Ga0466963_0187959
542 Ga0466963_0201215
543 Ga0466963_0247641
544 Ga0466963_0353205
545 Ga0466963_0564522
546 Ga0466963_0994754
547 Ga0466964_0026658
548 Ga0466964_0059096
549 Ga0466964_0307398
550 Ga0466964_0407367
551 Ga0466971_0001523
552 Ga0466971_0015983
553 Ga0466971_0021234
554 Ga0466971_0051690
555 Ga0466971_0100997
556 Ga0466971_0515472
557 Ga0466971_0648491
558 Ga0466968_0276194
559 Ga0466970_0024373
560 Ga0466970_0037926
561 Ga0466970_0045211
562 Ga0466970_0053774
563 Ga0466970_0156672
564 Ga0466970_0347364
565 Ga0466970_0546465
566 Ga0466970_0555016
567 Ga0466970_0659458
568 Ga0466970_0818009
569 Ga0466970_0843734
570 Ga0466970_0894286
571 Ga0466957_0005184
572 Ga0466957_0032126
573 Ga0466957_0052574
574 Ga0466957_0086066
575 Ga0466957_0195623
576 Ga0466957_0452944
577 Ga0466957_0479433
578 Ga0466957_0810892
579 Ga0466960_0003045
580 Ga0466960_0005215
581 Ga0466960_0005803
582 Ga0466960_0009657
583 Ga0466960_0074839
584 Ga0466960_0084745
585 Ga0466960_0129266
586 Ga0466960_0235731
587 Ga0466960_0272082
588 Ga0466960_0335767
589 Ga0466960_0367384
590 Ga0466960_0453080
591 Ga0466960_0503219
592 Ga0466960_0821500
593 Ga0466959_0061753
594 Ga0466959_0075185
595 Ga0466959_0276030
596 Ga0466959_0403715
597 Ga0466959_0493198
598 Ga0466959_0499133
599 Ga0466958_0022290
600 Ga0466958_0024253
601 Ga0466958_0058236
602 Ga0466958_0070542
603 Ga0466958_0077640
604 Ga0466958_0143092
605 Ga0466958_0263480
606 Ga0466958_0355841
607 Ga0466958_0577287
608 Ga0466958_0953753
609 Ga0466967_0002392
610 Ga0466967_0008572
611 Ga0466967_0026394
612 Ga0466967_0026907
613 Ga0466967_0033984
614 Ga0466967_0082539
615 Ga0466967_0101769
616 Ga0466967_0128482
617 Ga0466967_0138550
618 Ga0466967_0162634
619 Ga0466967_0197831
620 Ga0466967_0346319
621 Ga0466967_0435877
622 Ga0466967_0501701
623 Ga0466967_0555485
624 Ga0466967_0618816
625 Ga0466967_0674999
626 Ga0466967_1175071
627 Ga0466967_1253924
628 Ga0466967_1794867
629 Ga0466967_1880039
630 Ga0495580_1107454
631 Ga0495620_0192622
632 Ga0495620_0403132
633 Ga0495628_0652560
634 Ga0495631_0300146
635 Ga0495621_0272165
636 Ga0495667_0595226
637 Ga0495624_0701467
638 Ga0495680_0126763
639 Ga0495684_0474208
640 Ga0495602_0733001
641 Ga0496101_0139435
642 Ga0496102_0075321
643 Ga0496102_0104704
644 Ga0496102_0377627
645 Ga0496103_0372320
646 Ga0496103_0421694
647 Ga0496105_0056265
648 Ga0496108_0230481
649 Ga0496109_0054571
650 Ga0496109_0162205
651 Ga0496110_0162075
652 Ga0496110_0862481
653 Ga0496111_0088358
654 Ga0496113_0221005
655 Ga0496113_1570110
656 Ga0496114_0376039
657 Ga0496114_0778359
658 Ga0496117_0049279
659 Ga0496118_0000029
660 Ga0496124_0288355
661 Ga0501291_041154
662 Ga0501317_091732
663 Ga0501047_0146090
664 Ga0501070_0618847
665 Ga0501207_086423
666 Ga0501209_242799
667 Ga0501217_055582
668 Ga0501223_136058
669 Ga0501249_190313
670 Ga0501251_089472
671 Ga0501261_025358
672 Ga0501225_0264763
673 Ga0501245_046445
674 Ga0501080_1137225
675 Ga0501264_029253
676 Ga0501270_059938
677 Ga0501271_007692
678 Ga0501271_012727
679 Ga0501280_094877
680 Ga0501044_0089997
681 Ga0501212_071775
682 Ga0500616_0074789
683 Ga0587122_062789
684 Ga0587114_035518
685 Ga0587114_105234
686 Ga0466962_0014273
687 Ga0466962_0050316
688 Ga0466962_0095479
689 Ga0466962_0114903
690 Ga0466962_0191971
691 Ga0466962_0257829
692 Ga0466962_0391160
693 Ga0466962_0589823
694 2753034663
695 2753074768
696 2753323180
697 2835190081
698 2839989705
699 2855675572
700 2855677552
701 2857293199
702 2858852946
703 2858883281
704 2858891387
705 2858901554
706 2869053705
707 2869067900
708 2869071506
709 2870725308
710 2902842030
711 2935892606
712 8003874400

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tz5-assembly1.cif.gz_AA cryoem reconstruction of membrane-bound escrt-iii filament composed of chmp1b+ist1 (left-handed) 0.9584 12 70
1f4m-assembly3.cif.gz_E p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9573 17 65
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.9537 12 66
6tz4-assembly1.cif.gz_JB cryoem reconstruction of membrane-bound escrt-iii filament composed of chmp1b+ist1 (right-handed) 0.9483 12 70
1f4n-assembly1.cif.gz_B c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9451 18 63
ID Description Score Start End Superfamily
1f4mE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9573 17 65 1.10.287.230
2chpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9537 12 66 1.20.1260.10
1yuzA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9509 9 69 1.20.1260.10
1f4nB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9451 18 63 1.10.287.230
4cvpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9439 11 71 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7K0JPX1-F1-model_v4 deleted 0.9725 10 70
AF-A0A350X514-F1-model_v4 Rubrerythrin family protein 0.9724 12 70
AF-A0A2X2BWU6-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9633 11 70 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A7C5BUW2-F1-model_v4 Sensor histidine kinase 0.9608 8 70 GO:0016020
AF-A0A5B8CHC9-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9604 8 70 GO:0000156
GO:0005737
GO:0006935
GO:0008984

Map