F419653

General Info

Members Datasets Scaffolds Average Seq Length
354 202 354 190

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10008217|Ga0070709_100082172
Length 221
Sequence MLRAKPFRRATAATDAKQRPGFQNSTPAACAPQMSEDLLALFRKTGALLDGHFVLRSGLHSREYFQCALLLQHTEIAAKVCGRLADKVRKFNCDTVISPALGGIIVGQEVGRSLGKRHIFVEKEEGKLVLRRGFQISPNEKFVVVEDVVTRGGRVQETIDIVRAHGGIVSAVGVIVDRSGAAKPDFGCPFASLIEMNMETFPADNLPSDLAKIPAVKPGSK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 1.69
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2742384 2162886007 Bacteria 1000
2 MBSR1b_contig_11670001 2162886012 Bacteria 837
3 rootH2_10310919 3300003320 Bacteria 1761
4 rootL2_10103863 3300003322 Bacteria 10567
5 Ga0065703_1018946 3300005272 Bacteria 4839
6 Ga0065704_10006717 3300005289 Bacteria 3022
7 Ga0065704_10080585 3300005289 Bacteria 3919
8 Ga0065704_10151491 3300005289 Bacteria 1425
9 Ga0065712_10161874 3300005290 Bacteria 1297
10 Ga0065712_10199873 3300005290 Bacteria 1113
11 Ga0065715_10000421 3300005293 Bacteria 13595
12 Ga0065707_10392183 3300005295 Bacteria 863
13 Ga0070658_10467387 3300005327 Unclassified 1088
14 Ga0070658_10482515 3300005327 Bacteria 1070
15 Ga0070676_10076550 3300005328 Unclassified 2020
16 Ga0070676_10077305 3300005328 Bacteria 2011
17 Ga0070676_10160843 3300005328 Bacteria 1445
18 Ga0070683_100065580 3300005329 Bacteria 3381
19 Ga0070670_100094569 3300005331 Bacteria 2570
20 Ga0070670_100352935 3300005331 Unclassified 1292
21 Ga0070670_100599139 3300005331 Bacteria 986
22 Ga0070670_101048000 3300005331 Bacteria 743
23 Ga0070666_10017145 3300005335 Unclassified 4642
24 Ga0070666_10024577 3300005335 Bacteria 3926
25 Ga0070666_10069414 3300005335 Bacteria 2396
26 Ga0070660_100409916 3300005339 Unclassified 1121
27 Ga0070660_101089797 3300005339 Bacteria 676
28 Ga0070689_100015602 3300005340 Bacteria 5544
29 Ga0070668_100042150 3300005347 Bacteria 3498
30 Ga0070668_100295765 3300005347 Bacteria 1356
31 Ga0070669_100023536 3300005353 Bacteria 4409
32 Ga0070669_100200506 3300005353 Unclassified 1570
33 Ga0070669_100307413 3300005353 Unclassified 1277
34 Ga0070675_100011832 3300005354 Bacteria 6837
35 Ga0070675_100642025 3300005354 Bacteria 964
36 Ga0070671_100013870 3300005355 Bacteria 6501
37 Ga0070671_100114408 3300005355 Bacteria 2268
38 Ga0070674_100009944 3300005356 Bacteria 5726
39 Ga0070673_100007746 3300005364 Bacteria 7107
40 Ga0070673_100147459 3300005364 Bacteria 1990
41 Ga0070688_100175086 3300005365 Bacteria 1484
42 Ga0070688_100387446 3300005365 Bacteria 1032
43 Ga0070688_100872890 3300005365 Unclassified 708
44 Ga0070659_100399578 3300005366 Unclassified 1160
45 Ga0070667_100090804 3300005367 Bacteria 2626
46 Ga0070709_10008217 3300005434 Bacteria 5732
47 Ga0070714_100028795 3300005435 Bacteria 4612
48 Ga0070713_100534155 3300005436 Bacteria 1109
49 Ga0070710_10050272 3300005437 Bacteria 2336
50 Ga0070710_10170545 3300005437 Bacteria 1355
51 Ga0070711_100085444 3300005439 Bacteria 2260
52 Ga0070711_100121146 3300005439 Bacteria 1935
53 Ga0070711_100180105 3300005439 Bacteria 1618
54 Ga0070711_100231049 3300005439 Bacteria 1442
55 Ga0070711_100233226 3300005439 Bacteria 1436
56 Ga0070705_100108641 3300005440 Bacteria 1767
57 Ga0070708_100024411 3300005445 Bacteria 5158
58 Ga0070708_100035413 3300005445 Bacteria 4349
59 Ga0070708_100041822 3300005445 Bacteria 4020
60 Ga0070708_100098748 3300005445 Bacteria 2670
61 Ga0070708_100244067 3300005445 Bacteria 1686
62 Ga0070708_100298223 3300005445 Bacteria 1517
63 Ga0070678_100099366 3300005456 Unclassified 2252
64 Ga0068867_100047461 3300005459 Bacteria 3157
65 Ga0070685_10111433 3300005466 Unclassified 1686
66 Ga0070706_100000035 3300005467 Bacteria 152107
67 Ga0070706_100013032 3300005467 Bacteria 7693
68 Ga0070706_100020122 3300005467 Bacteria 6150
69 Ga0070706_100126647 3300005467 Unclassified 2382
70 Ga0070706_100133141 3300005467 Bacteria 2320
71 Ga0070706_100339360 3300005467 Bacteria 1401
72 Ga0070707_100002278 3300005468 Bacteria 18346
73 Ga0070707_100010859 3300005468 Bacteria 8481
74 Ga0070707_100027638 3300005468 Bacteria 5396
75 Ga0070707_100036698 3300005468 Bacteria 4677
76 Ga0070707_100050118 3300005468 Bacteria 4002
77 Ga0070707_100193204 3300005468 Unclassified 1985
78 Ga0070707_100338122 3300005468 Unclassified 1463
79 Ga0070707_100506935 3300005468 Bacteria 1168
80 Ga0070707_101192025 3300005468 Unclassified 728
81 Ga0070707_101240547 3300005468 Unclassified 712
82 Ga0070707_101484443 3300005468 Bacteria 645
83 Ga0070698_100004983 3300005471 Bacteria 14549
84 Ga0070698_100006835 3300005471 Bacteria 12359
85 Ga0070698_100052592 3300005471 Bacteria 4143
86 Ga0070698_100387100 3300005471 Bacteria 1331
87 Ga0070699_100120222 3300005518 Bacteria 2309
88 Ga0070699_100229532 3300005518 Bacteria 1655
89 Ga0070697_100015877 3300005536 Bacteria 5916
90 Ga0070697_100019738 3300005536 Bacteria 5325
91 Ga0070697_100032710 3300005536 Bacteria 4187
92 Ga0070697_100055004 3300005536 Bacteria 3235
93 Ga0070697_100127881 3300005536 Unclassified 2129
94 Ga0070697_100158000 3300005536 Unclassified 1915
95 Ga0068853_100000002 3300005539 Bacteria 485323
96 Ga0068853_100404072 3300005539 Bacteria 1279
97 Ga0070672_100006021 3300005543 Bacteria 8102
98 Ga0070672_100714102 3300005543 Bacteria 878
99 Ga0070695_100073769 3300005545 Bacteria 2241
100 Ga0070665_100522596 3300005548 Unclassified 1198
101 Ga0070665_100758534 3300005548 Bacteria 983
102 Ga0070665_100806791 3300005548 Unclassified 951
103 Ga0068855_100004104 3300005563 Bacteria 17766
104 Ga0070664_100073661 3300005564 Bacteria 2931
105 Ga0070664_100094178 3300005564 Bacteria 2597
106 Ga0068859_100196065 3300005617 Bacteria 2104
107 Ga0068864_100389019 3300005618 Bacteria 1323
108 Ga0068863_100045582 3300005841 Bacteria 4161
109 Ga0068863_100253600 3300005841 Bacteria 1700
110 Ga0068863_100865018 3300005841 Bacteria 903
111 Ga0068858_100105563 3300005842 Bacteria 2629
112 Ga0068858_100255552 3300005842 Bacteria 1665
113 Ga0068858_100487356 3300005842 Unclassified 1190
114 Ga0068858_100703019 3300005842 Bacteria 984
115 Ga0068860_100001252 3300005843 Bacteria 27727
116 Ga0081455_10001011 3300005937 Bacteria 35586
117 Ga0081455_10021737 3300005937 Bacteria 6010
118 Ga0081455_10046729 3300005937 Bacteria 3753
119 Ga0081540_1000018 3300005983 Bacteria 164931
120 Ga0081539_10000287 3300005985 Bacteria 113988
121 Ga0081539_10001712 3300005985 Bacteria 35198
122 Ga0070717_10048038 3300006028 Bacteria 3499
123 Ga0070717_10079637 3300006028 Bacteria 2747
124 Ga0070717_10105847 3300006028 Bacteria 2394
125 Ga0070717_10322837 3300006028 Unclassified 1376
126 Ga0070717_10459014 3300006028 Unclassified 1149
127 Ga0070717_10639900 3300006028 Bacteria 965
128 Ga0070716_100140143 3300006173 Bacteria 1541
129 Ga0070712_100191235 3300006175 Bacteria 1602
130 Ga0070712_100290840 3300006175 Bacteria 1319
131 Ga0070712_100415685 3300006175 Unclassified 1114
132 Ga0070712_100922957 3300006175 Bacteria 753
133 Ga0097621_100012002 3300006237 Bacteria 6411
134 Ga0097621_100299772 3300006237 Unclassified 1419
135 Ga0068871_101061301 3300006358 Unclassified 756
136 Ga0068871_101513720 3300006358 Unclassified 634
137 Ga0075434_100313201 3300006871 Bacteria 1590
138 Ga0075434_100336264 3300006871 Unclassified 1531
139 Ga0097620_100196066 3300006931 Bacteria 2104
140 Ga0075435_100747813 3300007076 Unclassified 851
141 Ga0105240_10000069 3300009093 Bacteria 205335
142 Ga0105240_11191814 3300009093 Unclassified 807
143 Ga0111539_10224743 3300009094 Bacteria 2187
144 Ga0111539_10489170 3300009094 Unclassified 1433
145 Ga0105245_10817842 3300009098 Bacteria 970
146 Ga0114129_10222625 3300009147 Bacteria 2545
147 Ga0105242_10585830 3300009176 Bacteria 1075
148 Ga0105237_10005057 3300009545 Bacteria 14990
149 Ga0105237_10382834 3300009545 Bacteria 1412
150 Ga0105249_10676890 3300009553 Bacteria 1091
151 Ga0105249_10789044 3300009553 Bacteria 1013
152 Ga0105239_10139955 3300010375 Bacteria 2696
153 Ga0105239_10142763 3300010375 Unclassified 2669
154 Ga0105239_10293348 3300010375 Bacteria 1831
155 Ga0105239_11234600 3300010375 Bacteria 862
156 Ga0157374_10000057 3300013296 Bacteria 117036
157 Ga0157374_10010066 3300013296 Bacteria 8118
158 Ga0157374_10033590 3300013296 Bacteria 4681
159 Ga0157374_10136227 3300013296 Bacteria 2381
160 Ga0157378_10026609 3300013297 Bacteria 5098
161 Ga0157378_10150801 3300013297 Bacteria 2166
162 Ga0157378_10382418 3300013297 Bacteria 1383
163 Ga0157378_10752965 3300013297 Unclassified 997
164 Ga0163162_10013581 3300013306 Bacteria 7956
165 Ga0157375_10000006 3300013308 Bacteria 384086
166 Ga0157375_10036685 3300013308 Bacteria 4691
167 Ga0157375_10107973 3300013308 Bacteria 2877
168 Ga0157375_10614325 3300013308 Unclassified 1246
169 Ga0157375_12616870 3300013308 Bacteria 603
170 Ga0157380_10423975 3300014326 Bacteria 1270
171 Ga0182008_10018991 3300014497 Bacteria 3553
172 Ga0157377_10051023 3300014745 Bacteria 2332
173 Ga0157376_10000357 3300014969 Bacteria 30379
174 Ga0157376_10292959 3300014969 Bacteria 1537
175 Ga0157376_11620262 3300014969 Unclassified 682
176 Ga0207697_10000257 3300025315 Bacteria 29235
177 Ga0207697_10005265 3300025315 Bacteria 6029
178 Ga0207697_10013644 3300025315 Bacteria 3386
179 Ga0207697_10020366 3300025315 Unclassified 2716
180 Ga0207688_10004727 3300025901 Bacteria 7416
181 Ga0207680_10027263 3300025903 Unclassified 3179
182 Ga0207699_10016136 3300025906 Bacteria 3898
183 Ga0207645_10119773 3300025907 Bacteria 1708
184 Ga0207645_10236475 3300025907 Bacteria 1206
185 Ga0207684_10000043 3300025910 Bacteria 259939
186 Ga0207684_10002807 3300025910 Bacteria 17312
187 Ga0207684_10004414 3300025910 Bacteria 13249
188 Ga0207684_10018448 3300025910 Bacteria 5974
189 Ga0207684_10027121 3300025910 Bacteria 4885
190 Ga0207695_10000186 3300025913 Bacteria 179847
191 Ga0207671_10004700 3300025914 Bacteria 12906
192 Ga0207671_10128071 3300025914 Bacteria 1946
193 Ga0207693_10076402 3300025915 Bacteria 2623
194 Ga0207693_10128348 3300025915 Bacteria 1993
195 Ga0207693_10179303 3300025915 Bacteria 1667
196 Ga0207693_10280000 3300025915 Bacteria 1307
197 Ga0207693_10348311 3300025915 Bacteria 1159
198 Ga0207663_10366966 3300025916 Bacteria 1094
199 Ga0207646_10004744 3300025922 Bacteria 14638
200 Ga0207646_10005562 3300025922 Bacteria 13229
201 Ga0207646_10012526 3300025922 Bacteria 8143
202 Ga0207646_10128557 3300025922 Unclassified 2279
203 Ga0207646_10382814 3300025922 Unclassified 1271
204 Ga0207681_10058606 3300025923 Bacteria 2637
205 Ga0207650_10287005 3300025925 Bacteria 1341
206 Ga0207659_10097413 3300025926 Bacteria 2210
207 Ga0207659_11085673 3300025926 Bacteria 689
208 Ga0207687_10798275 3300025927 Bacteria 805
209 Ga0207700_10013529 3300025928 Bacteria 5313
210 Ga0207700_10167373 3300025928 Bacteria 1830
211 Ga0207664_10248221 3300025929 Bacteria 1552
212 Ga0207644_10029024 3300025931 Bacteria 3835
213 Ga0207644_10040007 3300025931 Bacteria 3311
214 Ga0207644_10162302 3300025931 Bacteria 1738
215 Ga0207690_10271159 3300025932 Unclassified 1318
216 Ga0207669_10084707 3300025937 Unclassified 2043
217 Ga0207669_10250439 3300025937 Bacteria 1319
218 Ga0207669_10333286 3300025937 Unclassified 1166
219 Ga0207704_10019809 3300025938 Bacteria 3544
220 Ga0207665_10066411 3300025939 Bacteria 2455
221 Ga0207691_10000786 3300025940 Bacteria 31520
222 Ga0207667_10011801 3300025949 Bacteria 10122
223 Ga0207651_10488698 3300025960 Bacteria 1062
224 Ga0207668_10746040 3300025972 Bacteria 863
225 Ga0207658_10082121 3300025986 Bacteria 2474
226 Ga0207677_10967362 3300026023 Bacteria 770
227 Ga0207703_10017102 3300026035 Bacteria 5655
228 Ga0207703_10282555 3300026035 Bacteria 1508
229 Ga0207703_10832532 3300026035 Bacteria 882
230 Ga0207639_10000009 3300026041 Bacteria 432727
231 Ga0207639_10322978 3300026041 Bacteria 1371
232 Ga0207702_10003398 3300026078 Bacteria 14576
233 Ga0207641_10513017 3300026088 Bacteria 1165
234 Ga0207648_10051733 3300026089 Bacteria 3590
235 Ga0207674_10532270 3300026116 Bacteria 1135
236 Ga0207683_10015250 3300026121 Bacteria 6540
237 Ga0268266_10348732 3300028379 Bacteria 1391
238 Ga0268264_10000563 3300028381 Bacteria 45674
239 Ga0265319_1007559 3300028563 Bacteria 4867
240 Ga0265336_10001204 3300028666 Bacteria 12261
241 Ga0265338_10001425 3300028800 Bacteria 38871
242 Ga0265338_10006831 3300028800 Bacteria 14375
243 Ga0265338_10031607 3300028800 Bacteria 5186
244 Ga0265338_10147808 3300028800 Bacteria 1830
245 Ga0265332_10060597 3300031238 Bacteria 1619
246 Ga0265320_10013473 3300031240 Bacteria 4702
247 Ga0265327_10220730 3300031251 Bacteria 852
248 Ga0265316_10009401 3300031344 Bacteria 9003
249 Ga0307513_10051728 3300031456 Bacteria 4429
250 Ga0265313_10001405 3300031595 Bacteria 22549
251 Ga0373936_0086282 3300035113 Bacteria 1311
252 Ga0373953_0250509 3300035117 Unclassified 770
253 Ga0373954_0021485 3300035118 Bacteria 2923
254 Ga0373956_0048156 3300035119 Bacteria 1908
255 Ga0373946_0332190 3300035171 Bacteria 757
256 Ga0373955_0087196 3300035172 Bacteria 1774
257 Ga0373955_0087800 3300035172 Bacteria 1768
258 Ga0316574_0006761 3300035398 Bacteria 6229
259 Ga0373935_0333134 3300035692 Bacteria 1079
260 Ga0373927_0196491 3300035695 Bacteria 1324
261 Ga0373933_0012443 3300035724 Bacteria 4698
262 Ga0373933_0250846 3300035724 Bacteria 1140
263 Ga0373933_0418962 3300035724 Bacteria 875
264 Ga0373933_0799723 3300035724 Unclassified 621
265 Ga0373947_0033205 3300035725 Bacteria 3045
266 Ga0373937_0001191 3300036401 Bacteria 21823
267 Ga0373937_0002365 3300036401 Bacteria 15706
268 Ga0373937_0310960 3300036401 Bacteria 1490
269 Ga0316584_0085069 3300036712 Unclassified 2368
270 Ga0373925_1317450 3300037068 Unclassified 592
271 Ga0395899_0000020 3300037312 Bacteria 404354
272 Ga0395898_0000005 3300037466 Bacteria 621247
273 Ga0395898_0019151 3300037466 Bacteria 6969
274 Ga0395898_0465190 3300037466 Archaea 1204
275 Ga0395898_0800067 3300037466 Unclassified 883
276 Ga0395905_0209432 3300037471 Bacteria 1827
277 Ga0436364_0441573 3300037853 Bacteria 965
278 Ga0395901_0002558 3300038443 Bacteria 18424
279 Ga0395901_0157772 3300038443 Unclassified 2383
280 Ga0395901_0207841 3300038443 Unclassified 2050
281 Ga0395901_0451862 3300038443 Bacteria 1314
282 Ga0436365_0697187 3300039437 Bacteria 3564
283 Ga0436365_1198295 3300039437 Bacteria 7257
284 Ga0436365_1810650 3300039437 Bacteria 50427
285 Ga0436360_1260888 3300039438 Bacteria 4219
286 Ga0436361_0892360 3300039447 Bacteria 4928
287 Ga0436363_1014064 3300039450 Unclassified 1251
288 Ga0436362_0993857 3300039453 Bacteria 2356
289 Ga0451795_1469800 3300041456 Unclassified 1070
290 Ga0451837_1354135 3300041494 Unclassified 798
291 Ga0451577_0010770 3300042876 Bacteria 8701
292 Ga0451577_0101961 3300042876 Unclassified 2564
293 Ga0451577_0199515 3300042876 Bacteria 1806
294 Ga0466965_0008907 3300044683 Bacteria 4652
295 Ga0466966_0180727 3300044684 Bacteria 1280
296 Ga0466963_0101405 3300044694 Bacteria 1971
297 Ga0466964_0015317 3300044706 Bacteria 2917
298 Ga0466971_0000040 3300044719 Bacteria 51554
299 Ga0466957_0019445 3300044842 Bacteria 3995
300 Ga0466957_0034036 3300044842 Bacteria 3056
301 Ga0451576_0024910 3300045051 Bacteria 6456
302 Ga0451576_0174022 3300045051 Bacteria 2247
303 Ga0451576_0241957 3300045051 Bacteria 1885
304 Ga0451576_1148898 3300045051 Bacteria 812
305 Ga0466967_0196551 3300045976 Bacteria 1908
306 Ga0495629_0040550 3300046459 Bacteria 3275
307 Ga0495651_0036790 3300046462 Bacteria 3811
308 Ga0495580_0672156 3300046472 Unclassified 680
309 Ga0495608_0074295 3300046511 Bacteria 2216
310 Ga0495618_0002339 3300046514 Bacteria 12236
311 Ga0495643_0000894 3300046522 Bacteria 31755
312 Ga0495652_0008016 3300046529 Bacteria 9684
313 Ga0495640_0033865 3300046533 Bacteria 3629
314 Ga0495586_0001721 3300046535 Bacteria 11945
315 Ga0495587_0241139 3300046536 Unclassified 1017
316 Ga0495667_0121191 3300046559 Bacteria 1688
317 Ga0495634_0002486 3300046642 Bacteria 15285
318 Ga0495635_0066203 3300046663 Bacteria 2478
319 Ga0495599_0096905 3300046678 Bacteria 1839
320 Ga0495646_0065359 3300046680 Bacteria 2154
321 Ga0495646_0251150 3300046680 Bacteria 947
322 Ga0495647_0027199 3300046681 Bacteria 2101
323 Ga0495613_0002720 3300046689 Bacteria 13263
324 Ga0495613_0262885 3300046689 Bacteria 1202
325 Ga0495624_0422217 3300046690 Unclassified 800
326 Ga0495674_0082798 3300047319 Unclassified 2751
327 Ga0495680_0214882 3300047322 Bacteria 1375
328 Ga0495684_0021703 3300047471 Bacteria 4944
329 Ga0495684_0149343 3300047471 Bacteria 1748
330 Ga0495602_0480325 3300048088 Bacteria 872
331 Ga0496100_0201842 3300048903 Bacteria 1450
332 Ga0496109_0021164 3300048912 Bacteria 5751
333 Ga0496109_0321620 3300048912 Bacteria 1460
334 Ga0496112_0187122 3300048915 Bacteria 2034
335 Ga0496115_0272987 3300048918 Bacteria 1389
336 Ga0496121_0206099 3300048924 Bacteria 1397
337 Ga0501032_0047336 3300049569 Bacteria 2904
338 Ga0501036_0242268 3300049572 Bacteria 1512
339 Ga0501037_0000044 3300049573 Bacteria 117895
340 Ga0501039_0003683 3300049575 Bacteria 11486
341 Ga0501043_0000142 3300049579 Bacteria 67246
342 Ga0501043_0000667 3300049579 Bacteria 30257
343 Ga0501047_0007058 3300049581 Bacteria 10550
344 Ga0501047_0071684 3300049581 Bacteria 3335
345 Ga0501048_0563849 3300049582 Archaea 817
346 Ga0501070_0019648 3300049586 Bacteria 5664
347 Ga0501080_0165749 3300049742 Bacteria 2039
348 Ga0501035_0000001 3300049822 Bacteria 1037138
349 Ga0501044_0004304 3300049823 Bacteria 15966
350 nmdc:mga05p37_329241_c1 3300050507 Unclassified 1805
351 nmdc:mga08y16_935644_c1 3300050511 Unclassified 851
352 Ga0495619_0554089 3300053085 Unclassified 788
353 Ga0500616_0003907 3300053153 Bacteria 10960
354 Ga0466962_0000003 3300061719 Bacteria 187594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_100872890 Ga0070688_1008728901 162
2 3300005331 Ga0070670_100094569 Ga0070670_1000945692 177
3 3300025925 Ga0207650_10287005 Ga0207650_102870052 177
4 3300025910 Ga0207684_10018448 Ga0207684_100184484 178
5 3300035398 Ga0316574_0006761 Ga0316574_0006761_3105_3671 178
6 3300036712 Ga0316584_0085069 Ga0316584_0085069_1783_2349 178
7 3300005331 Ga0070670_100599139 Ga0070670_1005991392 181
8 3300005331 Ga0070670_101048000 Ga0070670_1010480001 181
9 3300005353 Ga0070669_100200506 Ga0070669_1002005062 181
10 3300005543 Ga0070672_100714102 Ga0070672_1007141021 181
11 3300026116 Ga0207674_10532270 Ga0207674_105322701 181
12 3300005937 Ga0081455_10021737 Ga0081455_100217374 183
13 3300041456 Ga0451795_1469800 Ga0451795_1469800_400_1011 185
14 3300041494 Ga0451837_1354135 Ga0451837_1354135_103_714 185
15 3300042876 Ga0451577_0199515 Ga0451577_0199515_187_759 185
16 3300045051 Ga0451576_0241957 Ga0451576_0241957_561_1133 185
17 3300005355 Ga0070671_100114408 Ga0070671_1001144083 186
18 3300025931 Ga0207644_10162302 Ga0207644_101623022 186
19 3300037466 Ga0395898_0000005 Ga0395898_0000005_86313_86876 186
20 3300044683 Ga0466965_0008907 Ga0466965_0008907_3462_4025 186
21 3300044694 Ga0466963_0101405 Ga0466963_0101405_485_1048 186
22 3300044706 Ga0466964_0015317 Ga0466964_0015317_938_1501 186
23 3300044719 Ga0466971_0000040 Ga0466971_0000040_24470_25033 186
24 3300044842 Ga0466957_0019445 Ga0466957_0019445_2146_2709 186
25 3300045976 Ga0466967_0196551 Ga0466967_0196551_616_1179 186
26 3300049569 Ga0501032_0047336 Ga0501032_0047336_1546_2109 186
27 3300061719 Ga0466962_0000003 Ga0466962_0000003_26522_27085 186
28 3300005331 Ga0070670_100352935 Ga0070670_1003529352 187
29 3300005335 Ga0070666_10017145 Ga0070666_100171456 187
30 3300005353 Ga0070669_100307413 Ga0070669_1003074132 187
31 3300005365 Ga0070688_100175086 Ga0070688_1001750862 187
32 3300005564 Ga0070664_100094178 Ga0070664_1000941782 187
33 3300005617 Ga0068859_100196065 Ga0068859_1001960653 187
34 3300006871 Ga0075434_100313201 Ga0075434_1003132012 187
35 3300006931 Ga0097620_100196066 Ga0097620_1001960662 187
36 3300009093 Ga0105240_10000069 Ga0105240_100000694 187
37 3300009093 Ga0105240_11191814 Ga0105240_111918141 187
38 3300009553 Ga0105249_10789044 Ga0105249_107890442 187
39 3300010375 Ga0105239_10139955 Ga0105239_101399552 187
40 3300013308 Ga0157375_10000006 Ga0157375_10000006180 187
41 3300013308 Ga0157375_10614325 Ga0157375_106143252 187
42 3300014326 Ga0157380_10423975 Ga0157380_104239752 187
43 3300025903 Ga0207680_10027263 Ga0207680_100272632 187
44 3300025913 Ga0207695_10000186 Ga0207695_10000186132 187
45 3300026078 Ga0207702_10003398 Ga0207702_1000339810 187
46 3300028563 Ga0265319_1007559 Ga0265319_10075593 187
47 3300028666 Ga0265336_10001204 Ga0265336_100012047 187
48 3300028800 Ga0265338_10001425 Ga0265338_1000142510 187
49 3300028800 Ga0265338_10006831 Ga0265338_1000683119 187
50 3300028800 Ga0265338_10031607 Ga0265338_100316072 187
51 3300028800 Ga0265338_10147808 Ga0265338_101478082 187
52 3300031238 Ga0265332_10060597 Ga0265332_100605972 187
53 3300031240 Ga0265320_10013473 Ga0265320_100134734 187
54 3300031251 Ga0265327_10220730 Ga0265327_102207301 187
55 3300031344 Ga0265316_10009401 Ga0265316_100094015 187
56 3300031595 Ga0265313_10001405 Ga0265313_100014058 187
57 3300035113 Ga0373936_0086282 Ga0373936_0086282_414_977 187
58 3300035118 Ga0373954_0021485 Ga0373954_0021485_1882_2448 187
59 3300035119 Ga0373956_0048156 Ga0373956_0048156_682_1248 187
60 3300035172 Ga0373955_0087196 Ga0373955_0087196_142_705 187
61 3300035172 Ga0373955_0087800 Ga0373955_0087800_566_1132 187
62 3300035724 Ga0373933_0012443 Ga0373933_0012443_21_587 187
63 3300035724 Ga0373933_0250846 Ga0373933_0250846_244_807 187
64 3300036401 Ga0373937_0001191 Ga0373937_0001191_9334_9900 187
65 3300036401 Ga0373937_0002365 Ga0373937_0002365_13413_13976 187
66 3300037312 Ga0395899_0000020 Ga0395899_0000020_74198_74809 187
67 3300042876 Ga0451577_0010770 Ga0451577_0010770_7093_7659 187
68 3300042876 Ga0451577_0101961 Ga0451577_0101961_596_1171 187
69 3300044842 Ga0466957_0034036 Ga0466957_0034036_1123_1719 187
70 3300045051 Ga0451576_0174022 Ga0451576_0174022_372_950 187
71 3300045051 Ga0451576_1148898 Ga0451576_1148898_107_673 187
72 3300046459 Ga0495629_0040550 Ga0495629_0040550_65_631 187
73 3300046462 Ga0495651_0036790 Ga0495651_0036790_2178_2741 187
74 3300046511 Ga0495608_0074295 Ga0495608_0074295_1137_1700 187
75 3300046514 Ga0495618_0002339 Ga0495618_0002339_9523_10089 187
76 3300046529 Ga0495652_0008016 Ga0495652_0008016_8681_9244 187
77 3300046533 Ga0495640_0033865 Ga0495640_0033865_1401_1964 187
78 3300046535 Ga0495586_0001721 Ga0495586_0001721_4569_5135 187
79 3300046559 Ga0495667_0121191 Ga0495667_0121191_429_995 187
80 3300046642 Ga0495634_0002486 Ga0495634_0002486_2242_2808 187
81 3300046663 Ga0495635_0066203 Ga0495635_0066203_920_1486 187
82 3300046678 Ga0495599_0096905 Ga0495599_0096905_1033_1596 187
83 3300046680 Ga0495646_0251150 Ga0495646_0251150_40_603 187
84 3300046681 Ga0495647_0027199 Ga0495647_0027199_1064_1630 187
85 3300046689 Ga0495613_0002720 Ga0495613_0002720_12509_13075 187
86 3300046689 Ga0495613_0262885 Ga0495613_0262885_165_731 187
87 3300046690 Ga0495624_0422217 Ga0495624_0422217_33_596 187
88 3300047319 Ga0495674_0082798 Ga0495674_0082798_1977_2540 187
89 3300047322 Ga0495680_0214882 Ga0495680_0214882_627_1190 187
90 3300047471 Ga0495684_0021703 Ga0495684_0021703_1853_2416 187
91 3300047471 Ga0495684_0149343 Ga0495684_0149343_588_1154 187
92 3300048088 Ga0495602_0480325 Ga0495602_0480325_103_666 187
93 3300049572 Ga0501036_0242268 Ga0501036_0242268_35_601 187
94 3300049573 Ga0501037_0000044 Ga0501037_0000044_98943_99509 187
95 3300049575 Ga0501039_0003683 Ga0501039_0003683_5565_6131 187
96 3300049579 Ga0501043_0000142 Ga0501043_0000142_62330_62896 187
97 3300049579 Ga0501043_0000667 Ga0501043_0000667_25389_25955 187
98 3300049581 Ga0501047_0007058 Ga0501047_0007058_6001_6567 187
99 3300049581 Ga0501047_0071684 Ga0501047_0071684_1067_1642 187
100 3300049582 Ga0501048_0563849 Ga0501048_0563849_102_668 187
101 3300049586 Ga0501070_0019648 Ga0501070_0019648_3967_4533 187
102 3300049822 Ga0501035_0000001 Ga0501035_0000001_632475_633041 187
103 3300049823 Ga0501044_0004304 Ga0501044_0004304_2064_2630 187
104 2162886007 SwRhRL2b_contig_2742384 SwRhRL2b_0115.00000390 188
105 2162886012 MBSR1b_contig_11670001 MBSR1b_0221.00003110 188
106 3300003320 rootH2_10310919 rootH2_103109192 188
107 3300003322 rootL2_10103863 rootL2_101038635 188
108 3300005272 Ga0065703_1018946 Ga0065703_10189465 188
109 3300005289 Ga0065704_10006717 Ga0065704_100067172 188
110 3300005289 Ga0065704_10080585 Ga0065704_100805853 188
111 3300005289 Ga0065704_10151491 Ga0065704_101514911 188
112 3300005290 Ga0065712_10161874 Ga0065712_101618742 188
113 3300005290 Ga0065712_10199873 Ga0065712_101998732 188
114 3300005293 Ga0065715_10000421 Ga0065715_100004215 188
115 3300005295 Ga0065707_10392183 Ga0065707_103921831 188
116 3300005327 Ga0070658_10467387 Ga0070658_104673871 188
117 3300005327 Ga0070658_10482515 Ga0070658_104825151 188
118 3300005328 Ga0070676_10076550 Ga0070676_100765502 188
119 3300005328 Ga0070676_10077305 Ga0070676_100773053 188
120 3300005328 Ga0070676_10160843 Ga0070676_101608432 188
121 3300005329 Ga0070683_100065580 Ga0070683_1000655805 188
122 3300005335 Ga0070666_10024577 Ga0070666_100245773 188
123 3300005335 Ga0070666_10069414 Ga0070666_100694142 188
124 3300005339 Ga0070660_100409916 Ga0070660_1004099162 188
125 3300005339 Ga0070660_101089797 Ga0070660_1010897971 188
126 3300005340 Ga0070689_100015602 Ga0070689_1000156022 188
127 3300005347 Ga0070668_100042150 Ga0070668_1000421504 188
128 3300005347 Ga0070668_100295765 Ga0070668_1002957652 188
129 3300005353 Ga0070669_100023536 Ga0070669_1000235362 188
130 3300005354 Ga0070675_100011832 Ga0070675_1000118325 188
131 3300005354 Ga0070675_100642025 Ga0070675_1006420251 188
132 3300005355 Ga0070671_100013870 Ga0070671_1000138704 188
133 3300005356 Ga0070674_100009944 Ga0070674_1000099445 188
134 3300005364 Ga0070673_100007746 Ga0070673_1000077464 188
135 3300005364 Ga0070673_100147459 Ga0070673_1001474592 188
136 3300005365 Ga0070688_100387446 Ga0070688_1003874461 188
137 3300005366 Ga0070659_100399578 Ga0070659_1003995782 188
138 3300005367 Ga0070667_100090804 Ga0070667_1000908043 188
139 3300005434 Ga0070709_10008217 Ga0070709_100082172 188
140 3300005435 Ga0070714_100028795 Ga0070714_1000287952 188
141 3300005436 Ga0070713_100534155 Ga0070713_1005341552 188
142 3300005437 Ga0070710_10050272 Ga0070710_100502722 188
143 3300005437 Ga0070710_10170545 Ga0070710_101705452 188
144 3300005439 Ga0070711_100085444 Ga0070711_1000854442 188
145 3300005439 Ga0070711_100121146 Ga0070711_1001211463 188
146 3300005439 Ga0070711_100180105 Ga0070711_1001801051 188
147 3300005439 Ga0070711_100231049 Ga0070711_1002310492 188
148 3300005439 Ga0070711_100233226 Ga0070711_1002332262 188
149 3300005440 Ga0070705_100108641 Ga0070705_1001086413 188
150 3300005445 Ga0070708_100024411 Ga0070708_1000244112 188
151 3300005445 Ga0070708_100035413 Ga0070708_1000354131 188
152 3300005445 Ga0070708_100041822 Ga0070708_1000418222 188
153 3300005445 Ga0070708_100098748 Ga0070708_1000987482 188
154 3300005445 Ga0070708_100244067 Ga0070708_1002440673 188
155 3300005445 Ga0070708_100298223 Ga0070708_1002982231 188
156 3300005456 Ga0070678_100099366 Ga0070678_1000993662 188
157 3300005459 Ga0068867_100047461 Ga0068867_1000474612 188
158 3300005466 Ga0070685_10111433 Ga0070685_101114331 188
159 3300005467 Ga0070706_100000035 Ga0070706_10000003593 188
160 3300005467 Ga0070706_100013032 Ga0070706_1000130328 188
161 3300005467 Ga0070706_100020122 Ga0070706_1000201224 188
162 3300005467 Ga0070706_100126647 Ga0070706_1001266472 188
163 3300005467 Ga0070706_100133141 Ga0070706_1001331413 188
164 3300005467 Ga0070706_100339360 Ga0070706_1003393601 188
165 3300005468 Ga0070707_100002278 Ga0070707_10000227816 188
166 3300005468 Ga0070707_100010859 Ga0070707_1000108594 188
167 3300005468 Ga0070707_100027638 Ga0070707_1000276384 188
168 3300005468 Ga0070707_100036698 Ga0070707_1000366985 188
169 3300005468 Ga0070707_100050118 Ga0070707_1000501183 188
170 3300005468 Ga0070707_100193204 Ga0070707_1001932043 188
171 3300005468 Ga0070707_100338122 Ga0070707_1003381222 188
172 3300005468 Ga0070707_100506935 Ga0070707_1005069352 188
173 3300005468 Ga0070707_101192025 Ga0070707_1011920251 188
174 3300005468 Ga0070707_101240547 Ga0070707_1012405471 188
175 3300005468 Ga0070707_101484443 Ga0070707_1014844431 188
176 3300005471 Ga0070698_100004983 Ga0070698_10000498311 188
177 3300005471 Ga0070698_100006835 Ga0070698_1000068357 188
178 3300005471 Ga0070698_100052592 Ga0070698_1000525922 188
179 3300005471 Ga0070698_100387100 Ga0070698_1003871002 188
180 3300005518 Ga0070699_100120222 Ga0070699_1001202222 188
181 3300005518 Ga0070699_100229532 Ga0070699_1002295323 188
182 3300005536 Ga0070697_100015877 Ga0070697_1000158776 188
183 3300005536 Ga0070697_100019738 Ga0070697_1000197384 188
184 3300005536 Ga0070697_100032710 Ga0070697_1000327101 188
185 3300005536 Ga0070697_100055004 Ga0070697_1000550043 188
186 3300005536 Ga0070697_100127881 Ga0070697_1001278811 188
187 3300005536 Ga0070697_100158000 Ga0070697_1001580001 188
188 3300005539 Ga0068853_100000002 Ga0068853_100000002313 188
189 3300005539 Ga0068853_100404072 Ga0068853_1004040722 188
190 3300005543 Ga0070672_100006021 Ga0070672_1000060214 188
191 3300005545 Ga0070695_100073769 Ga0070695_1000737692 188
192 3300005548 Ga0070665_100522596 Ga0070665_1005225961 188
193 3300005548 Ga0070665_100758534 Ga0070665_1007585341 188
194 3300005548 Ga0070665_100806791 Ga0070665_1008067912 188
195 3300005563 Ga0068855_100004104 Ga0068855_10000410419 188
196 3300005564 Ga0070664_100073661 Ga0070664_1000736612 188
197 3300005618 Ga0068864_100389019 Ga0068864_1003890191 188
198 3300005841 Ga0068863_100045582 Ga0068863_1000455826 188
199 3300005841 Ga0068863_100253600 Ga0068863_1002536002 188
200 3300005841 Ga0068863_100865018 Ga0068863_1008650182 188
201 3300005842 Ga0068858_100105563 Ga0068858_1001055632 188
202 3300005842 Ga0068858_100255552 Ga0068858_1002555522 188
203 3300005842 Ga0068858_100487356 Ga0068858_1004873561 188
204 3300005842 Ga0068858_100703019 Ga0068858_1007030192 188
205 3300005843 Ga0068860_100001252 Ga0068860_10000125211 188
206 3300005937 Ga0081455_10001011 Ga0081455_1000101130 188
207 3300005937 Ga0081455_10046729 Ga0081455_100467291 188
208 3300005983 Ga0081540_1000018 Ga0081540_1000018152 188
209 3300005985 Ga0081539_10000287 Ga0081539_1000028756 188
210 3300005985 Ga0081539_10001712 Ga0081539_1000171212 188
211 3300006028 Ga0070717_10048038 Ga0070717_100480383 188
212 3300006028 Ga0070717_10079637 Ga0070717_100796372 188
213 3300006028 Ga0070717_10105847 Ga0070717_101058472 188
214 3300006028 Ga0070717_10322837 Ga0070717_103228372 188
215 3300006028 Ga0070717_10459014 Ga0070717_104590142 188
216 3300006028 Ga0070717_10639900 Ga0070717_106399002 188
217 3300006173 Ga0070716_100140143 Ga0070716_1001401432 188
218 3300006175 Ga0070712_100191235 Ga0070712_1001912353 188
219 3300006175 Ga0070712_100290840 Ga0070712_1002908402 188
220 3300006175 Ga0070712_100415685 Ga0070712_1004156852 188
221 3300006175 Ga0070712_100922957 Ga0070712_1009229572 188
222 3300006237 Ga0097621_100012002 Ga0097621_1000120026 188
223 3300006237 Ga0097621_100299772 Ga0097621_1002997722 188
224 3300006358 Ga0068871_101061301 Ga0068871_1010613011 188
225 3300006358 Ga0068871_101513720 Ga0068871_1015137201 188
226 3300006871 Ga0075434_100336264 Ga0075434_1003362642 188
227 3300007076 Ga0075435_100747813 Ga0075435_1007478131 188
228 3300009094 Ga0111539_10224743 Ga0111539_102247433 188
229 3300009094 Ga0111539_10489170 Ga0111539_104891703 188
230 3300009098 Ga0105245_10817842 Ga0105245_108178422 188
231 3300009147 Ga0114129_10222625 Ga0114129_102226252 188
232 3300009176 Ga0105242_10585830 Ga0105242_105858302 188
233 3300009545 Ga0105237_10005057 Ga0105237_100050573 188
234 3300009545 Ga0105237_10382834 Ga0105237_103828342 188
235 3300009553 Ga0105249_10676890 Ga0105249_106768901 188
236 3300010375 Ga0105239_10142763 Ga0105239_101427632 188
237 3300010375 Ga0105239_10293348 Ga0105239_102933482 188
238 3300010375 Ga0105239_11234600 Ga0105239_112346002 188
239 3300013296 Ga0157374_10000057 Ga0157374_1000005724 188
240 3300013296 Ga0157374_10010066 Ga0157374_100100666 188
241 3300013296 Ga0157374_10033590 Ga0157374_100335901 188
242 3300013296 Ga0157374_10136227 Ga0157374_101362272 188
243 3300013297 Ga0157378_10026609 Ga0157378_100266094 188
244 3300013297 Ga0157378_10150801 Ga0157378_101508013 188
245 3300013297 Ga0157378_10382418 Ga0157378_103824182 188
246 3300013297 Ga0157378_10752965 Ga0157378_107529651 188
247 3300013306 Ga0163162_10013581 Ga0163162_100135814 188
248 3300013308 Ga0157375_10036685 Ga0157375_100366853 188
249 3300013308 Ga0157375_10107973 Ga0157375_101079732 188
250 3300013308 Ga0157375_12616870 Ga0157375_126168701 188
251 3300014497 Ga0182008_10018991 Ga0182008_100189912 188
252 3300014745 Ga0157377_10051023 Ga0157377_100510232 188
253 3300014969 Ga0157376_10000357 Ga0157376_1000035714 188
254 3300014969 Ga0157376_10292959 Ga0157376_102929592 188
255 3300014969 Ga0157376_11620262 Ga0157376_116202621 188
256 3300025315 Ga0207697_10000257 Ga0207697_1000025718 188
257 3300025315 Ga0207697_10005265 Ga0207697_100052652 188
258 3300025315 Ga0207697_10013644 Ga0207697_100136443 188
259 3300025315 Ga0207697_10020366 Ga0207697_100203663 188
260 3300025901 Ga0207688_10004727 Ga0207688_100047276 188
261 3300025906 Ga0207699_10016136 Ga0207699_100161365 188
262 3300025907 Ga0207645_10119773 Ga0207645_101197732 188
263 3300025907 Ga0207645_10236475 Ga0207645_102364751 188
264 3300025910 Ga0207684_10000043 Ga0207684_1000004329 188
265 3300025910 Ga0207684_10002807 Ga0207684_100028074 188
266 3300025910 Ga0207684_10004414 Ga0207684_100044147 188
267 3300025910 Ga0207684_10027121 Ga0207684_100271211 188
268 3300025914 Ga0207671_10004700 Ga0207671_100047008 188
269 3300025914 Ga0207671_10128071 Ga0207671_101280713 188
270 3300025915 Ga0207693_10076402 Ga0207693_100764023 188
271 3300025915 Ga0207693_10128348 Ga0207693_101283481 188
272 3300025915 Ga0207693_10179303 Ga0207693_101793032 188
273 3300025915 Ga0207693_10280000 Ga0207693_102800002 188
274 3300025915 Ga0207693_10348311 Ga0207693_103483112 188
275 3300025916 Ga0207663_10366966 Ga0207663_103669661 188
276 3300025922 Ga0207646_10004744 Ga0207646_1000474411 188
277 3300025922 Ga0207646_10005562 Ga0207646_1000556210 188
278 3300025922 Ga0207646_10012526 Ga0207646_100125264 188
279 3300025922 Ga0207646_10128557 Ga0207646_101285573 188
280 3300025922 Ga0207646_10382814 Ga0207646_103828142 188
281 3300025923 Ga0207681_10058606 Ga0207681_100586062 188
282 3300025926 Ga0207659_10097413 Ga0207659_100974132 188
283 3300025926 Ga0207659_11085673 Ga0207659_110856732 188
284 3300025927 Ga0207687_10798275 Ga0207687_107982751 188
285 3300025928 Ga0207700_10013529 Ga0207700_100135292 188
286 3300025928 Ga0207700_10167373 Ga0207700_101673732 188
287 3300025929 Ga0207664_10248221 Ga0207664_102482212 188
288 3300025931 Ga0207644_10029024 Ga0207644_100290243 188
289 3300025931 Ga0207644_10040007 Ga0207644_100400072 188
290 3300025932 Ga0207690_10271159 Ga0207690_102711592 188
291 3300025937 Ga0207669_10084707 Ga0207669_100847072 188
292 3300025937 Ga0207669_10250439 Ga0207669_102504393 188
293 3300025937 Ga0207669_10333286 Ga0207669_103332862 188
294 3300025938 Ga0207704_10019809 Ga0207704_100198094 188
295 3300025939 Ga0207665_10066411 Ga0207665_100664112 188
296 3300025940 Ga0207691_10000786 Ga0207691_1000078624 188
297 3300025949 Ga0207667_10011801 Ga0207667_100118015 188
298 3300025960 Ga0207651_10488698 Ga0207651_104886982 188
299 3300025972 Ga0207668_10746040 Ga0207668_107460401 188
300 3300025986 Ga0207658_10082121 Ga0207658_100821213 188
301 3300026023 Ga0207677_10967362 Ga0207677_109673621 188
302 3300026035 Ga0207703_10017102 Ga0207703_100171024 188
303 3300026035 Ga0207703_10282555 Ga0207703_102825551 188
304 3300026035 Ga0207703_10832532 Ga0207703_108325322 188
305 3300026041 Ga0207639_10000009 Ga0207639_10000009269 188
306 3300026041 Ga0207639_10322978 Ga0207639_103229782 188
307 3300026088 Ga0207641_10513017 Ga0207641_105130172 188
308 3300026089 Ga0207648_10051733 Ga0207648_100517332 188
309 3300026121 Ga0207683_10015250 Ga0207683_100152502 188
310 3300028379 Ga0268266_10348732 Ga0268266_103487322 188
311 3300028381 Ga0268264_10000563 Ga0268264_1000056313 188
312 3300031456 Ga0307513_10051728 Ga0307513_100517284 188
313 3300035117 Ga0373953_0250509 Ga0373953_0250509_126_692 188
314 3300035171 Ga0373946_0332190 Ga0373946_0332190_159_725 188
315 3300035692 Ga0373935_0333134 Ga0373935_0333134_91_657 188
316 3300035695 Ga0373927_0196491 Ga0373927_0196491_600_1166 188
317 3300035724 Ga0373933_0418962 Ga0373933_0418962_90_656 188
318 3300035724 Ga0373933_0799723 Ga0373933_0799723_17_583 188
319 3300035725 Ga0373947_0033205 Ga0373947_0033205_34_600 188
320 3300036401 Ga0373937_0310960 Ga0373937_0310960_865_1431 188
321 3300037068 Ga0373925_1317450 Ga0373925_1317450_15_581 188
322 3300037466 Ga0395898_0019151 Ga0395898_0019151_2629_3195 188
323 3300037466 Ga0395898_0465190 Ga0395898_0465190_261_827 188
324 3300037466 Ga0395898_0800067 Ga0395898_0800067_235_801 188
325 3300037471 Ga0395905_0209432 Ga0395905_0209432_721_1287 188
326 3300037853 Ga0436364_0441573 Ga0436364_0441573_169_735 188
327 3300038443 Ga0395901_0002558 Ga0395901_0002558_13204_13770 188
328 3300038443 Ga0395901_0157772 Ga0395901_0157772_48_617 188
329 3300038443 Ga0395901_0207841 Ga0395901_0207841_711_1277 188
330 3300038443 Ga0395901_0451862 Ga0395901_0451862_75_641 188
331 3300039437 Ga0436365_0697187 Ga0436365_0697187_2886_3458 188
332 3300039437 Ga0436365_1198295 Ga0436365_1198295_691_1260 188
333 3300039437 Ga0436365_1810650 Ga0436365_1810650_3418_3984 188
334 3300039438 Ga0436360_1260888 Ga0436360_1260888_564_1130 188
335 3300039447 Ga0436361_0892360 Ga0436361_0892360_2748_3314 188
336 3300039450 Ga0436363_1014064 Ga0436363_1014064_337_903 188
337 3300039453 Ga0436362_0993857 Ga0436362_0993857_1260_1826 188
338 3300044684 Ga0466966_0180727 Ga0466966_0180727_184_753 188
339 3300045051 Ga0451576_0024910 Ga0451576_0024910_5635_6201 188
340 3300046472 Ga0495580_0672156 Ga0495580_0672156_32_598 188
341 3300046522 Ga0495643_0000894 Ga0495643_0000894_28384_28953 188
342 3300046536 Ga0495587_0241139 Ga0495587_0241139_106_672 188
343 3300046680 Ga0495646_0065359 Ga0495646_0065359_273_839 188
344 3300048903 Ga0496100_0201842 Ga0496100_0201842_422_988 188
345 3300048912 Ga0496109_0021164 Ga0496109_0021164_2167_2733 188
346 3300048912 Ga0496109_0321620 Ga0496109_0321620_435_1007 188
347 3300048915 Ga0496112_0187122 Ga0496112_0187122_345_911 188
348 3300048918 Ga0496115_0272987 Ga0496115_0272987_88_654 188
349 3300048924 Ga0496121_0206099 Ga0496121_0206099_582_1151 188
350 3300049742 Ga0501080_0165749 Ga0501080_0165749_570_1139 188
351 3300050507 nmdc:mga05p37_329241_c1 nmdc:mga05p37_329241_c1_1055_1621 188
352 3300050511 nmdc:mga08y16_935644_c1 nmdc:mga08y16_935644_c1_88_654 188
353 3300053085 Ga0495619_0554089 Ga0495619_0554089_157_723 188
354 3300053153 Ga0500616_0003907 Ga0500616_0003907_5992_6561 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

69

205

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.8888 30 163
4paw-assembly1.cif.gz_A structure of hypothetical protein hp1257. 0.8832 4 185
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.8828 30 163
2aee-assembly1.cif.gz_A crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes 0.8678 2 162
4ohc-assembly1.cif.gz_D crystal structure of orotate phosphoribosyltransferase (oprtase) from burkholderia cenocepacia 0.8535 2 162
ID Description Score Start End Superfamily
4pawB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9137 4 185 3.40.50.2020
4pawB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8813 4 185 3.40.50.2020
af_Q59040_42_210_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8669 31 164 3.40.50.2020
4rv4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8495 2 163 3.40.50.2020
5yw5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8468 30 163 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A538NGA5-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9908 1 188 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A2V6HME3-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.99 1 168 GO:0004588
GO:0019856
GO:0044205
AF-A0A538NGA5-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9856 1 188 GO:0000287
GO:0004588
GO:0019856
GO:0044205
AF-A0A2V6HME3-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9842 1 168 GO:0004588
GO:0019856
GO:0044205
AF-A0A2V9PQC8-F1-model_v4 Orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9791 1 144 GO:0004588
GO:0019856
GO:0044205

Feature Viewer

pLDDT pTM Quality
93.47 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map