F420238
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 355 | 209 | 343 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0015269|Ga0451576_0015269_5718_6446 |
| Length | 242 |
| Sequence | LLWGVQFFFDPDKKARGVCLPPRCWGKLGGMNDTPLFFPTFAQGMALSLGLIVAIGAQNAFVLRQGLRREHVGTVVAFCALADAVLISAGVLGMAQALGDRPLLARALALAGAGFLALYGWQALGRARQSHQLRADLGAPGLSRPAALAQAAAFTLLNPHVYLDTVMLVGSIGAQQPVALRGWFVAGACTASLMWFTSLGFGARWLAPWFARPRAWQVLDALIGVTMWVLAALLVHHAWAGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 3 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 4 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 5 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 6 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 7 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 8 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 9 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 10 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 11 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 12 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 13 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 128 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 133 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 134 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 136 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 137 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 138 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 139 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 142 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 143 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 144 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 145 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 146 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 147 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 156 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 191 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 192 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 193 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 194 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 197 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 198 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 199 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 200 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 201 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 208 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 209 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.21 |
| Metatranscriptomes | 1.41 |
| Isolates | 3.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.31 |
| Nodule | 0.56 |
| Rhizoplane | 2.25 |
| Rhizosphere | 58.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3294069 | 2162886007 | Bacteria | 855 |
| 2 | JGI24741J21665_1001391 | 3300001915 | Bacteria | 6961 |
| 3 | JGI24740J21852_10000175 | 3300001979 | Bacteria | 25721 |
| 4 | JGI24740J21852_10002451 | 3300001979 | Bacteria | 8412 |
| 5 | JGI24740J21852_10006072 | 3300001979 | Bacteria | 5047 |
| 6 | JGI25156J39149_1009836 | 3300002705 | Bacteria | 2293 |
| 7 | JGI25154J39366_1000981 | 3300002738 | Bacteria | 11610 |
| 8 | JGI25152J39213_1001984 | 3300002773 | Bacteria | 8088 |
| 9 | JGI25151J46595_10000545 | 3300003187 | Bacteria | 34695 |
| 10 | JGI25151J46595_10022484 | 3300003187 | Bacteria | 2617 |
| 11 | JGI25153J46596_10005959 | 3300003215 | Bacteria | 6274 |
| 12 | Ga0006562J51391_1193001 | 3300003578 | Bacteria | 2030 |
| 13 | Ga0006562J51391_1193002 | 3300003578 | Bacteria | 1490 |
| 14 | Ga0055539_1000061 | 3300003752 | Bacteria | 144457 |
| 15 | Ga0055533_1012758 | 3300003756 | Bacteria | 877 |
| 16 | Ga0055532_1000042 | 3300003758 | Bacteria | 195195 |
| 17 | Ga0055525_1000741 | 3300003759 | Bacteria | 11140 |
| 18 | Ga0055527_1001264 | 3300003760 | Bacteria | 5559 |
| 19 | Ga0055535_1000031 | 3300003761 | Bacteria | 195195 |
| 20 | Ga0055529_1000075 | 3300003763 | Bacteria | 156291 |
| 21 | Ga0055529_1000098 | 3300003763 | Bacteria | 131900 |
| 22 | Ga0055526_1001640 | 3300003771 | Bacteria | 15723 |
| 23 | Ga0055526_1001725 | 3300003771 | Bacteria | 15211 |
| 24 | Ga0055526_1005507 | 3300003771 | Bacteria | 7255 |
| 25 | Ga0055524_1004746 | 3300003775 | Bacteria | 6215 |
| 26 | Ga0055524_1011390 | 3300003775 | Bacteria | 3483 |
| 27 | Ga0055536_1000501 | 3300003781 | Bacteria | 27098 |
| 28 | Ga0055534_1000777 | 3300003784 | Bacteria | 14972 |
| 29 | Ga0055534_1001007 | 3300003784 | Bacteria | 12394 |
| 30 | Ga0055541_1000186 | 3300003841 | Bacteria | 28517 |
| 31 | Ga0055541_1002065 | 3300003841 | Bacteria | 4108 |
| 32 | Ga0065704_10125258 | 3300005289 | Bacteria | 1706 |
| 33 | Ga0070670_100738519 | 3300005331 | Bacteria | 887 |
| 34 | Ga0070666_10353687 | 3300005335 | Bacteria | 1051 |
| 35 | Ga0070661_100000455 | 3300005344 | Bacteria | 31227 |
| 36 | Ga0070661_100439063 | 3300005344 | Bacteria | 1037 |
| 37 | Ga0070659_100009159 | 3300005366 | Bacteria | 7263 |
| 38 | Ga0070667_100167240 | 3300005367 | Bacteria | 1940 |
| 39 | Ga0070663_100000044 | 3300005455 | Bacteria | 57555 |
| 40 | Ga0068867_100395583 | 3300005459 | Bacteria | 1164 |
| 41 | Ga0070679_100400024 | 3300005530 | Bacteria | 1319 |
| 42 | Ga0070684_100131351 | 3300005535 | Bacteria | 2259 |
| 43 | Ga0070665_100005597 | 3300005548 | Bacteria | 12915 |
| 44 | Ga0070665_100648775 | 3300005548 | Bacteria | 1069 |
| 45 | Ga0070664_100000092 | 3300005564 | Bacteria | 57555 |
| 46 | Ga0068857_100013185 | 3300005577 | Bacteria | 7204 |
| 47 | Ga0068854_100000176 | 3300005578 | Bacteria | 43579 |
| 48 | Ga0068854_100642239 | 3300005578 | Bacteria | 910 |
| 49 | Ga0068856_100000261 | 3300005614 | Bacteria | 57555 |
| 50 | Ga0068856_101013430 | 3300005614 | Bacteria | 848 |
| 51 | Ga0068859_100473189 | 3300005617 | Bacteria | 1348 |
| 52 | Ga0068851_10397933 | 3300005834 | Bacteria | 810 |
| 53 | Ga0068863_100003739 | 3300005841 | Bacteria | 15051 |
| 54 | Ga0068858_100357531 | 3300005842 | Bacteria | 1399 |
| 55 | Ga0068860_100004430 | 3300005843 | Bacteria | 14338 |
| 56 | Ga0075370_10144369 | 3300006353 | Bacteria | 1392 |
| 57 | Ga0097620_100473175 | 3300006931 | Bacteria | 1348 |
| 58 | Ga0099826_10000009 | 3300006948 | Bacteria | 336081 |
| 59 | Ga0105251_10063900 | 3300009011 | Bacteria | 1726 |
| 60 | Ga0105240_10020847 | 3300009093 | Bacteria | 8730 |
| 61 | Ga0105240_10056199 | 3300009093 | Bacteria | 4925 |
| 62 | Ga0105240_10215560 | 3300009093 | Bacteria | 2240 |
| 63 | Ga0105240_10532174 | 3300009093 | Bacteria | 1303 |
| 64 | Ga0105247_10211973 | 3300009101 | Bacteria | 1307 |
| 65 | Ga0105241_10046624 | 3300009174 | Bacteria | 3292 |
| 66 | Ga0105241_10216007 | 3300009174 | Bacteria | 1609 |
| 67 | Ga0105248_10039956 | 3300009177 | Bacteria | 5259 |
| 68 | Ga0105248_11228540 | 3300009177 | Bacteria | 847 |
| 69 | Ga0105237_10178182 | 3300009545 | Bacteria | 2126 |
| 70 | Ga0105238_10072292 | 3300009551 | Bacteria | 3445 |
| 71 | Ga0105238_10403079 | 3300009551 | Bacteria | 1361 |
| 72 | Ga0105238_10689372 | 3300009551 | Bacteria | 1033 |
| 73 | Ga0105238_11258381 | 3300009551 | Bacteria | 765 |
| 74 | Ga0105249_10173564 | 3300009553 | Bacteria | 2092 |
| 75 | Ga0105249_10677470 | 3300009553 | Bacteria | 1090 |
| 76 | Ga0105239_10072994 | 3300010375 | Bacteria | 3773 |
| 77 | Ga0105239_10119244 | 3300010375 | Bacteria | 2928 |
| 78 | Ga0105239_10349198 | 3300010375 | Bacteria | 1670 |
| 79 | Ga0105239_10392330 | 3300010375 | Bacteria | 1570 |
| 80 | Ga0157373_10010772 | 3300013100 | Bacteria | 6729 |
| 81 | Ga0157371_10000362 | 3300013102 | Bacteria | 57561 |
| 82 | Ga0157371_10070673 | 3300013102 | Bacteria | 2471 |
| 83 | Ga0157370_10000766 | 3300013104 | Bacteria | 40226 |
| 84 | Ga0157369_10015046 | 3300013105 | Bacteria | 8731 |
| 85 | Ga0157369_10136039 | 3300013105 | Bacteria | 2602 |
| 86 | Ga0157372_10000269 | 3300013307 | Bacteria | 57561 |
| 87 | Ga0157372_10206306 | 3300013307 | Bacteria | 2277 |
| 88 | Ga0157375_10243914 | 3300013308 | Bacteria | 1956 |
| 89 | Ga0163163_10690438 | 3300014325 | Bacteria | 1084 |
| 90 | Ga0182008_10000671 | 3300014497 | Bacteria | 24825 |
| 91 | Ga0182008_10014304 | 3300014497 | Bacteria | 4158 |
| 92 | Ga0182008_10330798 | 3300014497 | Bacteria | 804 |
| 93 | Ga0157379_10339753 | 3300014968 | Bacteria | 1373 |
| 94 | Ga0157376_10697352 | 3300014969 | Bacteria | 1020 |
| 95 | Ga0182006_1000075 | 3300015261 | Bacteria | 130239 |
| 96 | Ga0182006_1003108 | 3300015261 | Bacteria | 8704 |
| 97 | Ga0182006_1005995 | 3300015261 | Bacteria | 5700 |
| 98 | Ga0182007_10000135 | 3300015262 | Bacteria | 51737 |
| 99 | Ga0182007_10108196 | 3300015262 | Bacteria | 924 |
| 100 | Ga0182005_1000106 | 3300015265 | Bacteria | 63464 |
| 101 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 102 | Ga0163161_10066663 | 3300017792 | Bacteria | 2629 |
| 103 | Ga0206351_10901382 | 3300020077 | Bacteria | 2174 |
| 104 | Ga0154015_1153690 | 3300020610 | Bacteria | 31263 |
| 105 | Ga0213872_10000639 | 3300021361 | Bacteria | 26467 |
| 106 | Ga0213872_10001941 | 3300021361 | Bacteria | 12635 |
| 107 | Ga0213872_10017759 | 3300021361 | Bacteria | 3285 |
| 108 | Ga0213872_10030306 | 3300021361 | Bacteria | 2480 |
| 109 | Ga0213872_10036837 | 3300021361 | Bacteria | 2234 |
| 110 | Ga0213872_10040350 | 3300021361 | Bacteria | 2131 |
| 111 | Ga0213872_10082509 | 3300021361 | Bacteria | 1443 |
| 112 | Ga0213872_10138490 | 3300021361 | Bacteria | 1069 |
| 113 | Ga0213872_10185234 | 3300021361 | Bacteria | 898 |
| 114 | Ga0224712_10109788 | 3300022467 | Bacteria | 1181 |
| 115 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 116 | Ga0209784_100245 | 3300025224 | Bacteria | 34658 |
| 117 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 118 | Ga0209566_100330 | 3300025225 | Bacteria | 42404 |
| 119 | Ga0209566_101382 | 3300025225 | Bacteria | 7502 |
| 120 | Ga0209674_100094 | 3300025226 | Bacteria | 169506 |
| 121 | Ga0209674_100160 | 3300025226 | Bacteria | 88210 |
| 122 | Ga0209672_100096 | 3300025228 | Bacteria | 112947 |
| 123 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 124 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 125 | Ga0209563_111133 | 3300025230 | Bacteria | 1282 |
| 126 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 127 | Ga0209646_1000019 | 3300025246 | Bacteria | 475248 |
| 128 | Ga0209026_1001332 | 3300025250 | Bacteria | 11070 |
| 129 | Ga0209677_100071 | 3300025253 | Bacteria | 139425 |
| 130 | Ga0209677_106554 | 3300025253 | Bacteria | 2727 |
| 131 | Ga0209148_1000118 | 3300025254 | Bacteria | 188330 |
| 132 | Ga0209148_1004006 | 3300025254 | Bacteria | 3768 |
| 133 | Ga0209759_1004169 | 3300025256 | Bacteria | 5495 |
| 134 | Ga0209129_1000041 | 3300025258 | Bacteria | 307590 |
| 135 | Ga0209565_1000086 | 3300025263 | Bacteria | 152204 |
| 136 | Ga0209565_1008034 | 3300025263 | Bacteria | 2791 |
| 137 | Ga0209455_1000009 | 3300025272 | Bacteria | 1042273 |
| 138 | Ga0209130_1002672 | 3300025284 | Bacteria | 8504 |
| 139 | Ga0209675_1000050 | 3300025291 | Bacteria | 212222 |
| 140 | Ga0209675_1000571 | 3300025291 | Bacteria | 26587 |
| 141 | Ga0209675_1001661 | 3300025291 | Bacteria | 12382 |
| 142 | Ga0209675_1002072 | 3300025291 | Bacteria | 10658 |
| 143 | Ga0209676_1000053 | 3300025292 | Bacteria | 370111 |
| 144 | Ga0209676_1015997 | 3300025292 | Bacteria | 2732 |
| 145 | Ga0209025_1000059 | 3300025294 | Bacteria | 305480 |
| 146 | Ga0209025_1000093 | 3300025294 | Bacteria | 241788 |
| 147 | Ga0209025_1003086 | 3300025294 | Bacteria | 16345 |
| 148 | Ga0209025_1035094 | 3300025294 | Bacteria | 2273 |
| 149 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 150 | Ga0209564_1000158 | 3300025295 | Bacteria | 164425 |
| 151 | Ga0209564_1000224 | 3300025295 | Bacteria | 126345 |
| 152 | Ga0209564_1001285 | 3300025295 | Bacteria | 27486 |
| 153 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 154 | Ga0209758_1010250 | 3300025297 | Bacteria | 5643 |
| 155 | Ga0209256_1001784 | 3300025299 | Bacteria | 20378 |
| 156 | Ga0209256_1003909 | 3300025299 | Bacteria | 9850 |
| 157 | Ga0209051_1014067 | 3300025303 | Bacteria | 3756 |
| 158 | Ga0209051_1021847 | 3300025303 | Bacteria | 2709 |
| 159 | Ga0207713_1090817 | 3300025735 | Bacteria | 1073 |
| 160 | Ga0207710_10103330 | 3300025900 | Bacteria | 1346 |
| 161 | Ga0207654_10311249 | 3300025911 | Bacteria | 1074 |
| 162 | Ga0207707_10005544 | 3300025912 | Bacteria | 11034 |
| 163 | Ga0207695_10008005 | 3300025913 | Bacteria | 13311 |
| 164 | Ga0207695_10142590 | 3300025913 | Bacteria | 2343 |
| 165 | Ga0207695_10484745 | 3300025913 | Bacteria | 1119 |
| 166 | Ga0207671_10040687 | 3300025914 | Bacteria | 3440 |
| 167 | Ga0207649_10002855 | 3300025920 | Bacteria | 9534 |
| 168 | Ga0207694_10049184 | 3300025924 | Bacteria | 3263 |
| 169 | Ga0207694_10820477 | 3300025924 | Bacteria | 786 |
| 170 | Ga0207711_10002351 | 3300025941 | Bacteria | 16947 |
| 171 | Ga0207711_10288433 | 3300025941 | Bacteria | 1512 |
| 172 | Ga0207679_10000341 | 3300025945 | Bacteria | 34009 |
| 173 | Ga0207712_10415833 | 3300025961 | Bacteria | 1133 |
| 174 | Ga0207640_10000049 | 3300025981 | Bacteria | 97025 |
| 175 | Ga0207640_10329485 | 3300025981 | Bacteria | 1219 |
| 176 | Ga0207703_10035250 | 3300026035 | Bacteria | 3976 |
| 177 | Ga0207678_10000148 | 3300026067 | Bacteria | 57513 |
| 178 | Ga0207702_10000296 | 3300026078 | Bacteria | 57562 |
| 179 | Ga0207641_10000470 | 3300026088 | Bacteria | 45563 |
| 180 | Ga0207648_10476876 | 3300026089 | Bacteria | 1139 |
| 181 | Ga0207674_10001491 | 3300026116 | Bacteria | 30227 |
| 182 | Ga0207675_100377240 | 3300026118 | Bacteria | 1394 |
| 183 | Ga0207698_10117157 | 3300026142 | Bacteria | 2246 |
| 184 | Ga0209282_1000017 | 3300027666 | Bacteria | 191482 |
| 185 | Ga0209974_10005261 | 3300027876 | Bacteria | 4566 |
| 186 | Ga0268266_10011990 | 3300028379 | Bacteria | 7504 |
| 187 | Ga0268266_10077971 | 3300028379 | Bacteria | 2882 |
| 188 | Ga0268265_10006274 | 3300028380 | Bacteria | 8053 |
| 189 | Ga0268264_10000708 | 3300028381 | Bacteria | 38439 |
| 190 | Ga0307515_10029601 | 3300028794 | Bacteria | 9245 |
| 191 | Ga0307515_10030036 | 3300028794 | Bacteria | 9153 |
| 192 | Ga0307512_10088951 | 3300030522 | Bacteria | 2163 |
| 193 | Ga0265339_10192762 | 3300031249 | Bacteria | 1009 |
| 194 | Ga0307513_10009669 | 3300031456 | Bacteria | 12179 |
| 195 | Ga0307513_10048651 | 3300031456 | Bacteria | 4600 |
| 196 | Ga0307513_10129626 | 3300031456 | Bacteria | 2470 |
| 197 | Ga0307509_10020057 | 3300031507 | Bacteria | 7598 |
| 198 | Ga0307516_10000506 | 3300031730 | Bacteria | 51918 |
| 199 | Ga0307516_10106294 | 3300031730 | Bacteria | 2617 |
| 200 | Ga0307510_10000018 | 3300033180 | Bacteria | 192986 |
| 201 | Ga0307510_10014663 | 3300033180 | Bacteria | 9277 |
| 202 | Ga0307510_10085989 | 3300033180 | Bacteria | 3018 |
| 203 | Ga0373936_0260976 | 3300035113 | Bacteria | 775 |
| 204 | Ga0395900_0027154 | 3300037418 | Bacteria | 5861 |
| 205 | Ga0436365_0320025 | 3300039437 | Bacteria | 1106 |
| 206 | Ga0436361_0007544 | 3300039447 | Bacteria | 2395 |
| 207 | Ga0436361_0019682 | 3300039447 | Bacteria | 41674 |
| 208 | Ga0436361_0021782 | 3300039447 | Bacteria | 5000 |
| 209 | Ga0436361_0025162 | 3300039447 | Bacteria | 4979 |
| 210 | Ga0436361_0038009 | 3300039447 | Bacteria | 4381 |
| 211 | Ga0436361_0148623 | 3300039447 | Bacteria | 2157 |
| 212 | Ga0436361_0213108 | 3300039447 | Bacteria | 2008 |
| 213 | Ga0436361_0333091 | 3300039447 | Bacteria | 2456 |
| 214 | Ga0436361_0417851 | 3300039447 | Bacteria | 1371 |
| 215 | Ga0436361_0780096 | 3300039447 | Bacteria | 938 |
| 216 | Ga0436361_0866882 | 3300039447 | Bacteria | 7359 |
| 217 | Ga0436361_1007985 | 3300039447 | Bacteria | 1229 |
| 218 | Ga0436361_1115311 | 3300039447 | Bacteria | 1259 |
| 219 | Ga0436361_1128746 | 3300039447 | Bacteria | 5098 |
| 220 | Ga0436361_1139319 | 3300039447 | Bacteria | 3171 |
| 221 | Ga0451577_0000303 | 3300042876 | Bacteria | 95840 |
| 222 | Ga0466986_0083669 | 3300044650 | Bacteria | 2208 |
| 223 | Ga0466972_0000217 | 3300044658 | Bacteria | 40421 |
| 224 | Ga0466978_0002795 | 3300044671 | Bacteria | 7722 |
| 225 | Ga0466982_0020506 | 3300044672 | Bacteria | 3758 |
| 226 | Ga0466965_0047733 | 3300044683 | Bacteria | 2120 |
| 227 | Ga0466965_0136983 | 3300044683 | Bacteria | 1272 |
| 228 | Ga0466966_0002396 | 3300044684 | Bacteria | 12243 |
| 229 | Ga0466961_0000078 | 3300044693 | Bacteria | 60385 |
| 230 | Ga0466961_0322134 | 3300044693 | Bacteria | 942 |
| 231 | Ga0466963_0096179 | 3300044694 | Bacteria | 2023 |
| 232 | Ga0466964_0002154 | 3300044706 | Bacteria | 6952 |
| 233 | Ga0466964_0002785 | 3300044706 | Bacteria | 6286 |
| 234 | Ga0466964_0038659 | 3300044706 | Bacteria | 1919 |
| 235 | Ga0453684_0000947 | 3300044712 | Bacteria | 95768 |
| 236 | Ga0453684_0212940 | 3300044712 | Bacteria | 2245 |
| 237 | Ga0466971_0002021 | 3300044719 | Bacteria | 8583 |
| 238 | Ga0466971_0014263 | 3300044719 | Bacteria | 3494 |
| 239 | Ga0466971_0197258 | 3300044719 | Bacteria | 949 |
| 240 | Ga0466968_0003642 | 3300044735 | Bacteria | 5712 |
| 241 | Ga0466968_0049098 | 3300044735 | Bacteria | 1797 |
| 242 | Ga0466970_0000245 | 3300044765 | Bacteria | 26613 |
| 243 | Ga0466970_0024951 | 3300044765 | Bacteria | 3128 |
| 244 | Ga0466970_0028940 | 3300044765 | Bacteria | 2914 |
| 245 | Ga0466970_0233364 | 3300044765 | Bacteria | 1028 |
| 246 | Ga0466957_0006923 | 3300044842 | Bacteria | 6409 |
| 247 | Ga0466957_0011126 | 3300044842 | Bacteria | 5182 |
| 248 | Ga0466959_0002066 | 3300045049 | Bacteria | 12700 |
| 249 | Ga0466959_0004039 | 3300045049 | Bacteria | 9760 |
| 250 | Ga0466959_0021294 | 3300045049 | Bacteria | 4780 |
| 251 | Ga0466959_0052994 | 3300045049 | Bacteria | 2968 |
| 252 | Ga0451576_0001138 | 3300045051 | Bacteria | 48072 |
| 253 | Ga0451576_0015269 | 3300045051 | Bacteria | 8513 |
| 254 | Ga0466958_0062922 | 3300045836 | Bacteria | 2262 |
| 255 | Ga0466958_0125338 | 3300045836 | Bacteria | 1610 |
| 256 | Ga0466967_0007139 | 3300045976 | Bacteria | 8017 |
| 257 | Ga0466967_0017142 | 3300045976 | Bacteria | 5739 |
| 258 | Ga0466967_0047195 | 3300045976 | Bacteria | 3754 |
| 259 | Ga0495638_0000069 | 3300046460 | Bacteria | 167503 |
| 260 | Ga0495638_0025263 | 3300046460 | Bacteria | 3864 |
| 261 | Ga0495650_0002641 | 3300046471 | Bacteria | 14014 |
| 262 | Ga0495605_0007559 | 3300046474 | Bacteria | 6162 |
| 263 | Ga0495584_0064242 | 3300046491 | Bacteria | 1845 |
| 264 | Ga0495596_0000255 | 3300046500 | Bacteria | 35643 |
| 265 | Ga0495607_0002536 | 3300046501 | Bacteria | 14777 |
| 266 | Ga0495606_0089768 | 3300046507 | Bacteria | 1893 |
| 267 | Ga0495606_0106882 | 3300046507 | Bacteria | 1694 |
| 268 | Ga0495610_0000200 | 3300046512 | Bacteria | 67114 |
| 269 | Ga0495616_0002056 | 3300046513 | Bacteria | 13520 |
| 270 | Ga0495631_0110918 | 3300046518 | Bacteria | 1180 |
| 271 | Ga0495648_0021843 | 3300046524 | Bacteria | 4421 |
| 272 | Ga0495654_0061970 | 3300046530 | Bacteria | 1794 |
| 273 | Ga0495609_0001548 | 3300046538 | Bacteria | 15066 |
| 274 | Ga0495597_0001204 | 3300046542 | Bacteria | 19351 |
| 275 | Ga0495622_0106531 | 3300046557 | Bacteria | 1284 |
| 276 | Ga0495622_0168687 | 3300046557 | Bacteria | 985 |
| 277 | Ga0495633_0000681 | 3300046558 | Bacteria | 31325 |
| 278 | Ga0495659_0065367 | 3300046664 | Bacteria | 1353 |
| 279 | Ga0495661_0007296 | 3300046665 | Bacteria | 7706 |
| 280 | Ga0495661_0089819 | 3300046665 | Bacteria | 1750 |
| 281 | Ga0495670_0019812 | 3300046691 | Bacteria | 3315 |
| 282 | Ga0495671_0001605 | 3300046692 | Bacteria | 14902 |
| 283 | Ga0495649_0004818 | 3300046694 | Bacteria | 8738 |
| 284 | Ga0495649_0363402 | 3300046694 | Bacteria | 730 |
| 285 | Ga0495672_0014302 | 3300047320 | Bacteria | 5440 |
| 286 | Ga0495626_0038677 | 3300048091 | Bacteria | 2261 |
| 287 | Ga0496100_0491554 | 3300048903 | Bacteria | 945 |
| 288 | Ga0496102_0063160 | 3300048905 | Bacteria | 3390 |
| 289 | Ga0496102_0317435 | 3300048905 | Bacteria | 1468 |
| 290 | Ga0496103_0101334 | 3300048906 | Bacteria | 1823 |
| 291 | Ga0496106_0682458 | 3300048909 | Bacteria | 819 |
| 292 | Ga0496112_0363067 | 3300048915 | Bacteria | 1390 |
| 293 | Ga0496116_0005398 | 3300048919 | Bacteria | 11892 |
| 294 | Ga0496116_0020560 | 3300048919 | Bacteria | 5010 |
| 295 | Ga0496116_0180347 | 3300048919 | Bacteria | 1131 |
| 296 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 297 | Ga0496117_0016841 | 3300048920 | Bacteria | 6140 |
| 298 | Ga0496118_0000008 | 3300048921 | Bacteria | 644537 |
| 299 | Ga0496118_0000419 | 3300048921 | Bacteria | 70630 |
| 300 | Ga0496118_0001837 | 3300048921 | Bacteria | 30407 |
| 301 | Ga0496118_0114317 | 3300048921 | Bacteria | 1780 |
| 302 | Ga0496118_0243343 | 3300048921 | Bacteria | 1028 |
| 303 | Ga0496119_0002339 | 3300048922 | Bacteria | 20876 |
| 304 | Ga0496119_0010201 | 3300048922 | Bacteria | 7929 |
| 305 | Ga0496119_0046025 | 3300048922 | Bacteria | 2729 |
| 306 | Ga0496120_0000014 | 3300048923 | Bacteria | 323163 |
| 307 | Ga0496120_0047167 | 3300048923 | Bacteria | 2485 |
| 308 | Ga0496120_0301630 | 3300048923 | Bacteria | 733 |
| 309 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 310 | Ga0496121_0006919 | 3300048924 | Bacteria | 13825 |
| 311 | Ga0496121_0009923 | 3300048924 | Bacteria | 10840 |
| 312 | Ga0496121_0063459 | 3300048924 | Bacteria | 3018 |
| 313 | Ga0496121_0115288 | 3300048924 | Bacteria | 2040 |
| 314 | Ga0496122_0001150 | 3300048925 | Bacteria | 45372 |
| 315 | Ga0496122_0005636 | 3300048925 | Bacteria | 14790 |
| 316 | Ga0496122_0012327 | 3300048925 | Bacteria | 8531 |
| 317 | Ga0496123_0000466 | 3300048926 | Bacteria | 70916 |
| 318 | Ga0496123_0001208 | 3300048926 | Bacteria | 37717 |
| 319 | Ga0496123_0082169 | 3300048926 | Bacteria | 1954 |
| 320 | Ga0496124_0062525 | 3300048927 | Bacteria | 3115 |
| 321 | Ga0496124_0081970 | 3300048927 | Bacteria | 2649 |
| 322 | Ga0496124_0446277 | 3300048927 | Bacteria | 883 |
| 323 | Ga0496125_0005098 | 3300048928 | Bacteria | 14785 |
| 324 | Ga0496125_0005629 | 3300048928 | Bacteria | 13832 |
| 325 | Ga0496125_0006533 | 3300048928 | Bacteria | 12570 |
| 326 | Ga0496125_0032400 | 3300048928 | Bacteria | 4643 |
| 327 | Ga0496126_0017481 | 3300048929 | Bacteria | 7142 |
| 328 | Ga0496126_0138763 | 3300048929 | Bacteria | 2094 |
| 329 | Ga0496126_0190120 | 3300048929 | Bacteria | 1739 |
| 330 | Ga0496126_0311760 | 3300048929 | Bacteria | 1295 |
| 331 | Ga0496126_0348011 | 3300048929 | Bacteria | 1213 |
| 332 | Ga0495682_0002813 | 3300049460 | Bacteria | 8025 |
| 333 | Ga0501033_0012432 | 3300049570 | Bacteria | 6497 |
| 334 | Ga0501034_0037241 | 3300049571 | Bacteria | 4925 |
| 335 | Ga0501034_0472392 | 3300049571 | Bacteria | 1170 |
| 336 | Ga0501038_0042700 | 3300049574 | Bacteria | 3948 |
| 337 | Ga0501038_0050653 | 3300049574 | Bacteria | 3587 |
| 338 | Ga0501047_0022514 | 3300049581 | Bacteria | 6052 |
| 339 | Ga0501047_0053213 | 3300049581 | Bacteria | 3914 |
| 340 | Ga0501035_0017849 | 3300049822 | Bacteria | 6545 |
| 341 | Ga0501035_0623845 | 3300049822 | Bacteria | 876 |
| 342 | Ga0500642_0320956 | 3300053130 | Bacteria | 695 |
| 343 | Ga0466962_0005341 | 3300061719 | Bacteria | 6175 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031456 | Ga0307513_10048651 | Ga0307513_100486512 | 177 |
| 2 | 3300003187 | JGI25151J46595_10000545 | JGI25151J46595_1000054521 | 182 |
| 3 | 3300003775 | Ga0055524_1004746 | Ga0055524_10047466 | 182 |
| 4 | 3300003784 | Ga0055534_1000777 | Ga0055534_10007774 | 182 |
| 5 | 3300003771 | Ga0055526_1001725 | Ga0055526_10017257 | 184 |
| 6 | 3300010375 | Ga0105239_10392330 | Ga0105239_103923302 | 184 |
| 7 | 3300025295 | Ga0209564_1000158 | Ga0209564_100015855 | 184 |
| 8 | 3300048905 | Ga0496102_0063160 | Ga0496102_0063160_2518_3090 | 185 |
| 9 | 3300048919 | Ga0496116_0180347 | Ga0496116_0180347_418_990 | 185 |
| 10 | 3300048921 | Ga0496118_0000419 | Ga0496118_0000419_27493_28065 | 185 |
| 11 | 3300048923 | Ga0496120_0301630 | Ga0496120_0301630_14_586 | 185 |
| 12 | 3300048924 | Ga0496121_0063459 | Ga0496121_0063459_42_614 | 185 |
| 13 | 3300048927 | Ga0496124_0081970 | Ga0496124_0081970_1032_1604 | 185 |
| 14 | 3300048929 | Ga0496126_0138763 | Ga0496126_0138763_800_1372 | 185 |
| 15 | 3300003187 | JGI25151J46595_10022484 | JGI25151J46595_100224841 | 189 |
| 16 | 3300003578 | Ga0006562J51391_1193001 | Ga0006562J51391_11930012 | 189 |
| 17 | 3300003771 | Ga0055526_1005507 | Ga0055526_10055072 | 189 |
| 18 | 3300003781 | Ga0055536_1000501 | Ga0055536_100050125 | 189 |
| 19 | 3300003784 | Ga0055534_1001007 | Ga0055534_10010075 | 189 |
| 20 | 3300025291 | Ga0209675_1000050 | Ga0209675_1000050128 | 189 |
| 21 | 3300025292 | Ga0209676_1000053 | Ga0209676_1000053120 | 189 |
| 22 | 3300025294 | Ga0209025_1000093 | Ga0209025_1000093156 | 189 |
| 23 | 3300025295 | Ga0209564_1000224 | Ga0209564_100022437 | 189 |
| 24 | 3300046471 | Ga0495650_0002641 | Ga0495650_0002641_708_1337 | 189 |
| 25 | iso_pu_bacteria | 2894817345 | 2894820828 | 194 |
| 26 | iso_pu_bacteria | 8005658619 | 8005658964 | 194 |
| 27 | 3300015683 | Ga0183362_10002 | Ga0183362_10002351 | 195 |
| 28 | 3300025263 | Ga0209565_1000086 | Ga0209565_1000086117 | 195 |
| 29 | 3300025291 | Ga0209675_1001661 | Ga0209675_10016619 | 195 |
| 30 | 3300025294 | Ga0209025_1000059 | Ga0209025_1000059170 | 195 |
| 31 | 3300025295 | Ga0209564_1001285 | Ga0209564_10012854 | 195 |
| 32 | 3300025297 | Ga0209758_1010250 | Ga0209758_10102502 | 195 |
| 33 | 3300025299 | Ga0209256_1003909 | Ga0209256_100390910 | 195 |
| 34 | 3300045836 | Ga0466958_0125338 | Ga0466958_0125338_752_1501 | 196 |
| 35 | 3300046557 | Ga0495622_0168687 | Ga0495622_0168687_279_893 | 196 |
| 36 | 3300046460 | Ga0495638_0000069 | Ga0495638_0000069_29676_30275 | 197 |
| 37 | 3300053130 | Ga0500642_0320956 | Ga0500642_0320956_47_673 | 197 |
| 38 | iso_pu_bacteria | 2842775625 | 2842778987 | 197 |
| 39 | iso_pu_bacteria | 2854681122 | 2854681834 | 197 |
| 40 | 3300001979 | JGI24740J21852_10006072 | JGI24740J21852_100060726 | 198 |
| 41 | 3300005548 | Ga0070665_100005597 | Ga0070665_10000559711 | 198 |
| 42 | 3300013102 | Ga0157371_10070673 | Ga0157371_100706731 | 198 |
| 43 | 3300021361 | Ga0213872_10000639 | Ga0213872_1000063917 | 198 |
| 44 | 3300021361 | Ga0213872_10001941 | Ga0213872_100019414 | 198 |
| 45 | 3300021361 | Ga0213872_10017759 | Ga0213872_100177594 | 198 |
| 46 | 3300021361 | Ga0213872_10040350 | Ga0213872_100403503 | 198 |
| 47 | 3300021361 | Ga0213872_10082509 | Ga0213872_100825092 | 198 |
| 48 | 3300021361 | Ga0213872_10185234 | Ga0213872_101852342 | 198 |
| 49 | 3300028379 | Ga0268266_10011990 | Ga0268266_100119905 | 198 |
| 50 | 3300039447 | Ga0436361_0007544 | Ga0436361_0007544_1196_1804 | 198 |
| 51 | 3300039447 | Ga0436361_0019682 | Ga0436361_0019682_10878_11486 | 198 |
| 52 | 3300039447 | Ga0436361_0021782 | Ga0436361_0021782_4026_4634 | 198 |
| 53 | 3300039447 | Ga0436361_0025162 | Ga0436361_0025162_150_758 | 198 |
| 54 | 3300039447 | Ga0436361_0038009 | Ga0436361_0038009_3543_4151 | 198 |
| 55 | 3300039447 | Ga0436361_0213108 | Ga0436361_0213108_1284_1901 | 198 |
| 56 | 3300039447 | Ga0436361_0333091 | Ga0436361_0333091_1460_2062 | 198 |
| 57 | 3300039447 | Ga0436361_0780096 | Ga0436361_0780096_262_870 | 198 |
| 58 | 3300039447 | Ga0436361_1007985 | Ga0436361_1007985_27_635 | 198 |
| 59 | 3300039447 | Ga0436361_1115311 | Ga0436361_1115311_191_796 | 198 |
| 60 | 3300044842 | Ga0466957_0011126 | Ga0466957_0011126_1630_2253 | 198 |
| 61 | 3300045836 | Ga0466958_0062922 | Ga0466958_0062922_285_893 | 198 |
| 62 | 3300049571 | Ga0501034_0037241 | Ga0501034_0037241_2283_2981 | 198 |
| 63 | 3300049571 | Ga0501034_0472392 | Ga0501034_0472392_64_729 | 198 |
| 64 | 3300049574 | Ga0501038_0042700 | Ga0501038_0042700_2777_3442 | 198 |
| 65 | 3300049574 | Ga0501038_0050653 | Ga0501038_0050653_1977_2675 | 198 |
| 66 | 3300001979 | JGI24740J21852_10000175 | JGI24740J21852_100001758 | 199 |
| 67 | 3300009177 | Ga0105248_10039956 | Ga0105248_100399564 | 199 |
| 68 | 3300025224 | Ga0209784_100245 | Ga0209784_10024534 | 199 |
| 69 | 3300025225 | Ga0209566_100330 | Ga0209566_10033020 | 199 |
| 70 | 3300025226 | Ga0209674_100160 | Ga0209674_10016025 | 199 |
| 71 | 3300025230 | Ga0209563_111133 | Ga0209563_1111332 | 199 |
| 72 | 3300025246 | Ga0209646_1000019 | Ga0209646_1000019197 | 199 |
| 73 | 3300025250 | Ga0209026_1001332 | Ga0209026_100133210 | 199 |
| 74 | 3300025253 | Ga0209677_106554 | Ga0209677_1065544 | 199 |
| 75 | 3300025254 | Ga0209148_1000118 | Ga0209148_1000118120 | 199 |
| 76 | 3300025256 | Ga0209759_1004169 | Ga0209759_10041695 | 199 |
| 77 | 3300025941 | Ga0207711_10002351 | Ga0207711_100023515 | 199 |
| 78 | 3300044658 | Ga0466972_0000217 | Ga0466972_0000217_12179_12799 | 199 |
| 79 | 3300044671 | Ga0466978_0002795 | Ga0466978_0002795_3712_4332 | 199 |
| 80 | 3300044672 | Ga0466982_0020506 | Ga0466982_0020506_1180_1800 | 199 |
| 81 | 3300044683 | Ga0466965_0136983 | Ga0466965_0136983_244_864 | 199 |
| 82 | 3300044693 | Ga0466961_0000078 | Ga0466961_0000078_47000_47620 | 199 |
| 83 | 3300044694 | Ga0466963_0096179 | Ga0466963_0096179_1048_1668 | 199 |
| 84 | 3300044706 | Ga0466964_0002785 | Ga0466964_0002785_4638_5258 | 199 |
| 85 | 3300044719 | Ga0466971_0014263 | Ga0466971_0014263_1298_1918 | 199 |
| 86 | 3300044735 | Ga0466968_0003642 | Ga0466968_0003642_4145_4765 | 199 |
| 87 | 3300044765 | Ga0466970_0000245 | Ga0466970_0000245_5461_6081 | 199 |
| 88 | 3300045049 | Ga0466959_0002066 | Ga0466959_0002066_4741_5361 | 199 |
| 89 | 3300045976 | Ga0466967_0007139 | Ga0466967_0007139_7291_7911 | 199 |
| 90 | 3300048905 | Ga0496102_0317435 | Ga0496102_0317435_405_1034 | 199 |
| 91 | 3300048906 | Ga0496103_0101334 | Ga0496103_0101334_128_757 | 199 |
| 92 | 3300048920 | Ga0496117_0016841 | Ga0496117_0016841_126_755 | 199 |
| 93 | 3300048921 | Ga0496118_0001837 | Ga0496118_0001837_25150_25779 | 199 |
| 94 | 3300048922 | Ga0496119_0046025 | Ga0496119_0046025_969_1598 | 199 |
| 95 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_224082_224711 | 199 |
| 96 | 3300061719 | Ga0466962_0005341 | Ga0466962_0005341_4082_4702 | 199 |
| 97 | 3300002773 | JGI25152J39213_1001984 | JGI25152J39213_10019842 | 200 |
| 98 | 3300003771 | Ga0055526_1001640 | Ga0055526_100164010 | 200 |
| 99 | 3300005331 | Ga0070670_100738519 | Ga0070670_1007385192 | 200 |
| 100 | 3300005335 | Ga0070666_10353687 | Ga0070666_103536871 | 200 |
| 101 | 3300005344 | Ga0070661_100439063 | Ga0070661_1004390631 | 200 |
| 102 | 3300005530 | Ga0070679_100400024 | Ga0070679_1004000242 | 200 |
| 103 | 3300005535 | Ga0070684_100131351 | Ga0070684_1001313512 | 200 |
| 104 | 3300005548 | Ga0070665_100648775 | Ga0070665_1006487752 | 200 |
| 105 | 3300005578 | Ga0068854_100642239 | Ga0068854_1006422391 | 200 |
| 106 | 3300005614 | Ga0068856_101013430 | Ga0068856_1010134302 | 200 |
| 107 | 3300005617 | Ga0068859_100473189 | Ga0068859_1004731892 | 200 |
| 108 | 3300005834 | Ga0068851_10397933 | Ga0068851_103979331 | 200 |
| 109 | 3300005841 | Ga0068863_100003739 | Ga0068863_10000373916 | 200 |
| 110 | 3300005842 | Ga0068858_100357531 | Ga0068858_1003575312 | 200 |
| 111 | 3300006931 | Ga0097620_100473175 | Ga0097620_1004731752 | 200 |
| 112 | 3300009093 | Ga0105240_10020847 | Ga0105240_1002084711 | 200 |
| 113 | 3300009093 | Ga0105240_10056199 | Ga0105240_100561992 | 200 |
| 114 | 3300009093 | Ga0105240_10532174 | Ga0105240_105321742 | 200 |
| 115 | 3300009101 | Ga0105247_10211973 | Ga0105247_102119732 | 200 |
| 116 | 3300009174 | Ga0105241_10046624 | Ga0105241_100466244 | 200 |
| 117 | 3300009174 | Ga0105241_10216007 | Ga0105241_102160072 | 200 |
| 118 | 3300009177 | Ga0105248_11228540 | Ga0105248_112285401 | 200 |
| 119 | 3300009545 | Ga0105237_10178182 | Ga0105237_101781823 | 200 |
| 120 | 3300009551 | Ga0105238_10072292 | Ga0105238_100722923 | 200 |
| 121 | 3300009551 | Ga0105238_10403079 | Ga0105238_104030792 | 200 |
| 122 | 3300009551 | Ga0105238_10689372 | Ga0105238_106893722 | 200 |
| 123 | 3300009551 | Ga0105238_11258381 | Ga0105238_112583811 | 200 |
| 124 | 3300009553 | Ga0105249_10173564 | Ga0105249_101735643 | 200 |
| 125 | 3300009553 | Ga0105249_10677470 | Ga0105249_106774702 | 200 |
| 126 | 3300010375 | Ga0105239_10072994 | Ga0105239_100729942 | 200 |
| 127 | 3300010375 | Ga0105239_10119244 | Ga0105239_101192442 | 200 |
| 128 | 3300010375 | Ga0105239_10349198 | Ga0105239_103491982 | 200 |
| 129 | 3300013307 | Ga0157372_10206306 | Ga0157372_102063062 | 200 |
| 130 | 3300013308 | Ga0157375_10243914 | Ga0157375_102439141 | 200 |
| 131 | 3300014325 | Ga0163163_10690438 | Ga0163163_106904381 | 200 |
| 132 | 3300014968 | Ga0157379_10339753 | Ga0157379_103397531 | 200 |
| 133 | 3300014969 | Ga0157376_10697352 | Ga0157376_106973522 | 200 |
| 134 | 3300025900 | Ga0207710_10103330 | Ga0207710_101033302 | 200 |
| 135 | 3300025911 | Ga0207654_10311249 | Ga0207654_103112492 | 200 |
| 136 | 3300025912 | Ga0207707_10005544 | Ga0207707_1000554411 | 200 |
| 137 | 3300025913 | Ga0207695_10142590 | Ga0207695_101425902 | 200 |
| 138 | 3300025913 | Ga0207695_10484745 | Ga0207695_104847452 | 200 |
| 139 | 3300025914 | Ga0207671_10040687 | Ga0207671_100406874 | 200 |
| 140 | 3300025924 | Ga0207694_10049184 | Ga0207694_100491842 | 200 |
| 141 | 3300025924 | Ga0207694_10820477 | Ga0207694_108204771 | 200 |
| 142 | 3300025941 | Ga0207711_10288433 | Ga0207711_102884332 | 200 |
| 143 | 3300025961 | Ga0207712_10415833 | Ga0207712_104158331 | 200 |
| 144 | 3300025981 | Ga0207640_10329485 | Ga0207640_103294851 | 200 |
| 145 | 3300026035 | Ga0207703_10035250 | Ga0207703_100352505 | 200 |
| 146 | 3300026118 | Ga0207675_100377240 | Ga0207675_1003772402 | 200 |
| 147 | 3300028379 | Ga0268266_10077971 | Ga0268266_100779713 | 200 |
| 148 | 3300028380 | Ga0268265_10006274 | Ga0268265_100062742 | 200 |
| 149 | 3300028794 | Ga0307515_10029601 | Ga0307515_100296012 | 200 |
| 150 | 3300031249 | Ga0265339_10192762 | Ga0265339_101927621 | 200 |
| 151 | 3300031456 | Ga0307513_10009669 | Ga0307513_100096699 | 200 |
| 152 | 3300033180 | Ga0307510_10000018 | Ga0307510_1000001896 | 200 |
| 153 | 3300033180 | Ga0307510_10014663 | Ga0307510_100146637 | 200 |
| 154 | 3300035113 | Ga0373936_0260976 | Ga0373936_0260976_140_751 | 200 |
| 155 | 3300039437 | Ga0436365_0320025 | Ga0436365_0320025_65_679 | 200 |
| 156 | 3300044706 | Ga0466964_0038659 | Ga0466964_0038659_591_1238 | 200 |
| 157 | 3300044719 | Ga0466971_0197258 | Ga0466971_0197258_199_891 | 200 |
| 158 | 3300044765 | Ga0466970_0233364 | Ga0466970_0233364_73_765 | 200 |
| 159 | 3300045049 | Ga0466959_0052994 | Ga0466959_0052994_60_752 | 200 |
| 160 | 3300046507 | Ga0495606_0106882 | Ga0495606_0106882_91_714 | 200 |
| 161 | 3300046694 | Ga0495649_0363402 | Ga0495649_0363402_64_681 | 200 |
| 162 | 3300048903 | Ga0496100_0491554 | Ga0496100_0491554_46_663 | 200 |
| 163 | 3300048909 | Ga0496106_0682458 | Ga0496106_0682458_138_755 | 200 |
| 164 | 3300048915 | Ga0496112_0363067 | Ga0496112_0363067_235_849 | 200 |
| 165 | 3300048921 | Ga0496118_0243343 | Ga0496118_0243343_195_809 | 200 |
| 166 | 3300048922 | Ga0496119_0002339 | Ga0496119_0002339_7907_8524 | 200 |
| 167 | 3300048922 | Ga0496119_0010201 | Ga0496119_0010201_792_1409 | 200 |
| 168 | 3300048923 | Ga0496120_0000014 | Ga0496120_0000014_29636_30253 | 200 |
| 169 | 3300048923 | Ga0496120_0047167 | Ga0496120_0047167_880_1497 | 200 |
| 170 | 3300048924 | Ga0496121_0115288 | Ga0496121_0115288_1271_1888 | 200 |
| 171 | 3300048927 | Ga0496124_0446277 | Ga0496124_0446277_152_769 | 200 |
| 172 | 3300048928 | Ga0496125_0005629 | Ga0496125_0005629_206_820 | 200 |
| 173 | 3300048928 | Ga0496125_0032400 | Ga0496125_0032400_1516_2133 | 200 |
| 174 | 3300048929 | Ga0496126_0190120 | Ga0496126_0190120_677_1294 | 200 |
| 175 | 3300048929 | Ga0496126_0311760 | Ga0496126_0311760_470_1084 | 200 |
| 176 | 3300049581 | Ga0501047_0022514 | Ga0501047_0022514_5342_5980 | 200 |
| 177 | 3300045051 | Ga0451576_0001138 | Ga0451576_0001138_13849_14472 | 201 |
| 178 | 3300005367 | Ga0070667_100167240 | Ga0070667_1001672401 | 202 |
| 179 | 3300005843 | Ga0068860_100004430 | Ga0068860_10000443014 | 202 |
| 180 | 3300013105 | Ga0157369_10136039 | Ga0157369_101360391 | 202 |
| 181 | 3300026088 | Ga0207641_10000470 | Ga0207641_100004707 | 202 |
| 182 | 3300028381 | Ga0268264_10000708 | Ga0268264_100007085 | 202 |
| 183 | 3300039447 | Ga0436361_0148623 | Ga0436361_0148623_1276_1896 | 202 |
| 184 | 3300045976 | Ga0466967_0017142 | Ga0466967_0017142_204_827 | 202 |
| 185 | 3300046518 | Ga0495631_0110918 | Ga0495631_0110918_514_1152 | 202 |
| 186 | iso_pu_bacteria | 2596583598 | 2597031993 | 202 |
| 187 | iso_pu_bacteria | 2599185178 | 2599444113 | 202 |
| 188 | iso_pu_bacteria | 2900577576 | 2900579374 | 202 |
| 189 | iso_pu_bacteria | 2928058823 | 2928062335 | 202 |
| 190 | 3300046530 | Ga0495654_0061970 | Ga0495654_0061970_576_1208 | 203 |
| 191 | 3300048091 | Ga0495626_0038677 | Ga0495626_0038677_385_1017 | 203 |
| 192 | 3300025284 | Ga0209130_1002672 | Ga0209130_10026725 | 204 |
| 193 | 3300025291 | Ga0209675_1000571 | Ga0209675_10005715 | 204 |
| 194 | 3300025292 | Ga0209676_1015997 | Ga0209676_10159971 | 204 |
| 195 | 3300025294 | Ga0209025_1035094 | Ga0209025_10350943 | 204 |
| 196 | 3300025303 | Ga0209051_1014067 | Ga0209051_10140674 | 204 |
| 197 | 3300025303 | Ga0209051_1021847 | Ga0209051_10218473 | 204 |
| 198 | 3300046665 | Ga0495661_0089819 | Ga0495661_0089819_764_1399 | 204 |
| 199 | iso_pu_bacteria | 2643221654 | 2644303751 | 204 |
| 200 | 3300001915 | JGI24741J21665_1001391 | JGI24741J21665_10013913 | 205 |
| 201 | 3300001979 | JGI24740J21852_10002451 | JGI24740J21852_100024517 | 205 |
| 202 | 3300002705 | JGI25156J39149_1009836 | JGI25156J39149_10098363 | 205 |
| 203 | 3300003578 | Ga0006562J51391_1193002 | Ga0006562J51391_11930022 | 205 |
| 204 | 3300003752 | Ga0055539_1000061 | Ga0055539_100006194 | 205 |
| 205 | 3300003758 | Ga0055532_1000042 | Ga0055532_100004278 | 205 |
| 206 | 3300003759 | Ga0055525_1000741 | Ga0055525_10007413 | 205 |
| 207 | 3300003760 | Ga0055527_1001264 | Ga0055527_10012645 | 205 |
| 208 | 3300003761 | Ga0055535_1000031 | Ga0055535_1000031124 | 205 |
| 209 | 3300003763 | Ga0055529_1000075 | Ga0055529_100007578 | 205 |
| 210 | 3300003763 | Ga0055529_1000098 | Ga0055529_100009824 | 205 |
| 211 | 3300003841 | Ga0055541_1002065 | Ga0055541_10020655 | 205 |
| 212 | 3300005344 | Ga0070661_100000455 | Ga0070661_10000045531 | 205 |
| 213 | 3300005366 | Ga0070659_100009159 | Ga0070659_1000091596 | 205 |
| 214 | 3300005455 | Ga0070663_100000044 | Ga0070663_10000004459 | 205 |
| 215 | 3300005564 | Ga0070664_100000092 | Ga0070664_10000009262 | 205 |
| 216 | 3300005577 | Ga0068857_100013185 | Ga0068857_1000131856 | 205 |
| 217 | 3300005578 | Ga0068854_100000176 | Ga0068854_10000017643 | 205 |
| 218 | 3300005614 | Ga0068856_100000261 | Ga0068856_10000026162 | 205 |
| 219 | 3300009093 | Ga0105240_10215560 | Ga0105240_102155603 | 205 |
| 220 | 3300013100 | Ga0157373_10010772 | Ga0157373_100107726 | 205 |
| 221 | 3300013102 | Ga0157371_10000362 | Ga0157371_1000036262 | 205 |
| 222 | 3300013104 | Ga0157370_10000766 | Ga0157370_1000076625 | 205 |
| 223 | 3300013105 | Ga0157369_10015046 | Ga0157369_100150462 | 205 |
| 224 | 3300013307 | Ga0157372_10000269 | Ga0157372_1000026964 | 205 |
| 225 | 3300014497 | Ga0182008_10014304 | Ga0182008_100143045 | 205 |
| 226 | 3300015261 | Ga0182006_1003108 | Ga0182006_10031084 | 205 |
| 227 | 3300015261 | Ga0182006_1005995 | Ga0182006_10059956 | 205 |
| 228 | 3300015262 | Ga0182007_10108196 | Ga0182007_101081962 | 205 |
| 229 | 3300020077 | Ga0206351_10901382 | Ga0206351_109013825 | 205 |
| 230 | 3300020610 | Ga0154015_1153690 | Ga0154015_11536908 | 205 |
| 231 | 3300022467 | Ga0224712_10109788 | Ga0224712_101097882 | 205 |
| 232 | 3300025224 | Ga0209784_100003 | Ga0209784_1000031306 | 205 |
| 233 | 3300025225 | Ga0209566_100002 | Ga0209566_1000022260 | 205 |
| 234 | 3300025225 | Ga0209566_101382 | Ga0209566_1013823 | 205 |
| 235 | 3300025226 | Ga0209674_100094 | Ga0209674_10009477 | 205 |
| 236 | 3300025228 | Ga0209672_100096 | Ga0209672_10009646 | 205 |
| 237 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021014 | 205 |
| 238 | 3300025230 | Ga0209563_100004 | Ga0209563_1000041677 | 205 |
| 239 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021014 | 205 |
| 240 | 3300025253 | Ga0209677_100071 | Ga0209677_10007147 | 205 |
| 241 | 3300025254 | Ga0209148_1004006 | Ga0209148_10040065 | 205 |
| 242 | 3300025272 | Ga0209455_1000009 | Ga0209455_1000009895 | 205 |
| 243 | 3300025913 | Ga0207695_10008005 | Ga0207695_100080054 | 205 |
| 244 | 3300025920 | Ga0207649_10002855 | Ga0207649_100028557 | 205 |
| 245 | 3300025945 | Ga0207679_10000341 | Ga0207679_100003418 | 205 |
| 246 | 3300025981 | Ga0207640_10000049 | Ga0207640_1000004993 | 205 |
| 247 | 3300026067 | Ga0207678_10000148 | Ga0207678_100001487 | 205 |
| 248 | 3300026078 | Ga0207702_10000296 | Ga0207702_1000029662 | 205 |
| 249 | 3300026116 | Ga0207674_10001491 | Ga0207674_100014916 | 205 |
| 250 | 3300026142 | Ga0207698_10117157 | Ga0207698_101171572 | 205 |
| 251 | 3300037418 | Ga0395900_0027154 | Ga0395900_0027154_4429_5070 | 205 |
| 252 | 3300042876 | Ga0451577_0000303 | Ga0451577_0000303_26914_27552 | 205 |
| 253 | 3300044650 | Ga0466986_0083669 | Ga0466986_0083669_475_1116 | 205 |
| 254 | 3300044712 | Ga0453684_0000947 | Ga0453684_0000947_68289_68927 | 205 |
| 255 | 3300045976 | Ga0466967_0047195 | Ga0466967_0047195_2170_2811 | 205 |
| 256 | 3300046460 | Ga0495638_0025263 | Ga0495638_0025263_2647_3285 | 205 |
| 257 | 3300048921 | Ga0496118_0114317 | Ga0496118_0114317_1114_1755 | 205 |
| 258 | 3300048928 | Ga0496125_0006533 | Ga0496125_0006533_6317_6958 | 205 |
| 259 | 3300049570 | Ga0501033_0012432 | Ga0501033_0012432_478_1131 | 205 |
| 260 | 3300049581 | Ga0501047_0053213 | Ga0501047_0053213_2474_3127 | 205 |
| 261 | 3300049822 | Ga0501035_0623845 | Ga0501035_0623845_195_848 | 205 |
| 262 | iso_pu_bacteria | 2600255292 | 2601670882 | 205 |
| 263 | iso_pu_bacteria | 2842733646 | 2842737928 | 205 |
| 264 | iso_pu_bacteria | 2857547612 | 2857547655 | 205 |
| 265 | 3300021361 | Ga0213872_10138490 | Ga0213872_101384902 | 207 |
| 266 | 3300028794 | Ga0307515_10030036 | Ga0307515_100300364 | 207 |
| 267 | 3300031730 | Ga0307516_10000506 | Ga0307516_1000050625 | 207 |
| 268 | 3300039447 | Ga0436361_0866882 | Ga0436361_0866882_5361_6011 | 207 |
| 269 | 3300044712 | Ga0453684_0212940 | Ga0453684_0212940_1330_1974 | 207 |
| 270 | 3300049822 | Ga0501035_0017849 | Ga0501035_0017849_2139_2795 | 207 |
| 271 | 3300002738 | JGI25154J39366_1000981 | JGI25154J39366_100098110 | 208 |
| 272 | 3300003215 | JGI25153J46596_10005959 | JGI25153J46596_100059593 | 208 |
| 273 | 3300003756 | Ga0055533_1012758 | Ga0055533_10127581 | 208 |
| 274 | 3300003775 | Ga0055524_1011390 | Ga0055524_10113902 | 208 |
| 275 | 3300003841 | Ga0055541_1000186 | Ga0055541_100018625 | 208 |
| 276 | 3300005459 | Ga0068867_100395583 | Ga0068867_1003955831 | 208 |
| 277 | 3300006353 | Ga0075370_10144369 | Ga0075370_101443692 | 208 |
| 278 | 3300006948 | Ga0099826_10000009 | Ga0099826_10000009255 | 208 |
| 279 | 3300009011 | Ga0105251_10063900 | Ga0105251_100639002 | 208 |
| 280 | 3300014497 | Ga0182008_10000671 | Ga0182008_100006714 | 208 |
| 281 | 3300014497 | Ga0182008_10330798 | Ga0182008_103307981 | 208 |
| 282 | 3300015261 | Ga0182006_1000075 | Ga0182006_100007546 | 208 |
| 283 | 3300015262 | Ga0182007_10000135 | Ga0182007_1000013544 | 208 |
| 284 | 3300015265 | Ga0182005_1000106 | Ga0182005_100010644 | 208 |
| 285 | 3300017792 | Ga0163161_10066663 | Ga0163161_100666631 | 208 |
| 286 | 3300021361 | Ga0213872_10030306 | Ga0213872_100303063 | 208 |
| 287 | 3300021361 | Ga0213872_10036837 | Ga0213872_100368372 | 208 |
| 288 | 3300025258 | Ga0209129_1000041 | Ga0209129_1000041221 | 208 |
| 289 | 3300025263 | Ga0209565_1008034 | Ga0209565_10080341 | 208 |
| 290 | 3300025291 | Ga0209675_1002072 | Ga0209675_10020727 | 208 |
| 291 | 3300025294 | Ga0209025_1003086 | Ga0209025_100308612 | 208 |
| 292 | 3300025295 | Ga0209564_1000029 | Ga0209564_1000029367 | 208 |
| 293 | 3300025297 | Ga0209758_1000043 | Ga0209758_100004373 | 208 |
| 294 | 3300025299 | Ga0209256_1001784 | Ga0209256_10017845 | 208 |
| 295 | 3300025735 | Ga0207713_1090817 | Ga0207713_10908172 | 208 |
| 296 | 3300026089 | Ga0207648_10476876 | Ga0207648_104768761 | 208 |
| 297 | 3300027666 | Ga0209282_1000017 | Ga0209282_1000017160 | 208 |
| 298 | 3300027876 | Ga0209974_10005261 | Ga0209974_100052613 | 208 |
| 299 | 3300030522 | Ga0307512_10088951 | Ga0307512_100889512 | 208 |
| 300 | 3300031456 | Ga0307513_10129626 | Ga0307513_101296263 | 208 |
| 301 | 3300031507 | Ga0307509_10020057 | Ga0307509_100200574 | 208 |
| 302 | 3300031730 | Ga0307516_10106294 | Ga0307516_101062942 | 208 |
| 303 | 3300033180 | Ga0307510_10085989 | Ga0307510_100859893 | 208 |
| 304 | 3300039447 | Ga0436361_0417851 | Ga0436361_0417851_626_1282 | 208 |
| 305 | 3300039447 | Ga0436361_1128746 | Ga0436361_1128746_3952_4593 | 208 |
| 306 | 3300039447 | Ga0436361_1139319 | Ga0436361_1139319_1993_2664 | 208 |
| 307 | 3300044683 | Ga0466965_0047733 | Ga0466965_0047733_1307_1969 | 208 |
| 308 | 3300044684 | Ga0466966_0002396 | Ga0466966_0002396_11524_12186 | 208 |
| 309 | 3300044693 | Ga0466961_0322134 | Ga0466961_0322134_25_687 | 208 |
| 310 | 3300044706 | Ga0466964_0002154 | Ga0466964_0002154_5906_6568 | 208 |
| 311 | 3300044719 | Ga0466971_0002021 | Ga0466971_0002021_5176_5838 | 208 |
| 312 | 3300044735 | Ga0466968_0049098 | Ga0466968_0049098_159_821 | 208 |
| 313 | 3300044765 | Ga0466970_0024951 | Ga0466970_0024951_356_1006 | 208 |
| 314 | 3300044765 | Ga0466970_0028940 | Ga0466970_0028940_1465_2127 | 208 |
| 315 | 3300044842 | Ga0466957_0006923 | Ga0466957_0006923_1909_2571 | 208 |
| 316 | 3300045049 | Ga0466959_0004039 | Ga0466959_0004039_2659_3309 | 208 |
| 317 | 3300045049 | Ga0466959_0021294 | Ga0466959_0021294_1256_1918 | 208 |
| 318 | 3300045051 | Ga0451576_0015269 | Ga0451576_0015269_5718_6446 | 208 |
| 319 | 3300046474 | Ga0495605_0007559 | Ga0495605_0007559_4692_5348 | 208 |
| 320 | 3300046491 | Ga0495584_0064242 | Ga0495584_0064242_537_1193 | 208 |
| 321 | 3300046500 | Ga0495596_0000255 | Ga0495596_0000255_8182_8838 | 208 |
| 322 | 3300046501 | Ga0495607_0002536 | Ga0495607_0002536_7917_8573 | 208 |
| 323 | 3300046507 | Ga0495606_0089768 | Ga0495606_0089768_880_1536 | 208 |
| 324 | 3300046512 | Ga0495610_0000200 | Ga0495610_0000200_8248_8904 | 208 |
| 325 | 3300046513 | Ga0495616_0002056 | Ga0495616_0002056_4378_5034 | 208 |
| 326 | 3300046524 | Ga0495648_0021843 | Ga0495648_0021843_3516_4172 | 208 |
| 327 | 3300046538 | Ga0495609_0001548 | Ga0495609_0001548_8026_8682 | 208 |
| 328 | 3300046558 | Ga0495633_0000681 | Ga0495633_0000681_23794_24441 | 208 |
| 329 | 3300046664 | Ga0495659_0065367 | Ga0495659_0065367_299_949 | 208 |
| 330 | 3300046665 | Ga0495661_0007296 | Ga0495661_0007296_3423_4079 | 208 |
| 331 | 3300046691 | Ga0495670_0019812 | Ga0495670_0019812_891_1547 | 208 |
| 332 | 3300046692 | Ga0495671_0001605 | Ga0495671_0001605_7776_8432 | 208 |
| 333 | 3300046694 | Ga0495649_0004818 | Ga0495649_0004818_1232_1888 | 208 |
| 334 | 3300047320 | Ga0495672_0014302 | Ga0495672_0014302_3596_4252 | 208 |
| 335 | 3300048919 | Ga0496116_0005398 | Ga0496116_0005398_4916_5572 | 208 |
| 336 | 3300048919 | Ga0496116_0020560 | Ga0496116_0020560_64_711 | 208 |
| 337 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_2128422_2129069 | 208 |
| 338 | 3300048921 | Ga0496118_0000008 | Ga0496118_0000008_246715_247362 | 208 |
| 339 | 3300048924 | Ga0496121_0006919 | Ga0496121_0006919_3795_4442 | 208 |
| 340 | 3300048924 | Ga0496121_0009923 | Ga0496121_0009923_1589_2245 | 208 |
| 341 | 3300048925 | Ga0496122_0001150 | Ga0496122_0001150_30700_31347 | 208 |
| 342 | 3300048925 | Ga0496122_0005636 | Ga0496122_0005636_7836_8492 | 208 |
| 343 | 3300048926 | Ga0496123_0000466 | Ga0496123_0000466_7791_8447 | 208 |
| 344 | 3300048926 | Ga0496123_0001208 | Ga0496123_0001208_25038_25685 | 208 |
| 345 | 3300048929 | Ga0496126_0348011 | Ga0496126_0348011_526_1182 | 208 |
| 346 | 3300049460 | Ga0495682_0002813 | Ga0495682_0002813_2719_3366 | 208 |
| 347 | 3300046557 | Ga0495622_0106531 | Ga0495622_0106531_98_748 | 209 |
| 348 | 3300046542 | Ga0495597_0001204 | Ga0495597_0001204_2964_3602 | 212 |
| 349 | 2162886007 | SwRhRL2b_contig_3294069 | SwRhRL2b_0563.00002840 | 217 |
| 350 | 3300005289 | Ga0065704_10125258 | Ga0065704_101252581 | 217 |
| 351 | 3300048925 | Ga0496122_0012327 | Ga0496122_0012327_151_804 | 217 |
| 352 | 3300048926 | Ga0496123_0082169 | Ga0496123_0082169_1054_1707 | 217 |
| 353 | 3300048927 | Ga0496124_0062525 | Ga0496124_0062525_45_698 | 217 |
| 354 | 3300048928 | Ga0496125_0005098 | Ga0496125_0005098_5233_5886 | 217 |
| 355 | 3300048929 | Ga0496126_0017481 | Ga0496126_0017481_4877_5530 | 217 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6w4s-assembly1.cif.gz_F | structure of apo human ferroportin in lipid nanodisc | 0.4666 | 5 | 217 |
| 6ob6-assembly1.cif.gz_A | human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned | 0.4651 | 10 | 214 |
| 7lo7-assembly1.cif.gz_Z | nora in complex with fab25 | 0.4451 | 18 | 214 |
| 7xq2-assembly1.cif.gz_A | structure of hslc19a1+2'3'-cgamp | 0.4412 | 9 | 215 |
| 4iu9-assembly2.cif.gz_A | crystal structure of a membrane transporter | 0.4378 | 12 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76264_30_182_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6837 | 32 | 208 | 1.20.1250.20 |
| af_P76264_30_182_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6658 | 32 | 208 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5322 | 19 | 204 | 1.20.1250.20 |
| af_P67127_16_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5234 | 19 | 204 | 1.20.1250.20 |
| af_B9G125_1_232_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5001 | 14 | 217 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A172YK65-F1-model_v4 | Lysine transporter LysE | 0.9413 | 11 | 211 |
GO:0005886
GO:0015171 |
| AF-A0A562PKS8-F1-model_v4 | L-lysine exporter family protein LysE/ArgO | 0.9333 | 10 | 210 |
GO:0005886
GO:0015171 |
| AF-A0A077FJK8-F1-model_v4 | Arginine exporter protein ArgO | 0.9323 | 13 | 212 |
GO:0005886
GO:0015171 |
| AF-A0A172YK65-F1-model_v4 | Lysine transporter LysE | 0.9323 | 11 | 211 |
GO:0005886
GO:0015171 |
| AF-A0A6M8B2Z9-F1-model_v4 | LysE family transporter | 0.9292 | 9 | 211 |
GO:0005886
GO:0015171 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar