F420238

General Info

Members Datasets Scaffolds Average Seq Length
355 209 343 210

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0015269|Ga0451576_0015269_5718_6446
Length 242
Sequence LLWGVQFFFDPDKKARGVCLPPRCWGKLGGMNDTPLFFPTFAQGMALSLGLIVAIGAQNAFVLRQGLRREHVGTVVAFCALADAVLISAGVLGMAQALGDRPLLARALALAGAGFLALYGWQALGRARQSHQLRADLGAPGLSRPAALAQAAAFTLLNPHVYLDTVMLVGSIGAQQPVALRGWFVAGACTASLMWFTSLGFGARWLAPWFARPRAWQVLDALIGVTMWVLAALLVHHAWAGS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
3 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
4 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
5 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
6 2842733646 Variovorax sp. R-72446 Isolate Unclassified
7 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
8 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
9 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
10 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
11 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
12 2928058823 Ralstonia sp. 1138 Isolate Unclassified
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
147 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.21
Metatranscriptomes 1.41
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.31
Nodule 0.56
Rhizoplane 2.25
Rhizosphere 58.87
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3294069 2162886007 Bacteria 855
2 JGI24741J21665_1001391 3300001915 Bacteria 6961
3 JGI24740J21852_10000175 3300001979 Bacteria 25721
4 JGI24740J21852_10002451 3300001979 Bacteria 8412
5 JGI24740J21852_10006072 3300001979 Bacteria 5047
6 JGI25156J39149_1009836 3300002705 Bacteria 2293
7 JGI25154J39366_1000981 3300002738 Bacteria 11610
8 JGI25152J39213_1001984 3300002773 Bacteria 8088
9 JGI25151J46595_10000545 3300003187 Bacteria 34695
10 JGI25151J46595_10022484 3300003187 Bacteria 2617
11 JGI25153J46596_10005959 3300003215 Bacteria 6274
12 Ga0006562J51391_1193001 3300003578 Bacteria 2030
13 Ga0006562J51391_1193002 3300003578 Bacteria 1490
14 Ga0055539_1000061 3300003752 Bacteria 144457
15 Ga0055533_1012758 3300003756 Bacteria 877
16 Ga0055532_1000042 3300003758 Bacteria 195195
17 Ga0055525_1000741 3300003759 Bacteria 11140
18 Ga0055527_1001264 3300003760 Bacteria 5559
19 Ga0055535_1000031 3300003761 Bacteria 195195
20 Ga0055529_1000075 3300003763 Bacteria 156291
21 Ga0055529_1000098 3300003763 Bacteria 131900
22 Ga0055526_1001640 3300003771 Bacteria 15723
23 Ga0055526_1001725 3300003771 Bacteria 15211
24 Ga0055526_1005507 3300003771 Bacteria 7255
25 Ga0055524_1004746 3300003775 Bacteria 6215
26 Ga0055524_1011390 3300003775 Bacteria 3483
27 Ga0055536_1000501 3300003781 Bacteria 27098
28 Ga0055534_1000777 3300003784 Bacteria 14972
29 Ga0055534_1001007 3300003784 Bacteria 12394
30 Ga0055541_1000186 3300003841 Bacteria 28517
31 Ga0055541_1002065 3300003841 Bacteria 4108
32 Ga0065704_10125258 3300005289 Bacteria 1706
33 Ga0070670_100738519 3300005331 Bacteria 887
34 Ga0070666_10353687 3300005335 Bacteria 1051
35 Ga0070661_100000455 3300005344 Bacteria 31227
36 Ga0070661_100439063 3300005344 Bacteria 1037
37 Ga0070659_100009159 3300005366 Bacteria 7263
38 Ga0070667_100167240 3300005367 Bacteria 1940
39 Ga0070663_100000044 3300005455 Bacteria 57555
40 Ga0068867_100395583 3300005459 Bacteria 1164
41 Ga0070679_100400024 3300005530 Bacteria 1319
42 Ga0070684_100131351 3300005535 Bacteria 2259
43 Ga0070665_100005597 3300005548 Bacteria 12915
44 Ga0070665_100648775 3300005548 Bacteria 1069
45 Ga0070664_100000092 3300005564 Bacteria 57555
46 Ga0068857_100013185 3300005577 Bacteria 7204
47 Ga0068854_100000176 3300005578 Bacteria 43579
48 Ga0068854_100642239 3300005578 Bacteria 910
49 Ga0068856_100000261 3300005614 Bacteria 57555
50 Ga0068856_101013430 3300005614 Bacteria 848
51 Ga0068859_100473189 3300005617 Bacteria 1348
52 Ga0068851_10397933 3300005834 Bacteria 810
53 Ga0068863_100003739 3300005841 Bacteria 15051
54 Ga0068858_100357531 3300005842 Bacteria 1399
55 Ga0068860_100004430 3300005843 Bacteria 14338
56 Ga0075370_10144369 3300006353 Bacteria 1392
57 Ga0097620_100473175 3300006931 Bacteria 1348
58 Ga0099826_10000009 3300006948 Bacteria 336081
59 Ga0105251_10063900 3300009011 Bacteria 1726
60 Ga0105240_10020847 3300009093 Bacteria 8730
61 Ga0105240_10056199 3300009093 Bacteria 4925
62 Ga0105240_10215560 3300009093 Bacteria 2240
63 Ga0105240_10532174 3300009093 Bacteria 1303
64 Ga0105247_10211973 3300009101 Bacteria 1307
65 Ga0105241_10046624 3300009174 Bacteria 3292
66 Ga0105241_10216007 3300009174 Bacteria 1609
67 Ga0105248_10039956 3300009177 Bacteria 5259
68 Ga0105248_11228540 3300009177 Bacteria 847
69 Ga0105237_10178182 3300009545 Bacteria 2126
70 Ga0105238_10072292 3300009551 Bacteria 3445
71 Ga0105238_10403079 3300009551 Bacteria 1361
72 Ga0105238_10689372 3300009551 Bacteria 1033
73 Ga0105238_11258381 3300009551 Bacteria 765
74 Ga0105249_10173564 3300009553 Bacteria 2092
75 Ga0105249_10677470 3300009553 Bacteria 1090
76 Ga0105239_10072994 3300010375 Bacteria 3773
77 Ga0105239_10119244 3300010375 Bacteria 2928
78 Ga0105239_10349198 3300010375 Bacteria 1670
79 Ga0105239_10392330 3300010375 Bacteria 1570
80 Ga0157373_10010772 3300013100 Bacteria 6729
81 Ga0157371_10000362 3300013102 Bacteria 57561
82 Ga0157371_10070673 3300013102 Bacteria 2471
83 Ga0157370_10000766 3300013104 Bacteria 40226
84 Ga0157369_10015046 3300013105 Bacteria 8731
85 Ga0157369_10136039 3300013105 Bacteria 2602
86 Ga0157372_10000269 3300013307 Bacteria 57561
87 Ga0157372_10206306 3300013307 Bacteria 2277
88 Ga0157375_10243914 3300013308 Bacteria 1956
89 Ga0163163_10690438 3300014325 Bacteria 1084
90 Ga0182008_10000671 3300014497 Bacteria 24825
91 Ga0182008_10014304 3300014497 Bacteria 4158
92 Ga0182008_10330798 3300014497 Bacteria 804
93 Ga0157379_10339753 3300014968 Bacteria 1373
94 Ga0157376_10697352 3300014969 Bacteria 1020
95 Ga0182006_1000075 3300015261 Bacteria 130239
96 Ga0182006_1003108 3300015261 Bacteria 8704
97 Ga0182006_1005995 3300015261 Bacteria 5700
98 Ga0182007_10000135 3300015262 Bacteria 51737
99 Ga0182007_10108196 3300015262 Bacteria 924
100 Ga0182005_1000106 3300015265 Bacteria 63464
101 Ga0183362_10002 3300015683 Bacteria 1432711
102 Ga0163161_10066663 3300017792 Bacteria 2629
103 Ga0206351_10901382 3300020077 Bacteria 2174
104 Ga0154015_1153690 3300020610 Bacteria 31263
105 Ga0213872_10000639 3300021361 Bacteria 26467
106 Ga0213872_10001941 3300021361 Bacteria 12635
107 Ga0213872_10017759 3300021361 Bacteria 3285
108 Ga0213872_10030306 3300021361 Bacteria 2480
109 Ga0213872_10036837 3300021361 Bacteria 2234
110 Ga0213872_10040350 3300021361 Bacteria 2131
111 Ga0213872_10082509 3300021361 Bacteria 1443
112 Ga0213872_10138490 3300021361 Bacteria 1069
113 Ga0213872_10185234 3300021361 Bacteria 898
114 Ga0224712_10109788 3300022467 Bacteria 1181
115 Ga0209784_100003 3300025224 Bacteria 1379451
116 Ga0209784_100245 3300025224 Bacteria 34658
117 Ga0209566_100002 3300025225 Bacteria 2614868
118 Ga0209566_100330 3300025225 Bacteria 42404
119 Ga0209566_101382 3300025225 Bacteria 7502
120 Ga0209674_100094 3300025226 Bacteria 169506
121 Ga0209674_100160 3300025226 Bacteria 88210
122 Ga0209672_100096 3300025228 Bacteria 112947
123 Ga0209147_100002 3300025229 Bacteria 2158988
124 Ga0209563_100004 3300025230 Bacteria 1814108
125 Ga0209563_111133 3300025230 Bacteria 1282
126 Ga0209258_100002 3300025242 Bacteria 2158988
127 Ga0209646_1000019 3300025246 Bacteria 475248
128 Ga0209026_1001332 3300025250 Bacteria 11070
129 Ga0209677_100071 3300025253 Bacteria 139425
130 Ga0209677_106554 3300025253 Bacteria 2727
131 Ga0209148_1000118 3300025254 Bacteria 188330
132 Ga0209148_1004006 3300025254 Bacteria 3768
133 Ga0209759_1004169 3300025256 Bacteria 5495
134 Ga0209129_1000041 3300025258 Bacteria 307590
135 Ga0209565_1000086 3300025263 Bacteria 152204
136 Ga0209565_1008034 3300025263 Bacteria 2791
137 Ga0209455_1000009 3300025272 Bacteria 1042273
138 Ga0209130_1002672 3300025284 Bacteria 8504
139 Ga0209675_1000050 3300025291 Bacteria 212222
140 Ga0209675_1000571 3300025291 Bacteria 26587
141 Ga0209675_1001661 3300025291 Bacteria 12382
142 Ga0209675_1002072 3300025291 Bacteria 10658
143 Ga0209676_1000053 3300025292 Bacteria 370111
144 Ga0209676_1015997 3300025292 Bacteria 2732
145 Ga0209025_1000059 3300025294 Bacteria 305480
146 Ga0209025_1000093 3300025294 Bacteria 241788
147 Ga0209025_1003086 3300025294 Bacteria 16345
148 Ga0209025_1035094 3300025294 Bacteria 2273
149 Ga0209564_1000029 3300025295 Bacteria 505995
150 Ga0209564_1000158 3300025295 Bacteria 164425
151 Ga0209564_1000224 3300025295 Bacteria 126345
152 Ga0209564_1001285 3300025295 Bacteria 27486
153 Ga0209758_1000043 3300025297 Bacteria 402310
154 Ga0209758_1010250 3300025297 Bacteria 5643
155 Ga0209256_1001784 3300025299 Bacteria 20378
156 Ga0209256_1003909 3300025299 Bacteria 9850
157 Ga0209051_1014067 3300025303 Bacteria 3756
158 Ga0209051_1021847 3300025303 Bacteria 2709
159 Ga0207713_1090817 3300025735 Bacteria 1073
160 Ga0207710_10103330 3300025900 Bacteria 1346
161 Ga0207654_10311249 3300025911 Bacteria 1074
162 Ga0207707_10005544 3300025912 Bacteria 11034
163 Ga0207695_10008005 3300025913 Bacteria 13311
164 Ga0207695_10142590 3300025913 Bacteria 2343
165 Ga0207695_10484745 3300025913 Bacteria 1119
166 Ga0207671_10040687 3300025914 Bacteria 3440
167 Ga0207649_10002855 3300025920 Bacteria 9534
168 Ga0207694_10049184 3300025924 Bacteria 3263
169 Ga0207694_10820477 3300025924 Bacteria 786
170 Ga0207711_10002351 3300025941 Bacteria 16947
171 Ga0207711_10288433 3300025941 Bacteria 1512
172 Ga0207679_10000341 3300025945 Bacteria 34009
173 Ga0207712_10415833 3300025961 Bacteria 1133
174 Ga0207640_10000049 3300025981 Bacteria 97025
175 Ga0207640_10329485 3300025981 Bacteria 1219
176 Ga0207703_10035250 3300026035 Bacteria 3976
177 Ga0207678_10000148 3300026067 Bacteria 57513
178 Ga0207702_10000296 3300026078 Bacteria 57562
179 Ga0207641_10000470 3300026088 Bacteria 45563
180 Ga0207648_10476876 3300026089 Bacteria 1139
181 Ga0207674_10001491 3300026116 Bacteria 30227
182 Ga0207675_100377240 3300026118 Bacteria 1394
183 Ga0207698_10117157 3300026142 Bacteria 2246
184 Ga0209282_1000017 3300027666 Bacteria 191482
185 Ga0209974_10005261 3300027876 Bacteria 4566
186 Ga0268266_10011990 3300028379 Bacteria 7504
187 Ga0268266_10077971 3300028379 Bacteria 2882
188 Ga0268265_10006274 3300028380 Bacteria 8053
189 Ga0268264_10000708 3300028381 Bacteria 38439
190 Ga0307515_10029601 3300028794 Bacteria 9245
191 Ga0307515_10030036 3300028794 Bacteria 9153
192 Ga0307512_10088951 3300030522 Bacteria 2163
193 Ga0265339_10192762 3300031249 Bacteria 1009
194 Ga0307513_10009669 3300031456 Bacteria 12179
195 Ga0307513_10048651 3300031456 Bacteria 4600
196 Ga0307513_10129626 3300031456 Bacteria 2470
197 Ga0307509_10020057 3300031507 Bacteria 7598
198 Ga0307516_10000506 3300031730 Bacteria 51918
199 Ga0307516_10106294 3300031730 Bacteria 2617
200 Ga0307510_10000018 3300033180 Bacteria 192986
201 Ga0307510_10014663 3300033180 Bacteria 9277
202 Ga0307510_10085989 3300033180 Bacteria 3018
203 Ga0373936_0260976 3300035113 Bacteria 775
204 Ga0395900_0027154 3300037418 Bacteria 5861
205 Ga0436365_0320025 3300039437 Bacteria 1106
206 Ga0436361_0007544 3300039447 Bacteria 2395
207 Ga0436361_0019682 3300039447 Bacteria 41674
208 Ga0436361_0021782 3300039447 Bacteria 5000
209 Ga0436361_0025162 3300039447 Bacteria 4979
210 Ga0436361_0038009 3300039447 Bacteria 4381
211 Ga0436361_0148623 3300039447 Bacteria 2157
212 Ga0436361_0213108 3300039447 Bacteria 2008
213 Ga0436361_0333091 3300039447 Bacteria 2456
214 Ga0436361_0417851 3300039447 Bacteria 1371
215 Ga0436361_0780096 3300039447 Bacteria 938
216 Ga0436361_0866882 3300039447 Bacteria 7359
217 Ga0436361_1007985 3300039447 Bacteria 1229
218 Ga0436361_1115311 3300039447 Bacteria 1259
219 Ga0436361_1128746 3300039447 Bacteria 5098
220 Ga0436361_1139319 3300039447 Bacteria 3171
221 Ga0451577_0000303 3300042876 Bacteria 95840
222 Ga0466986_0083669 3300044650 Bacteria 2208
223 Ga0466972_0000217 3300044658 Bacteria 40421
224 Ga0466978_0002795 3300044671 Bacteria 7722
225 Ga0466982_0020506 3300044672 Bacteria 3758
226 Ga0466965_0047733 3300044683 Bacteria 2120
227 Ga0466965_0136983 3300044683 Bacteria 1272
228 Ga0466966_0002396 3300044684 Bacteria 12243
229 Ga0466961_0000078 3300044693 Bacteria 60385
230 Ga0466961_0322134 3300044693 Bacteria 942
231 Ga0466963_0096179 3300044694 Bacteria 2023
232 Ga0466964_0002154 3300044706 Bacteria 6952
233 Ga0466964_0002785 3300044706 Bacteria 6286
234 Ga0466964_0038659 3300044706 Bacteria 1919
235 Ga0453684_0000947 3300044712 Bacteria 95768
236 Ga0453684_0212940 3300044712 Bacteria 2245
237 Ga0466971_0002021 3300044719 Bacteria 8583
238 Ga0466971_0014263 3300044719 Bacteria 3494
239 Ga0466971_0197258 3300044719 Bacteria 949
240 Ga0466968_0003642 3300044735 Bacteria 5712
241 Ga0466968_0049098 3300044735 Bacteria 1797
242 Ga0466970_0000245 3300044765 Bacteria 26613
243 Ga0466970_0024951 3300044765 Bacteria 3128
244 Ga0466970_0028940 3300044765 Bacteria 2914
245 Ga0466970_0233364 3300044765 Bacteria 1028
246 Ga0466957_0006923 3300044842 Bacteria 6409
247 Ga0466957_0011126 3300044842 Bacteria 5182
248 Ga0466959_0002066 3300045049 Bacteria 12700
249 Ga0466959_0004039 3300045049 Bacteria 9760
250 Ga0466959_0021294 3300045049 Bacteria 4780
251 Ga0466959_0052994 3300045049 Bacteria 2968
252 Ga0451576_0001138 3300045051 Bacteria 48072
253 Ga0451576_0015269 3300045051 Bacteria 8513
254 Ga0466958_0062922 3300045836 Bacteria 2262
255 Ga0466958_0125338 3300045836 Bacteria 1610
256 Ga0466967_0007139 3300045976 Bacteria 8017
257 Ga0466967_0017142 3300045976 Bacteria 5739
258 Ga0466967_0047195 3300045976 Bacteria 3754
259 Ga0495638_0000069 3300046460 Bacteria 167503
260 Ga0495638_0025263 3300046460 Bacteria 3864
261 Ga0495650_0002641 3300046471 Bacteria 14014
262 Ga0495605_0007559 3300046474 Bacteria 6162
263 Ga0495584_0064242 3300046491 Bacteria 1845
264 Ga0495596_0000255 3300046500 Bacteria 35643
265 Ga0495607_0002536 3300046501 Bacteria 14777
266 Ga0495606_0089768 3300046507 Bacteria 1893
267 Ga0495606_0106882 3300046507 Bacteria 1694
268 Ga0495610_0000200 3300046512 Bacteria 67114
269 Ga0495616_0002056 3300046513 Bacteria 13520
270 Ga0495631_0110918 3300046518 Bacteria 1180
271 Ga0495648_0021843 3300046524 Bacteria 4421
272 Ga0495654_0061970 3300046530 Bacteria 1794
273 Ga0495609_0001548 3300046538 Bacteria 15066
274 Ga0495597_0001204 3300046542 Bacteria 19351
275 Ga0495622_0106531 3300046557 Bacteria 1284
276 Ga0495622_0168687 3300046557 Bacteria 985
277 Ga0495633_0000681 3300046558 Bacteria 31325
278 Ga0495659_0065367 3300046664 Bacteria 1353
279 Ga0495661_0007296 3300046665 Bacteria 7706
280 Ga0495661_0089819 3300046665 Bacteria 1750
281 Ga0495670_0019812 3300046691 Bacteria 3315
282 Ga0495671_0001605 3300046692 Bacteria 14902
283 Ga0495649_0004818 3300046694 Bacteria 8738
284 Ga0495649_0363402 3300046694 Bacteria 730
285 Ga0495672_0014302 3300047320 Bacteria 5440
286 Ga0495626_0038677 3300048091 Bacteria 2261
287 Ga0496100_0491554 3300048903 Bacteria 945
288 Ga0496102_0063160 3300048905 Bacteria 3390
289 Ga0496102_0317435 3300048905 Bacteria 1468
290 Ga0496103_0101334 3300048906 Bacteria 1823
291 Ga0496106_0682458 3300048909 Bacteria 819
292 Ga0496112_0363067 3300048915 Bacteria 1390
293 Ga0496116_0005398 3300048919 Bacteria 11892
294 Ga0496116_0020560 3300048919 Bacteria 5010
295 Ga0496116_0180347 3300048919 Bacteria 1131
296 Ga0496117_0000001 3300048920 Bacteria 2526244
297 Ga0496117_0016841 3300048920 Bacteria 6140
298 Ga0496118_0000008 3300048921 Bacteria 644537
299 Ga0496118_0000419 3300048921 Bacteria 70630
300 Ga0496118_0001837 3300048921 Bacteria 30407
301 Ga0496118_0114317 3300048921 Bacteria 1780
302 Ga0496118_0243343 3300048921 Bacteria 1028
303 Ga0496119_0002339 3300048922 Bacteria 20876
304 Ga0496119_0010201 3300048922 Bacteria 7929
305 Ga0496119_0046025 3300048922 Bacteria 2729
306 Ga0496120_0000014 3300048923 Bacteria 323163
307 Ga0496120_0047167 3300048923 Bacteria 2485
308 Ga0496120_0301630 3300048923 Bacteria 733
309 Ga0496121_0000009 3300048924 Bacteria 836971
310 Ga0496121_0006919 3300048924 Bacteria 13825
311 Ga0496121_0009923 3300048924 Bacteria 10840
312 Ga0496121_0063459 3300048924 Bacteria 3018
313 Ga0496121_0115288 3300048924 Bacteria 2040
314 Ga0496122_0001150 3300048925 Bacteria 45372
315 Ga0496122_0005636 3300048925 Bacteria 14790
316 Ga0496122_0012327 3300048925 Bacteria 8531
317 Ga0496123_0000466 3300048926 Bacteria 70916
318 Ga0496123_0001208 3300048926 Bacteria 37717
319 Ga0496123_0082169 3300048926 Bacteria 1954
320 Ga0496124_0062525 3300048927 Bacteria 3115
321 Ga0496124_0081970 3300048927 Bacteria 2649
322 Ga0496124_0446277 3300048927 Bacteria 883
323 Ga0496125_0005098 3300048928 Bacteria 14785
324 Ga0496125_0005629 3300048928 Bacteria 13832
325 Ga0496125_0006533 3300048928 Bacteria 12570
326 Ga0496125_0032400 3300048928 Bacteria 4643
327 Ga0496126_0017481 3300048929 Bacteria 7142
328 Ga0496126_0138763 3300048929 Bacteria 2094
329 Ga0496126_0190120 3300048929 Bacteria 1739
330 Ga0496126_0311760 3300048929 Bacteria 1295
331 Ga0496126_0348011 3300048929 Bacteria 1213
332 Ga0495682_0002813 3300049460 Bacteria 8025
333 Ga0501033_0012432 3300049570 Bacteria 6497
334 Ga0501034_0037241 3300049571 Bacteria 4925
335 Ga0501034_0472392 3300049571 Bacteria 1170
336 Ga0501038_0042700 3300049574 Bacteria 3948
337 Ga0501038_0050653 3300049574 Bacteria 3587
338 Ga0501047_0022514 3300049581 Bacteria 6052
339 Ga0501047_0053213 3300049581 Bacteria 3914
340 Ga0501035_0017849 3300049822 Bacteria 6545
341 Ga0501035_0623845 3300049822 Bacteria 876
342 Ga0500642_0320956 3300053130 Bacteria 695
343 Ga0466962_0005341 3300061719 Bacteria 6175

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10048651 Ga0307513_100486512 177
2 3300003187 JGI25151J46595_10000545 JGI25151J46595_1000054521 182
3 3300003775 Ga0055524_1004746 Ga0055524_10047466 182
4 3300003784 Ga0055534_1000777 Ga0055534_10007774 182
5 3300003771 Ga0055526_1001725 Ga0055526_10017257 184
6 3300010375 Ga0105239_10392330 Ga0105239_103923302 184
7 3300025295 Ga0209564_1000158 Ga0209564_100015855 184
8 3300048905 Ga0496102_0063160 Ga0496102_0063160_2518_3090 185
9 3300048919 Ga0496116_0180347 Ga0496116_0180347_418_990 185
10 3300048921 Ga0496118_0000419 Ga0496118_0000419_27493_28065 185
11 3300048923 Ga0496120_0301630 Ga0496120_0301630_14_586 185
12 3300048924 Ga0496121_0063459 Ga0496121_0063459_42_614 185
13 3300048927 Ga0496124_0081970 Ga0496124_0081970_1032_1604 185
14 3300048929 Ga0496126_0138763 Ga0496126_0138763_800_1372 185
15 3300003187 JGI25151J46595_10022484 JGI25151J46595_100224841 189
16 3300003578 Ga0006562J51391_1193001 Ga0006562J51391_11930012 189
17 3300003771 Ga0055526_1005507 Ga0055526_10055072 189
18 3300003781 Ga0055536_1000501 Ga0055536_100050125 189
19 3300003784 Ga0055534_1001007 Ga0055534_10010075 189
20 3300025291 Ga0209675_1000050 Ga0209675_1000050128 189
21 3300025292 Ga0209676_1000053 Ga0209676_1000053120 189
22 3300025294 Ga0209025_1000093 Ga0209025_1000093156 189
23 3300025295 Ga0209564_1000224 Ga0209564_100022437 189
24 3300046471 Ga0495650_0002641 Ga0495650_0002641_708_1337 189
25 iso_pu_bacteria 2894817345 2894820828 194
26 iso_pu_bacteria 8005658619 8005658964 194
27 3300015683 Ga0183362_10002 Ga0183362_10002351 195
28 3300025263 Ga0209565_1000086 Ga0209565_1000086117 195
29 3300025291 Ga0209675_1001661 Ga0209675_10016619 195
30 3300025294 Ga0209025_1000059 Ga0209025_1000059170 195
31 3300025295 Ga0209564_1001285 Ga0209564_10012854 195
32 3300025297 Ga0209758_1010250 Ga0209758_10102502 195
33 3300025299 Ga0209256_1003909 Ga0209256_100390910 195
34 3300045836 Ga0466958_0125338 Ga0466958_0125338_752_1501 196
35 3300046557 Ga0495622_0168687 Ga0495622_0168687_279_893 196
36 3300046460 Ga0495638_0000069 Ga0495638_0000069_29676_30275 197
37 3300053130 Ga0500642_0320956 Ga0500642_0320956_47_673 197
38 iso_pu_bacteria 2842775625 2842778987 197
39 iso_pu_bacteria 2854681122 2854681834 197
40 3300001979 JGI24740J21852_10006072 JGI24740J21852_100060726 198
41 3300005548 Ga0070665_100005597 Ga0070665_10000559711 198
42 3300013102 Ga0157371_10070673 Ga0157371_100706731 198
43 3300021361 Ga0213872_10000639 Ga0213872_1000063917 198
44 3300021361 Ga0213872_10001941 Ga0213872_100019414 198
45 3300021361 Ga0213872_10017759 Ga0213872_100177594 198
46 3300021361 Ga0213872_10040350 Ga0213872_100403503 198
47 3300021361 Ga0213872_10082509 Ga0213872_100825092 198
48 3300021361 Ga0213872_10185234 Ga0213872_101852342 198
49 3300028379 Ga0268266_10011990 Ga0268266_100119905 198
50 3300039447 Ga0436361_0007544 Ga0436361_0007544_1196_1804 198
51 3300039447 Ga0436361_0019682 Ga0436361_0019682_10878_11486 198
52 3300039447 Ga0436361_0021782 Ga0436361_0021782_4026_4634 198
53 3300039447 Ga0436361_0025162 Ga0436361_0025162_150_758 198
54 3300039447 Ga0436361_0038009 Ga0436361_0038009_3543_4151 198
55 3300039447 Ga0436361_0213108 Ga0436361_0213108_1284_1901 198
56 3300039447 Ga0436361_0333091 Ga0436361_0333091_1460_2062 198
57 3300039447 Ga0436361_0780096 Ga0436361_0780096_262_870 198
58 3300039447 Ga0436361_1007985 Ga0436361_1007985_27_635 198
59 3300039447 Ga0436361_1115311 Ga0436361_1115311_191_796 198
60 3300044842 Ga0466957_0011126 Ga0466957_0011126_1630_2253 198
61 3300045836 Ga0466958_0062922 Ga0466958_0062922_285_893 198
62 3300049571 Ga0501034_0037241 Ga0501034_0037241_2283_2981 198
63 3300049571 Ga0501034_0472392 Ga0501034_0472392_64_729 198
64 3300049574 Ga0501038_0042700 Ga0501038_0042700_2777_3442 198
65 3300049574 Ga0501038_0050653 Ga0501038_0050653_1977_2675 198
66 3300001979 JGI24740J21852_10000175 JGI24740J21852_100001758 199
67 3300009177 Ga0105248_10039956 Ga0105248_100399564 199
68 3300025224 Ga0209784_100245 Ga0209784_10024534 199
69 3300025225 Ga0209566_100330 Ga0209566_10033020 199
70 3300025226 Ga0209674_100160 Ga0209674_10016025 199
71 3300025230 Ga0209563_111133 Ga0209563_1111332 199
72 3300025246 Ga0209646_1000019 Ga0209646_1000019197 199
73 3300025250 Ga0209026_1001332 Ga0209026_100133210 199
74 3300025253 Ga0209677_106554 Ga0209677_1065544 199
75 3300025254 Ga0209148_1000118 Ga0209148_1000118120 199
76 3300025256 Ga0209759_1004169 Ga0209759_10041695 199
77 3300025941 Ga0207711_10002351 Ga0207711_100023515 199
78 3300044658 Ga0466972_0000217 Ga0466972_0000217_12179_12799 199
79 3300044671 Ga0466978_0002795 Ga0466978_0002795_3712_4332 199
80 3300044672 Ga0466982_0020506 Ga0466982_0020506_1180_1800 199
81 3300044683 Ga0466965_0136983 Ga0466965_0136983_244_864 199
82 3300044693 Ga0466961_0000078 Ga0466961_0000078_47000_47620 199
83 3300044694 Ga0466963_0096179 Ga0466963_0096179_1048_1668 199
84 3300044706 Ga0466964_0002785 Ga0466964_0002785_4638_5258 199
85 3300044719 Ga0466971_0014263 Ga0466971_0014263_1298_1918 199
86 3300044735 Ga0466968_0003642 Ga0466968_0003642_4145_4765 199
87 3300044765 Ga0466970_0000245 Ga0466970_0000245_5461_6081 199
88 3300045049 Ga0466959_0002066 Ga0466959_0002066_4741_5361 199
89 3300045976 Ga0466967_0007139 Ga0466967_0007139_7291_7911 199
90 3300048905 Ga0496102_0317435 Ga0496102_0317435_405_1034 199
91 3300048906 Ga0496103_0101334 Ga0496103_0101334_128_757 199
92 3300048920 Ga0496117_0016841 Ga0496117_0016841_126_755 199
93 3300048921 Ga0496118_0001837 Ga0496118_0001837_25150_25779 199
94 3300048922 Ga0496119_0046025 Ga0496119_0046025_969_1598 199
95 3300048924 Ga0496121_0000009 Ga0496121_0000009_224082_224711 199
96 3300061719 Ga0466962_0005341 Ga0466962_0005341_4082_4702 199
97 3300002773 JGI25152J39213_1001984 JGI25152J39213_10019842 200
98 3300003771 Ga0055526_1001640 Ga0055526_100164010 200
99 3300005331 Ga0070670_100738519 Ga0070670_1007385192 200
100 3300005335 Ga0070666_10353687 Ga0070666_103536871 200
101 3300005344 Ga0070661_100439063 Ga0070661_1004390631 200
102 3300005530 Ga0070679_100400024 Ga0070679_1004000242 200
103 3300005535 Ga0070684_100131351 Ga0070684_1001313512 200
104 3300005548 Ga0070665_100648775 Ga0070665_1006487752 200
105 3300005578 Ga0068854_100642239 Ga0068854_1006422391 200
106 3300005614 Ga0068856_101013430 Ga0068856_1010134302 200
107 3300005617 Ga0068859_100473189 Ga0068859_1004731892 200
108 3300005834 Ga0068851_10397933 Ga0068851_103979331 200
109 3300005841 Ga0068863_100003739 Ga0068863_10000373916 200
110 3300005842 Ga0068858_100357531 Ga0068858_1003575312 200
111 3300006931 Ga0097620_100473175 Ga0097620_1004731752 200
112 3300009093 Ga0105240_10020847 Ga0105240_1002084711 200
113 3300009093 Ga0105240_10056199 Ga0105240_100561992 200
114 3300009093 Ga0105240_10532174 Ga0105240_105321742 200
115 3300009101 Ga0105247_10211973 Ga0105247_102119732 200
116 3300009174 Ga0105241_10046624 Ga0105241_100466244 200
117 3300009174 Ga0105241_10216007 Ga0105241_102160072 200
118 3300009177 Ga0105248_11228540 Ga0105248_112285401 200
119 3300009545 Ga0105237_10178182 Ga0105237_101781823 200
120 3300009551 Ga0105238_10072292 Ga0105238_100722923 200
121 3300009551 Ga0105238_10403079 Ga0105238_104030792 200
122 3300009551 Ga0105238_10689372 Ga0105238_106893722 200
123 3300009551 Ga0105238_11258381 Ga0105238_112583811 200
124 3300009553 Ga0105249_10173564 Ga0105249_101735643 200
125 3300009553 Ga0105249_10677470 Ga0105249_106774702 200
126 3300010375 Ga0105239_10072994 Ga0105239_100729942 200
127 3300010375 Ga0105239_10119244 Ga0105239_101192442 200
128 3300010375 Ga0105239_10349198 Ga0105239_103491982 200
129 3300013307 Ga0157372_10206306 Ga0157372_102063062 200
130 3300013308 Ga0157375_10243914 Ga0157375_102439141 200
131 3300014325 Ga0163163_10690438 Ga0163163_106904381 200
132 3300014968 Ga0157379_10339753 Ga0157379_103397531 200
133 3300014969 Ga0157376_10697352 Ga0157376_106973522 200
134 3300025900 Ga0207710_10103330 Ga0207710_101033302 200
135 3300025911 Ga0207654_10311249 Ga0207654_103112492 200
136 3300025912 Ga0207707_10005544 Ga0207707_1000554411 200
137 3300025913 Ga0207695_10142590 Ga0207695_101425902 200
138 3300025913 Ga0207695_10484745 Ga0207695_104847452 200
139 3300025914 Ga0207671_10040687 Ga0207671_100406874 200
140 3300025924 Ga0207694_10049184 Ga0207694_100491842 200
141 3300025924 Ga0207694_10820477 Ga0207694_108204771 200
142 3300025941 Ga0207711_10288433 Ga0207711_102884332 200
143 3300025961 Ga0207712_10415833 Ga0207712_104158331 200
144 3300025981 Ga0207640_10329485 Ga0207640_103294851 200
145 3300026035 Ga0207703_10035250 Ga0207703_100352505 200
146 3300026118 Ga0207675_100377240 Ga0207675_1003772402 200
147 3300028379 Ga0268266_10077971 Ga0268266_100779713 200
148 3300028380 Ga0268265_10006274 Ga0268265_100062742 200
149 3300028794 Ga0307515_10029601 Ga0307515_100296012 200
150 3300031249 Ga0265339_10192762 Ga0265339_101927621 200
151 3300031456 Ga0307513_10009669 Ga0307513_100096699 200
152 3300033180 Ga0307510_10000018 Ga0307510_1000001896 200
153 3300033180 Ga0307510_10014663 Ga0307510_100146637 200
154 3300035113 Ga0373936_0260976 Ga0373936_0260976_140_751 200
155 3300039437 Ga0436365_0320025 Ga0436365_0320025_65_679 200
156 3300044706 Ga0466964_0038659 Ga0466964_0038659_591_1238 200
157 3300044719 Ga0466971_0197258 Ga0466971_0197258_199_891 200
158 3300044765 Ga0466970_0233364 Ga0466970_0233364_73_765 200
159 3300045049 Ga0466959_0052994 Ga0466959_0052994_60_752 200
160 3300046507 Ga0495606_0106882 Ga0495606_0106882_91_714 200
161 3300046694 Ga0495649_0363402 Ga0495649_0363402_64_681 200
162 3300048903 Ga0496100_0491554 Ga0496100_0491554_46_663 200
163 3300048909 Ga0496106_0682458 Ga0496106_0682458_138_755 200
164 3300048915 Ga0496112_0363067 Ga0496112_0363067_235_849 200
165 3300048921 Ga0496118_0243343 Ga0496118_0243343_195_809 200
166 3300048922 Ga0496119_0002339 Ga0496119_0002339_7907_8524 200
167 3300048922 Ga0496119_0010201 Ga0496119_0010201_792_1409 200
168 3300048923 Ga0496120_0000014 Ga0496120_0000014_29636_30253 200
169 3300048923 Ga0496120_0047167 Ga0496120_0047167_880_1497 200
170 3300048924 Ga0496121_0115288 Ga0496121_0115288_1271_1888 200
171 3300048927 Ga0496124_0446277 Ga0496124_0446277_152_769 200
172 3300048928 Ga0496125_0005629 Ga0496125_0005629_206_820 200
173 3300048928 Ga0496125_0032400 Ga0496125_0032400_1516_2133 200
174 3300048929 Ga0496126_0190120 Ga0496126_0190120_677_1294 200
175 3300048929 Ga0496126_0311760 Ga0496126_0311760_470_1084 200
176 3300049581 Ga0501047_0022514 Ga0501047_0022514_5342_5980 200
177 3300045051 Ga0451576_0001138 Ga0451576_0001138_13849_14472 201
178 3300005367 Ga0070667_100167240 Ga0070667_1001672401 202
179 3300005843 Ga0068860_100004430 Ga0068860_10000443014 202
180 3300013105 Ga0157369_10136039 Ga0157369_101360391 202
181 3300026088 Ga0207641_10000470 Ga0207641_100004707 202
182 3300028381 Ga0268264_10000708 Ga0268264_100007085 202
183 3300039447 Ga0436361_0148623 Ga0436361_0148623_1276_1896 202
184 3300045976 Ga0466967_0017142 Ga0466967_0017142_204_827 202
185 3300046518 Ga0495631_0110918 Ga0495631_0110918_514_1152 202
186 iso_pu_bacteria 2596583598 2597031993 202
187 iso_pu_bacteria 2599185178 2599444113 202
188 iso_pu_bacteria 2900577576 2900579374 202
189 iso_pu_bacteria 2928058823 2928062335 202
190 3300046530 Ga0495654_0061970 Ga0495654_0061970_576_1208 203
191 3300048091 Ga0495626_0038677 Ga0495626_0038677_385_1017 203
192 3300025284 Ga0209130_1002672 Ga0209130_10026725 204
193 3300025291 Ga0209675_1000571 Ga0209675_10005715 204
194 3300025292 Ga0209676_1015997 Ga0209676_10159971 204
195 3300025294 Ga0209025_1035094 Ga0209025_10350943 204
196 3300025303 Ga0209051_1014067 Ga0209051_10140674 204
197 3300025303 Ga0209051_1021847 Ga0209051_10218473 204
198 3300046665 Ga0495661_0089819 Ga0495661_0089819_764_1399 204
199 iso_pu_bacteria 2643221654 2644303751 204
200 3300001915 JGI24741J21665_1001391 JGI24741J21665_10013913 205
201 3300001979 JGI24740J21852_10002451 JGI24740J21852_100024517 205
202 3300002705 JGI25156J39149_1009836 JGI25156J39149_10098363 205
203 3300003578 Ga0006562J51391_1193002 Ga0006562J51391_11930022 205
204 3300003752 Ga0055539_1000061 Ga0055539_100006194 205
205 3300003758 Ga0055532_1000042 Ga0055532_100004278 205
206 3300003759 Ga0055525_1000741 Ga0055525_10007413 205
207 3300003760 Ga0055527_1001264 Ga0055527_10012645 205
208 3300003761 Ga0055535_1000031 Ga0055535_1000031124 205
209 3300003763 Ga0055529_1000075 Ga0055529_100007578 205
210 3300003763 Ga0055529_1000098 Ga0055529_100009824 205
211 3300003841 Ga0055541_1002065 Ga0055541_10020655 205
212 3300005344 Ga0070661_100000455 Ga0070661_10000045531 205
213 3300005366 Ga0070659_100009159 Ga0070659_1000091596 205
214 3300005455 Ga0070663_100000044 Ga0070663_10000004459 205
215 3300005564 Ga0070664_100000092 Ga0070664_10000009262 205
216 3300005577 Ga0068857_100013185 Ga0068857_1000131856 205
217 3300005578 Ga0068854_100000176 Ga0068854_10000017643 205
218 3300005614 Ga0068856_100000261 Ga0068856_10000026162 205
219 3300009093 Ga0105240_10215560 Ga0105240_102155603 205
220 3300013100 Ga0157373_10010772 Ga0157373_100107726 205
221 3300013102 Ga0157371_10000362 Ga0157371_1000036262 205
222 3300013104 Ga0157370_10000766 Ga0157370_1000076625 205
223 3300013105 Ga0157369_10015046 Ga0157369_100150462 205
224 3300013307 Ga0157372_10000269 Ga0157372_1000026964 205
225 3300014497 Ga0182008_10014304 Ga0182008_100143045 205
226 3300015261 Ga0182006_1003108 Ga0182006_10031084 205
227 3300015261 Ga0182006_1005995 Ga0182006_10059956 205
228 3300015262 Ga0182007_10108196 Ga0182007_101081962 205
229 3300020077 Ga0206351_10901382 Ga0206351_109013825 205
230 3300020610 Ga0154015_1153690 Ga0154015_11536908 205
231 3300022467 Ga0224712_10109788 Ga0224712_101097882 205
232 3300025224 Ga0209784_100003 Ga0209784_1000031306 205
233 3300025225 Ga0209566_100002 Ga0209566_1000022260 205
234 3300025225 Ga0209566_101382 Ga0209566_1013823 205
235 3300025226 Ga0209674_100094 Ga0209674_10009477 205
236 3300025228 Ga0209672_100096 Ga0209672_10009646 205
237 3300025229 Ga0209147_100002 Ga0209147_1000021014 205
238 3300025230 Ga0209563_100004 Ga0209563_1000041677 205
239 3300025242 Ga0209258_100002 Ga0209258_1000021014 205
240 3300025253 Ga0209677_100071 Ga0209677_10007147 205
241 3300025254 Ga0209148_1004006 Ga0209148_10040065 205
242 3300025272 Ga0209455_1000009 Ga0209455_1000009895 205
243 3300025913 Ga0207695_10008005 Ga0207695_100080054 205
244 3300025920 Ga0207649_10002855 Ga0207649_100028557 205
245 3300025945 Ga0207679_10000341 Ga0207679_100003418 205
246 3300025981 Ga0207640_10000049 Ga0207640_1000004993 205
247 3300026067 Ga0207678_10000148 Ga0207678_100001487 205
248 3300026078 Ga0207702_10000296 Ga0207702_1000029662 205
249 3300026116 Ga0207674_10001491 Ga0207674_100014916 205
250 3300026142 Ga0207698_10117157 Ga0207698_101171572 205
251 3300037418 Ga0395900_0027154 Ga0395900_0027154_4429_5070 205
252 3300042876 Ga0451577_0000303 Ga0451577_0000303_26914_27552 205
253 3300044650 Ga0466986_0083669 Ga0466986_0083669_475_1116 205
254 3300044712 Ga0453684_0000947 Ga0453684_0000947_68289_68927 205
255 3300045976 Ga0466967_0047195 Ga0466967_0047195_2170_2811 205
256 3300046460 Ga0495638_0025263 Ga0495638_0025263_2647_3285 205
257 3300048921 Ga0496118_0114317 Ga0496118_0114317_1114_1755 205
258 3300048928 Ga0496125_0006533 Ga0496125_0006533_6317_6958 205
259 3300049570 Ga0501033_0012432 Ga0501033_0012432_478_1131 205
260 3300049581 Ga0501047_0053213 Ga0501047_0053213_2474_3127 205
261 3300049822 Ga0501035_0623845 Ga0501035_0623845_195_848 205
262 iso_pu_bacteria 2600255292 2601670882 205
263 iso_pu_bacteria 2842733646 2842737928 205
264 iso_pu_bacteria 2857547612 2857547655 205
265 3300021361 Ga0213872_10138490 Ga0213872_101384902 207
266 3300028794 Ga0307515_10030036 Ga0307515_100300364 207
267 3300031730 Ga0307516_10000506 Ga0307516_1000050625 207
268 3300039447 Ga0436361_0866882 Ga0436361_0866882_5361_6011 207
269 3300044712 Ga0453684_0212940 Ga0453684_0212940_1330_1974 207
270 3300049822 Ga0501035_0017849 Ga0501035_0017849_2139_2795 207
271 3300002738 JGI25154J39366_1000981 JGI25154J39366_100098110 208
272 3300003215 JGI25153J46596_10005959 JGI25153J46596_100059593 208
273 3300003756 Ga0055533_1012758 Ga0055533_10127581 208
274 3300003775 Ga0055524_1011390 Ga0055524_10113902 208
275 3300003841 Ga0055541_1000186 Ga0055541_100018625 208
276 3300005459 Ga0068867_100395583 Ga0068867_1003955831 208
277 3300006353 Ga0075370_10144369 Ga0075370_101443692 208
278 3300006948 Ga0099826_10000009 Ga0099826_10000009255 208
279 3300009011 Ga0105251_10063900 Ga0105251_100639002 208
280 3300014497 Ga0182008_10000671 Ga0182008_100006714 208
281 3300014497 Ga0182008_10330798 Ga0182008_103307981 208
282 3300015261 Ga0182006_1000075 Ga0182006_100007546 208
283 3300015262 Ga0182007_10000135 Ga0182007_1000013544 208
284 3300015265 Ga0182005_1000106 Ga0182005_100010644 208
285 3300017792 Ga0163161_10066663 Ga0163161_100666631 208
286 3300021361 Ga0213872_10030306 Ga0213872_100303063 208
287 3300021361 Ga0213872_10036837 Ga0213872_100368372 208
288 3300025258 Ga0209129_1000041 Ga0209129_1000041221 208
289 3300025263 Ga0209565_1008034 Ga0209565_10080341 208
290 3300025291 Ga0209675_1002072 Ga0209675_10020727 208
291 3300025294 Ga0209025_1003086 Ga0209025_100308612 208
292 3300025295 Ga0209564_1000029 Ga0209564_1000029367 208
293 3300025297 Ga0209758_1000043 Ga0209758_100004373 208
294 3300025299 Ga0209256_1001784 Ga0209256_10017845 208
295 3300025735 Ga0207713_1090817 Ga0207713_10908172 208
296 3300026089 Ga0207648_10476876 Ga0207648_104768761 208
297 3300027666 Ga0209282_1000017 Ga0209282_1000017160 208
298 3300027876 Ga0209974_10005261 Ga0209974_100052613 208
299 3300030522 Ga0307512_10088951 Ga0307512_100889512 208
300 3300031456 Ga0307513_10129626 Ga0307513_101296263 208
301 3300031507 Ga0307509_10020057 Ga0307509_100200574 208
302 3300031730 Ga0307516_10106294 Ga0307516_101062942 208
303 3300033180 Ga0307510_10085989 Ga0307510_100859893 208
304 3300039447 Ga0436361_0417851 Ga0436361_0417851_626_1282 208
305 3300039447 Ga0436361_1128746 Ga0436361_1128746_3952_4593 208
306 3300039447 Ga0436361_1139319 Ga0436361_1139319_1993_2664 208
307 3300044683 Ga0466965_0047733 Ga0466965_0047733_1307_1969 208
308 3300044684 Ga0466966_0002396 Ga0466966_0002396_11524_12186 208
309 3300044693 Ga0466961_0322134 Ga0466961_0322134_25_687 208
310 3300044706 Ga0466964_0002154 Ga0466964_0002154_5906_6568 208
311 3300044719 Ga0466971_0002021 Ga0466971_0002021_5176_5838 208
312 3300044735 Ga0466968_0049098 Ga0466968_0049098_159_821 208
313 3300044765 Ga0466970_0024951 Ga0466970_0024951_356_1006 208
314 3300044765 Ga0466970_0028940 Ga0466970_0028940_1465_2127 208
315 3300044842 Ga0466957_0006923 Ga0466957_0006923_1909_2571 208
316 3300045049 Ga0466959_0004039 Ga0466959_0004039_2659_3309 208
317 3300045049 Ga0466959_0021294 Ga0466959_0021294_1256_1918 208
318 3300045051 Ga0451576_0015269 Ga0451576_0015269_5718_6446 208
319 3300046474 Ga0495605_0007559 Ga0495605_0007559_4692_5348 208
320 3300046491 Ga0495584_0064242 Ga0495584_0064242_537_1193 208
321 3300046500 Ga0495596_0000255 Ga0495596_0000255_8182_8838 208
322 3300046501 Ga0495607_0002536 Ga0495607_0002536_7917_8573 208
323 3300046507 Ga0495606_0089768 Ga0495606_0089768_880_1536 208
324 3300046512 Ga0495610_0000200 Ga0495610_0000200_8248_8904 208
325 3300046513 Ga0495616_0002056 Ga0495616_0002056_4378_5034 208
326 3300046524 Ga0495648_0021843 Ga0495648_0021843_3516_4172 208
327 3300046538 Ga0495609_0001548 Ga0495609_0001548_8026_8682 208
328 3300046558 Ga0495633_0000681 Ga0495633_0000681_23794_24441 208
329 3300046664 Ga0495659_0065367 Ga0495659_0065367_299_949 208
330 3300046665 Ga0495661_0007296 Ga0495661_0007296_3423_4079 208
331 3300046691 Ga0495670_0019812 Ga0495670_0019812_891_1547 208
332 3300046692 Ga0495671_0001605 Ga0495671_0001605_7776_8432 208
333 3300046694 Ga0495649_0004818 Ga0495649_0004818_1232_1888 208
334 3300047320 Ga0495672_0014302 Ga0495672_0014302_3596_4252 208
335 3300048919 Ga0496116_0005398 Ga0496116_0005398_4916_5572 208
336 3300048919 Ga0496116_0020560 Ga0496116_0020560_64_711 208
337 3300048920 Ga0496117_0000001 Ga0496117_0000001_2128422_2129069 208
338 3300048921 Ga0496118_0000008 Ga0496118_0000008_246715_247362 208
339 3300048924 Ga0496121_0006919 Ga0496121_0006919_3795_4442 208
340 3300048924 Ga0496121_0009923 Ga0496121_0009923_1589_2245 208
341 3300048925 Ga0496122_0001150 Ga0496122_0001150_30700_31347 208
342 3300048925 Ga0496122_0005636 Ga0496122_0005636_7836_8492 208
343 3300048926 Ga0496123_0000466 Ga0496123_0000466_7791_8447 208
344 3300048926 Ga0496123_0001208 Ga0496123_0001208_25038_25685 208
345 3300048929 Ga0496126_0348011 Ga0496126_0348011_526_1182 208
346 3300049460 Ga0495682_0002813 Ga0495682_0002813_2719_3366 208
347 3300046557 Ga0495622_0106531 Ga0495622_0106531_98_748 209
348 3300046542 Ga0495597_0001204 Ga0495597_0001204_2964_3602 212
349 2162886007 SwRhRL2b_contig_3294069 SwRhRL2b_0563.00002840 217
350 3300005289 Ga0065704_10125258 Ga0065704_101252581 217
351 3300048925 Ga0496122_0012327 Ga0496122_0012327_151_804 217
352 3300048926 Ga0496123_0082169 Ga0496123_0082169_1054_1707 217
353 3300048927 Ga0496124_0062525 Ga0496124_0062525_45_698 217
354 3300048928 Ga0496125_0005098 Ga0496125_0005098_5233_5886 217
355 3300048929 Ga0496126_0017481 Ga0496126_0017481_4877_5530 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

49

238

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w4s-assembly1.cif.gz_F structure of apo human ferroportin in lipid nanodisc 0.4666 5 217
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4651 10 214
7lo7-assembly1.cif.gz_Z nora in complex with fab25 0.4451 18 214
7xq2-assembly1.cif.gz_A structure of hslc19a1+2'3'-cgamp 0.4412 9 215
4iu9-assembly2.cif.gz_A crystal structure of a membrane transporter 0.4378 12 208
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6837 32 208 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6658 32 208 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5322 19 204 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5234 19 204 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5001 14 217 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A172YK65-F1-model_v4 Lysine transporter LysE 0.9413 11 211 GO:0005886
GO:0015171
AF-A0A562PKS8-F1-model_v4 L-lysine exporter family protein LysE/ArgO 0.9333 10 210 GO:0005886
GO:0015171
AF-A0A077FJK8-F1-model_v4 Arginine exporter protein ArgO 0.9323 13 212 GO:0005886
GO:0015171
AF-A0A172YK65-F1-model_v4 Lysine transporter LysE 0.9323 11 211 GO:0005886
GO:0015171
AF-A0A6M8B2Z9-F1-model_v4 LysE family transporter 0.9292 9 211 GO:0005886
GO:0015171

Feature Viewer

pLDDT pTM Quality
79.39 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map