F419427

General Info

Members Datasets Scaffolds Average Seq Length
353 263 706 136

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10031687|Ga0265316_100316872
Length 160
Sequence MSTTMTAEMPQQIASASPATNRGFQVQPYLFFNGRCEEAVEFYRRALGAEVTMLARFKDNPEPIPPDSENKIMHVSFRVGDTTVMASDGGCNGEQKFEGFSLSLTVPDADAAERAFASLANGGRVEMPLTKTFFSPRFGMVEDRFGVSWMIYVAQQHGLP

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
6 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
207 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
232 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
233 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
234 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
260 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
263 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.57
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10031687 3300031344 Unclassified 4320
2 JGI24739J22299_10102753 3300001989 Bacteria 862
3 JGI24738J21930_10054561 3300002075 Bacteria 816
4 JGI26145J50221_1000096 3300003371 Bacteria 6878
5 JGI26134J50242_103319 3300003392 Bacteria 551
6 JGI26133J50247_102110 3300003397 Bacteria 649
7 Ga0065704_10001227 3300005289 Bacteria 11632
8 Ga0065715_10020621 3300005293 Bacteria 3482
9 Ga0065715_10532026 3300005293 Bacteria 755
10 Ga0065707_10001748 3300005295 Bacteria 9030
11 Ga0070676_10004156 3300005328 Bacteria 7603
12 Ga0070683_100103210 3300005329 Bacteria 2687
13 Ga0070690_100000599 3300005330 Bacteria 18205
14 Ga0070690_100041407 3300005330 Bacteria 2916
15 Ga0070670_100004744 3300005331 Bacteria 11412
16 Ga0070677_10002667 3300005333 Bacteria 5710
17 Ga0068869_100034492 3300005334 Bacteria 3580
18 Ga0070666_10627690 3300005335 Bacteria 785
19 Ga0070680_100017536 3300005336 Bacteria 5646
20 Ga0070682_100073346 3300005337 Bacteria 2195
21 Ga0068868_100010929 3300005338 Bacteria 6590
22 Ga0070660_100055948 3300005339 Bacteria 3051
23 Ga0070689_100000804 3300005340 Bacteria 19320
24 Ga0070689_100036501 3300005340 Bacteria 3759
25 Ga0070691_10000240 3300005341 Bacteria 18772
26 Ga0070687_100001696 3300005343 Bacteria 7909
27 Ga0070661_100002485 3300005344 Bacteria 12635
28 Ga0070661_100423222 3300005344 Bacteria 1056
29 Ga0070668_100008190 3300005347 Bacteria 7763
30 Ga0070669_100002951 3300005353 Bacteria 12262
31 Ga0070675_100018569 3300005354 Bacteria 5537
32 Ga0070675_100310239 3300005354 Bacteria 1392
33 Ga0070671_100370837 3300005355 Bacteria 1223
34 Ga0070674_100001339 3300005356 Bacteria 12993
35 Ga0070673_100001861 3300005364 Bacteria 12606
36 Ga0070688_100003744 3300005365 Bacteria 7873
37 Ga0070688_100033351 3300005365 Bacteria 3112
38 Ga0070659_100001082 3300005366 Bacteria 19884
39 Ga0070659_100398293 3300005366 Bacteria 1162
40 Ga0070667_100005324 3300005367 Bacteria 10748
41 Ga0070667_100464141 3300005367 Bacteria 1158
42 Ga0070713_100535952 3300005436 Bacteria 1107
43 Ga0070710_10308083 3300005437 Bacteria 1035
44 Ga0070710_11038336 3300005437 Bacteria 599
45 Ga0070705_100010266 3300005440 Bacteria 4681
46 Ga0070705_100675043 3300005440 Bacteria 809
47 Ga0070700_100000693 3300005441 Bacteria 16629
48 Ga0070694_100005880 3300005444 Bacteria 7440
49 Ga0070694_100433876 3300005444 Bacteria 1034
50 Ga0070694_101511493 3300005444 Unclassified 568
51 Ga0070708_100115814 3300005445 Bacteria 2467
52 Ga0070678_100001478 3300005456 Bacteria 12538
53 Ga0070678_100262507 3300005456 Bacteria 1453
54 Ga0070662_100000059 3300005457 Bacteria 59672
55 Ga0070662_100569044 3300005457 Bacteria 951
56 Ga0070681_10007414 3300005458 Bacteria 10726
57 Ga0068867_100000588 3300005459 Bacteria 24065
58 Ga0068867_101108191 3300005459 Bacteria 723
59 Ga0068867_101587148 3300005459 Unclassified 611
60 Ga0070707_100121924 3300005468 Bacteria 2531
61 Ga0070707_101961645 3300005468 Bacteria 553
62 Ga0070698_100603697 3300005471 Bacteria 1038
63 Ga0070699_100219503 3300005518 Bacteria 1694
64 Ga0070699_100255186 3300005518 Bacteria 1567
65 Ga0070699_102009999 3300005518 Bacteria 528
66 Ga0070679_100020498 3300005530 Bacteria 6447
67 Ga0070679_100055829 3300005530 Bacteria 3934
68 Ga0070684_100002952 3300005535 Bacteria 12658
69 Ga0070684_100961750 3300005535 Bacteria 801
70 Ga0070697_101445544 3300005536 Bacteria 614
71 Ga0070672_100024691 3300005543 Bacteria 4446
72 Ga0070672_100474768 3300005543 Bacteria 1079
73 Ga0070686_100002331 3300005544 Bacteria 10472
74 Ga0070695_100008379 3300005545 Bacteria 6135
75 Ga0070696_100000917 3300005546 Bacteria 19177
76 Ga0070696_100054346 3300005546 Bacteria 2790
77 Ga0070696_100294791 3300005546 Bacteria 1240
78 Ga0070665_100125434 3300005548 Bacteria 2570
79 Ga0070704_100280696 3300005549 Bacteria 1380
80 Ga0070704_101087945 3300005549 Bacteria 726
81 Ga0068855_100076676 3300005563 Bacteria 3879
82 Ga0068855_102131441 3300005563 Bacteria 564
83 Ga0070664_100005553 3300005564 Bacteria 10130
84 Ga0070664_100038990 3300005564 Bacteria 4001
85 Ga0070664_100456121 3300005564 Bacteria 1174
86 Ga0068857_100045203 3300005577 Bacteria 3906
87 Ga0070702_100005612 3300005615 Bacteria 5867
88 Ga0070702_100344361 3300005615 Bacteria 1047
89 Ga0068852_100732932 3300005616 Bacteria 1000
90 Ga0068859_100046364 3300005617 Bacteria 4365
91 Ga0068859_100235471 3300005617 Bacteria 1919
92 Ga0068864_100056065 3300005618 Bacteria 3405
93 Ga0068861_100022557 3300005719 Bacteria 4537
94 Ga0068870_10002336 3300005840 Bacteria 7892
95 Ga0068858_100087766 3300005842 Bacteria 2893
96 Ga0068858_101567114 3300005842 Bacteria 650
97 Ga0068860_100024071 3300005843 Bacteria 5886
98 Ga0068860_100080975 3300005843 Bacteria 3088
99 Ga0068862_100018796 3300005844 Bacteria 5759
100 Ga0081455_10001030 3300005937 Bacteria 35155
101 Ga0081455_10205748 3300005937 Bacteria 1470
102 Ga0070717_10023048 3300006028 Bacteria 4927
103 Ga0070717_10079878 3300006028 Bacteria 2743
104 Ga0075432_10000012 3300006058 Bacteria 34480
105 Ga0070716_100183225 3300006173 Bacteria 1377
106 Ga0070712_100021708 3300006175 Bacteria 4222
107 Ga0097621_100002795 3300006237 Bacteria 11951
108 Ga0097621_100009709 3300006237 Bacteria 7000
109 Ga0097621_101888204 3300006237 Bacteria 570
110 Ga0068871_100003706 3300006358 Bacteria 10508
111 Ga0068871_100159179 3300006358 Bacteria 1930
112 Ga0075428_100179299 3300006844 Bacteria 2293
113 Ga0075428_100491204 3300006844 Bacteria 1314
114 Ga0075430_100306362 3300006846 Bacteria 1314
115 Ga0075431_100459492 3300006847 Bacteria 1268
116 Ga0075433_10126442 3300006852 Bacteria 2270
117 Ga0075434_100038001 3300006871 Bacteria 4768
118 Ga0075434_100817568 3300006871 Bacteria 948
119 Ga0075434_101365621 3300006871 Bacteria 719
120 Ga0075429_100050571 3300006880 Bacteria 3615
121 Ga0068865_100006114 3300006881 Bacteria 7341
122 Ga0075436_100024828 3300006914 Bacteria 4122
123 Ga0075436_100209221 3300006914 Bacteria 1382
124 Ga0097620_100046363 3300006931 Bacteria 4365
125 Ga0097620_100235472 3300006931 Bacteria 1919
126 Ga0075435_100018915 3300007076 Bacteria 5249
127 Ga0075435_101117545 3300007076 Unclassified 689
128 Ga0099794_10586970 3300007265 Unclassified 590
129 Ga0105244_10366451 3300009036 Bacteria 664
130 Ga0105240_10298796 3300009093 Bacteria 1842
131 Ga0105240_11480303 3300009093 Bacteria 712
132 Ga0111539_10104235 3300009094 Bacteria 3328
133 Ga0111539_10127303 3300009094 Bacteria 2983
134 Ga0111539_10324997 3300009094 Bacteria 1790
135 Ga0111539_10777628 3300009094 Bacteria 1114
136 Ga0105245_10006102 3300009098 Bacteria 10595
137 Ga0114129_10028896 3300009147 Bacteria 7855
138 Ga0114129_10069655 3300009147 Bacteria 4903
139 Ga0114129_10139879 3300009147 Bacteria 3319
140 Ga0105243_10002601 3300009148 Bacteria 15051
141 Ga0105241_10247721 3300009174 Bacteria 1509
142 Ga0105242_10000834 3300009176 Bacteria 23976
143 Ga0105237_11659505 3300009545 Bacteria 646
144 Ga0105237_11802250 3300009545 Bacteria 620
145 Ga0105238_10289197 3300009551 Bacteria 1621
146 Ga0105249_10018526 3300009553 Bacteria 6198
147 Ga0105249_12227425 3300009553 Bacteria 621
148 Ga0105239_10043621 3300010375 Bacteria 4917
149 Ga0105239_10265518 3300010375 Bacteria 1930
150 Ga0105246_10001787 3300011119 Bacteria 12861
151 Ga0157373_10149914 3300013100 Bacteria 1640
152 Ga0157370_11138189 3300013104 Bacteria 705
153 Ga0157374_10083838 3300013296 Bacteria 3029
154 Ga0157374_10174212 3300013296 Bacteria 2100
155 Ga0157378_10040189 3300013297 Bacteria 4148
156 Ga0163162_10390131 3300013306 Bacteria 1525
157 Ga0157372_10063321 3300013307 Bacteria 4146
158 Ga0157372_10273448 3300013307 Bacteria 1963
159 Ga0157372_12198839 3300013307 Bacteria 634
160 Ga0157372_12322813 3300013307 Bacteria 616
161 Ga0157375_10042589 3300013308 Bacteria 4395
162 Ga0157380_10007252 3300014326 Bacteria 7864
163 Ga0157377_10000545 3300014745 Bacteria 15900
164 Ga0157376_10000178 3300014969 Bacteria 43694
165 Ga0206353_10451398 3300020082 Bacteria 1433
166 Ga0207697_10022285 3300025315 Bacteria 2594
167 Ga0207682_10011319 3300025893 Bacteria 3485
168 Ga0207692_10581424 3300025898 Bacteria 718
169 Ga0207688_10002146 3300025901 Bacteria 10609
170 Ga0207680_10054485 3300025903 Bacteria 2406
171 Ga0207647_10053062 3300025904 Bacteria 2500
172 Ga0207699_10715790 3300025906 Bacteria 733
173 Ga0207645_10000009 3300025907 Bacteria 142449
174 Ga0207643_10029395 3300025908 Bacteria 3056
175 Ga0207684_10078523 3300025910 Bacteria 2807
176 Ga0207654_10094977 3300025911 Bacteria 1825
177 Ga0207707_10008622 3300025912 Bacteria 8843
178 Ga0207695_10212699 3300025913 Bacteria 1843
179 Ga0207671_10813985 3300025914 Bacteria 740
180 Ga0207693_10000958 3300025915 Bacteria 25894
181 Ga0207693_10071672 3300025915 Bacteria 2712
182 Ga0207663_10210648 3300025916 Bacteria 1408
183 Ga0207660_10002893 3300025917 Bacteria 11221
184 Ga0207662_10000618 3300025918 Bacteria 15923
185 Ga0207662_10010022 3300025918 Bacteria 5228
186 Ga0207657_10012182 3300025919 Bacteria 8498
187 Ga0207657_10024455 3300025919 Bacteria 5590
188 Ga0207649_10011371 3300025920 Bacteria 4908
189 Ga0207652_10034950 3300025921 Bacteria 4239
190 Ga0207646_10112388 3300025922 Bacteria 2445
191 Ga0207681_10006417 3300025923 Bacteria 7219
192 Ga0207650_10014984 3300025925 Bacteria 5392
193 Ga0207659_10004061 3300025926 Bacteria 8833
194 Ga0207659_11781144 3300025926 Unclassified 523
195 Ga0207687_10298584 3300025927 Bacteria 1297
196 Ga0207690_10001782 3300025932 Bacteria 13229
197 Ga0207690_10125111 3300025932 Bacteria 1873
198 Ga0207706_10000134 3300025933 Bacteria 80573
199 Ga0207686_10297718 3300025934 Bacteria 1197
200 Ga0207709_10146622 3300025935 Bacteria 1629
201 Ga0207670_10016562 3300025936 Bacteria 4433
202 Ga0207670_10083964 3300025936 Bacteria 2235
203 Ga0207670_10254390 3300025936 Unclassified 1359
204 Ga0207669_10004535 3300025937 Bacteria 6127
205 Ga0207704_10002290 3300025938 Bacteria 8607
206 Ga0207665_10084973 3300025939 Bacteria 2184
207 Ga0207665_10326371 3300025939 Bacteria 1153
208 Ga0207691_10000066 3300025940 Bacteria 84662
209 Ga0207691_10007979 3300025940 Bacteria 10185
210 Ga0207711_11924019 3300025941 Bacteria 534
211 Ga0207689_10006708 3300025942 Bacteria 10156
212 Ga0207661_10093123 3300025944 Bacteria 2514
213 Ga0207679_10017660 3300025945 Bacteria 4763
214 Ga0207679_10075552 3300025945 Bacteria 2557
215 Ga0207667_10070510 3300025949 Bacteria 3637
216 Ga0207651_10003923 3300025960 Bacteria 7382
217 Ga0207651_10072954 3300025960 Bacteria 2439
218 Ga0207712_10055830 3300025961 Bacteria 2780
219 Ga0207712_10178943 3300025961 Bacteria 1664
220 Ga0207668_10030686 3300025972 Bacteria 3534
221 Ga0207658_10003514 3300025986 Bacteria 11061
222 Ga0207658_10560186 3300025986 Bacteria 1023
223 Ga0207677_10004218 3300026023 Bacteria 7694
224 Ga0207677_12133147 3300026023 Unclassified 521
225 Ga0207703_10248171 3300026035 Bacteria 1603
226 Ga0207703_11116887 3300026035 Bacteria 757
227 Ga0207678_10028054 3300026067 Bacteria 4916
228 Ga0207708_10000336 3300026075 Bacteria 36973
229 Ga0207648_10000049 3300026089 Bacteria 108876
230 Ga0207648_10837927 3300026089 Bacteria 857
231 Ga0207674_10014015 3300026116 Bacteria 8860
232 Ga0207675_100064914 3300026118 Bacteria 3412
233 Ga0207683_10000023 3300026121 Bacteria 114463
234 Ga0207683_10239026 3300026121 Bacteria 1657
235 Ga0209973_1000241 3300027252 Bacteria 3725
236 Ga0209969_1000233 3300027360 Bacteria 7474
237 Ga0209967_1000068 3300027364 Bacteria 13872
238 Ga0209981_1000063 3300027378 Bacteria 11574
239 Ga0209996_1000107 3300027395 Bacteria 10784
240 Ga0209984_1007704 3300027424 Bacteria 1341
241 Ga0210000_1000014 3300027462 Bacteria 31267
242 Ga0209995_1000076 3300027471 Bacteria 15333
243 Ga0209968_1000036 3300027526 Bacteria 24144
244 Ga0209999_1000794 3300027543 Bacteria 5202
245 Ga0209982_1000216 3300027552 Bacteria 6807
246 Ga0209970_1000116 3300027614 Bacteria 11661
247 Ga0210002_1000004 3300027617 Bacteria 38105
248 Ga0209983_1015118 3300027665 Bacteria 1592
249 Ga0209971_1000305 3300027682 Bacteria 13653
250 Ga0209966_1000028 3300027695 Bacteria 65208
251 Ga0209998_10000030 3300027717 Bacteria 60299
252 Ga0209974_10001002 3300027876 Bacteria 9957
253 Ga0207428_10005241 3300027907 Bacteria 12112
254 Ga0207428_10253495 3300027907 Bacteria 1312
255 Ga0268266_11758882 3300028379 Bacteria 595
256 Ga0268264_10024213 3300028381 Bacteria 4956
257 Ga0268264_10177122 3300028381 Bacteria 1933
258 Ga0268264_10219040 3300028381 Bacteria 1751
259 Ga0265325_10000095 3300031241 Bacteria 62028
260 Ga0265339_10129786 3300031249 Bacteria 1290
261 Ga0265313_10034518 3300031595 Bacteria 2557
262 Ga0265313_10085182 3300031595 Bacteria 1428
263 Ga0265314_10624495 3300031711 Bacteria 552
264 Ga0265342_10064251 3300031712 Bacteria 2155
265 Ga0307416_100348214 3300032002 Bacteria 1498
266 Ga0373929_0065685 3300035085 Unclassified 858
267 Ga0373936_0261494 3300035113 Bacteria 775
268 Ga0373955_0060187 3300035172 Bacteria 2094
269 Ga0373942_0358216 3300035207 Unclassified 517
270 Ga0373961_0111633 3300035241 Bacteria 896
271 Ga0373931_0102040 3300035691 Bacteria 1615
272 Ga0373931_0249885 3300035691 Bacteria 1078
273 Ga0373931_1094320 3300035691 Unclassified 542
274 Ga0373925_0323154 3300037068 Bacteria 1249
275 Ga0395899_0085713 3300037312 Bacteria 2289
276 Ga0395900_0004828 3300037418 Bacteria 14197
277 Ga0395898_0001751 3300037466 Bacteria 28535
278 Ga0395905_0004576 3300037471 Bacteria 14311
279 Ga0395901_0000525 3300038443 Bacteria 44276
280 Ga0395901_0053660 3300038443 Bacteria 4189
281 Ga0395901_0232136 3300038443 Bacteria 1926
282 Ga0436365_1117139 3300039437 Bacteria 26783
283 Ga0436362_0133792 3300039453 Bacteria 2384
284 Ga0439437_043840 3300042000 Bacteria 584
285 Ga0439448_0064541 3300042005 Bacteria 1214
286 Ga0439455_0062161 3300042012 Bacteria 992
287 Ga0450890_038439 3300042127 Bacteria 701
288 Ga0450889_007978 3300042144 Bacteria 1072
289 Ga0439464_0023029 3300042439 Bacteria 1719
290 Ga0451577_0734689 3300042876 Bacteria 893
291 Ga0453684_1226199 3300044712 Unclassified 786
292 Ga0451576_0587435 3300045051 Bacteria 1170
293 Ga0451576_1067576 3300045051 Bacteria 845
294 Ga0451576_1067621 3300045051 Bacteria 845
295 Ga0495651_0487173 3300046462 Unclassified 791
296 Ga0495618_0223957 3300046514 Bacteria 1186
297 Ga0495652_0076947 3300046529 Bacteria 2767
298 Ga0495640_0159823 3300046533 Bacteria 1444
299 Ga0495587_0194307 3300046536 Bacteria 1148
300 Ga0495634_0146093 3300046642 Bacteria 1498
301 Ga0495635_0224984 3300046663 Bacteria 1268
302 Ga0495599_0152830 3300046678 Bacteria 1428
303 Ga0495658_0705838 3300046683 Bacteria 646
304 Ga0495613_0578524 3300046689 Bacteria 749
305 Ga0495581_0200540 3300047315 Bacteria 1167
306 Ga0495604_0087563 3300047317 Bacteria 2319
307 Ga0495674_0502558 3300047319 Bacteria 970
308 Ga0495680_0111323 3300047322 Bacteria 2028
309 Ga0495684_0098344 3300047471 Bacteria 2213
310 Ga0495602_0191686 3300048088 Bacteria 1567
311 Ga0495602_0335662 3300048088 Bacteria 1095
312 Ga0496104_0003117 3300048907 Bacteria 14295
313 Ga0496105_0000168 3300048908 Bacteria 43805
314 Ga0496121_0465911 3300048924 Bacteria 811
315 Ga0501291_008202 3300049514 Bacteria 1438
316 Ga0501294_031396 3300049517 Unclassified 621
317 Ga0501295_023862 3300049518 Unclassified 1146
318 Ga0501298_062842 3300049521 Bacteria 789
319 Ga0501033_0417239 3300049570 Bacteria 935
320 Ga0501034_0330959 3300049571 Bacteria 1455
321 Ga0501034_0398091 3300049571 Bacteria 1300
322 Ga0501037_0657282 3300049573 Bacteria 700
323 Ga0501040_0024116 3300049576 Bacteria 4081
324 Ga0501067_0102659 3300049583 Bacteria 1588
325 Ga0501068_0149333 3300049584 Bacteria 1468
326 Ga0501069_0130239 3300049585 Bacteria 1440
327 Ga0501071_1099197 3300049587 Bacteria 614
328 Ga0501074_0587345 3300049590 Bacteria 788
329 Ga0501217_262620 3300049661 Unclassified 560
330 Ga0501079_0556966 3300049741 Bacteria 902
331 Ga0501080_0073549 3300049742 Bacteria 3180
332 Ga0501080_1294670 3300049742 Bacteria 624
333 Ga0501083_0016189 3300049744 Bacteria 5221
334 nmdc:mga05p37_44416_c1 3300050507 Bacteria 5467
335 nmdc:mga05p37_649164_c1 3300050507 Bacteria 1182
336 nmdc:mga09592_96999_c1 3300050508 Bacteria 2523
337 nmdc:mga0qj67_16449_c1 3300050509 Bacteria 5611
338 nmdc:mga06r32_7372_c1 3300050510 Bacteria 9898
339 nmdc:mga06r32_84966_c1 3300050510 Bacteria 3085
340 nmdc:mga08y16_102346_c1 3300050511 Bacteria 2982
341 nmdc:mga08y16_282391_c1 3300050511 Bacteria 1712
342 nmdc:mga0rr50_394418_c1 3300050513 Bacteria 1168
343 nmdc:mga08x19_306992_c1 3300050514 Bacteria 1103
344 nmdc:mga08x19_333162_c1 3300050514 Bacteria 1058
345 nmdc:mga0a205_810975_c1 3300050515 Bacteria 784
346 Ga0495601_0019773 3300053077 Bacteria 4110
347 Ga0495612_0031004 3300053078 Bacteria 2155
348 Ga0495619_0000206 3300053085 Bacteria 42730
349 Ga0500590_103167 3300053148 Bacteria 1366
350 Ga0587101_153058 3300059623 Bacteria 501
351 Ga0501082_0055994 3300060353 Bacteria 3397
352 2883293316 2883291878 Bacteria 5894118
353 2883356264 2883354860 Bacteria 5865246
354 Ga0265316_10031687
355 JGI24739J22299_10102753
356 JGI24738J21930_10054561
357 JGI26145J50221_1000096
358 JGI26134J50242_103319
359 JGI26133J50247_102110
360 Ga0065704_10001227
361 Ga0065715_10020621
362 Ga0065715_10532026
363 Ga0065707_10001748
364 Ga0070676_10004156
365 Ga0070683_100103210
366 Ga0070690_100000599
367 Ga0070690_100041407
368 Ga0070670_100004744
369 Ga0070677_10002667
370 Ga0068869_100034492
371 Ga0070666_10627690
372 Ga0070680_100017536
373 Ga0070682_100073346
374 Ga0068868_100010929
375 Ga0070660_100055948
376 Ga0070689_100000804
377 Ga0070689_100036501
378 Ga0070691_10000240
379 Ga0070687_100001696
380 Ga0070661_100002485
381 Ga0070661_100423222
382 Ga0070668_100008190
383 Ga0070669_100002951
384 Ga0070675_100018569
385 Ga0070675_100310239
386 Ga0070671_100370837
387 Ga0070674_100001339
388 Ga0070673_100001861
389 Ga0070688_100003744
390 Ga0070688_100033351
391 Ga0070659_100001082
392 Ga0070659_100398293
393 Ga0070667_100005324
394 Ga0070667_100464141
395 Ga0070713_100535952
396 Ga0070710_10308083
397 Ga0070710_11038336
398 Ga0070705_100010266
399 Ga0070705_100675043
400 Ga0070700_100000693
401 Ga0070694_100005880
402 Ga0070694_100433876
403 Ga0070694_101511493
404 Ga0070708_100115814
405 Ga0070678_100001478
406 Ga0070678_100262507
407 Ga0070662_100000059
408 Ga0070662_100569044
409 Ga0070681_10007414
410 Ga0068867_100000588
411 Ga0068867_101108191
412 Ga0068867_101587148
413 Ga0070707_100121924
414 Ga0070707_101961645
415 Ga0070698_100603697
416 Ga0070699_100219503
417 Ga0070699_100255186
418 Ga0070699_102009999
419 Ga0070679_100020498
420 Ga0070679_100055829
421 Ga0070684_100002952
422 Ga0070684_100961750
423 Ga0070697_101445544
424 Ga0070672_100024691
425 Ga0070672_100474768
426 Ga0070686_100002331
427 Ga0070695_100008379
428 Ga0070696_100000917
429 Ga0070696_100054346
430 Ga0070696_100294791
431 Ga0070665_100125434
432 Ga0070704_100280696
433 Ga0070704_101087945
434 Ga0068855_100076676
435 Ga0068855_102131441
436 Ga0070664_100005553
437 Ga0070664_100038990
438 Ga0070664_100456121
439 Ga0068857_100045203
440 Ga0070702_100005612
441 Ga0070702_100344361
442 Ga0068852_100732932
443 Ga0068859_100046364
444 Ga0068859_100235471
445 Ga0068864_100056065
446 Ga0068861_100022557
447 Ga0068870_10002336
448 Ga0068858_100087766
449 Ga0068858_101567114
450 Ga0068860_100024071
451 Ga0068860_100080975
452 Ga0068862_100018796
453 Ga0081455_10001030
454 Ga0081455_10205748
455 Ga0070717_10023048
456 Ga0070717_10079878
457 Ga0075432_10000012
458 Ga0070716_100183225
459 Ga0070712_100021708
460 Ga0097621_100002795
461 Ga0097621_100009709
462 Ga0097621_101888204
463 Ga0068871_100003706
464 Ga0068871_100159179
465 Ga0075428_100179299
466 Ga0075428_100491204
467 Ga0075430_100306362
468 Ga0075431_100459492
469 Ga0075433_10126442
470 Ga0075434_100038001
471 Ga0075434_100817568
472 Ga0075434_101365621
473 Ga0075429_100050571
474 Ga0068865_100006114
475 Ga0075436_100024828
476 Ga0075436_100209221
477 Ga0097620_100046363
478 Ga0097620_100235472
479 Ga0075435_100018915
480 Ga0075435_101117545
481 Ga0099794_10586970
482 Ga0105244_10366451
483 Ga0105240_10298796
484 Ga0105240_11480303
485 Ga0111539_10104235
486 Ga0111539_10127303
487 Ga0111539_10324997
488 Ga0111539_10777628
489 Ga0105245_10006102
490 Ga0114129_10028896
491 Ga0114129_10069655
492 Ga0114129_10139879
493 Ga0105243_10002601
494 Ga0105241_10247721
495 Ga0105242_10000834
496 Ga0105237_11659505
497 Ga0105237_11802250
498 Ga0105238_10289197
499 Ga0105249_10018526
500 Ga0105249_12227425
501 Ga0105239_10043621
502 Ga0105239_10265518
503 Ga0105246_10001787
504 Ga0157373_10149914
505 Ga0157370_11138189
506 Ga0157374_10083838
507 Ga0157374_10174212
508 Ga0157378_10040189
509 Ga0163162_10390131
510 Ga0157372_10063321
511 Ga0157372_10273448
512 Ga0157372_12198839
513 Ga0157372_12322813
514 Ga0157375_10042589
515 Ga0157380_10007252
516 Ga0157377_10000545
517 Ga0157376_10000178
518 Ga0206353_10451398
519 Ga0207697_10022285
520 Ga0207682_10011319
521 Ga0207692_10581424
522 Ga0207688_10002146
523 Ga0207680_10054485
524 Ga0207647_10053062
525 Ga0207699_10715790
526 Ga0207645_10000009
527 Ga0207643_10029395
528 Ga0207684_10078523
529 Ga0207654_10094977
530 Ga0207707_10008622
531 Ga0207695_10212699
532 Ga0207671_10813985
533 Ga0207693_10000958
534 Ga0207693_10071672
535 Ga0207663_10210648
536 Ga0207660_10002893
537 Ga0207662_10000618
538 Ga0207662_10010022
539 Ga0207657_10012182
540 Ga0207657_10024455
541 Ga0207649_10011371
542 Ga0207652_10034950
543 Ga0207646_10112388
544 Ga0207681_10006417
545 Ga0207650_10014984
546 Ga0207659_10004061
547 Ga0207659_11781144
548 Ga0207687_10298584
549 Ga0207690_10001782
550 Ga0207690_10125111
551 Ga0207706_10000134
552 Ga0207686_10297718
553 Ga0207709_10146622
554 Ga0207670_10016562
555 Ga0207670_10083964
556 Ga0207670_10254390
557 Ga0207669_10004535
558 Ga0207704_10002290
559 Ga0207665_10084973
560 Ga0207665_10326371
561 Ga0207691_10000066
562 Ga0207691_10007979
563 Ga0207711_11924019
564 Ga0207689_10006708
565 Ga0207661_10093123
566 Ga0207679_10017660
567 Ga0207679_10075552
568 Ga0207667_10070510
569 Ga0207651_10003923
570 Ga0207651_10072954
571 Ga0207712_10055830
572 Ga0207712_10178943
573 Ga0207668_10030686
574 Ga0207658_10003514
575 Ga0207658_10560186
576 Ga0207677_10004218
577 Ga0207677_12133147
578 Ga0207703_10248171
579 Ga0207703_11116887
580 Ga0207678_10028054
581 Ga0207708_10000336
582 Ga0207648_10000049
583 Ga0207648_10837927
584 Ga0207674_10014015
585 Ga0207675_100064914
586 Ga0207683_10000023
587 Ga0207683_10239026
588 Ga0209973_1000241
589 Ga0209969_1000233
590 Ga0209967_1000068
591 Ga0209981_1000063
592 Ga0209996_1000107
593 Ga0209984_1007704
594 Ga0210000_1000014
595 Ga0209995_1000076
596 Ga0209968_1000036
597 Ga0209999_1000794
598 Ga0209982_1000216
599 Ga0209970_1000116
600 Ga0210002_1000004
601 Ga0209983_1015118
602 Ga0209971_1000305
603 Ga0209966_1000028
604 Ga0209998_10000030
605 Ga0209974_10001002
606 Ga0207428_10005241
607 Ga0207428_10253495
608 Ga0268266_11758882
609 Ga0268264_10024213
610 Ga0268264_10177122
611 Ga0268264_10219040
612 Ga0265325_10000095
613 Ga0265339_10129786
614 Ga0265313_10034518
615 Ga0265313_10085182
616 Ga0265314_10624495
617 Ga0265342_10064251
618 Ga0307416_100348214
619 Ga0373929_0065685
620 Ga0373936_0261494
621 Ga0373955_0060187
622 Ga0373942_0358216
623 Ga0373961_0111633
624 Ga0373931_0102040
625 Ga0373931_0249885
626 Ga0373931_1094320
627 Ga0373925_0323154
628 Ga0395899_0085713
629 Ga0395900_0004828
630 Ga0395898_0001751
631 Ga0395905_0004576
632 Ga0395901_0000525
633 Ga0395901_0053660
634 Ga0395901_0232136
635 Ga0436365_1117139
636 Ga0436362_0133792
637 Ga0439437_043840
638 Ga0439448_0064541
639 Ga0439455_0062161
640 Ga0450890_038439
641 Ga0450889_007978
642 Ga0439464_0023029
643 Ga0451577_0734689
644 Ga0453684_1226199
645 Ga0451576_0587435
646 Ga0451576_1067576
647 Ga0451576_1067621
648 Ga0495651_0487173
649 Ga0495618_0223957
650 Ga0495652_0076947
651 Ga0495640_0159823
652 Ga0495587_0194307
653 Ga0495634_0146093
654 Ga0495635_0224984
655 Ga0495599_0152830
656 Ga0495658_0705838
657 Ga0495613_0578524
658 Ga0495581_0200540
659 Ga0495604_0087563
660 Ga0495674_0502558
661 Ga0495680_0111323
662 Ga0495684_0098344
663 Ga0495602_0191686
664 Ga0495602_0335662
665 Ga0496104_0003117
666 Ga0496105_0000168
667 Ga0496121_0465911
668 Ga0501291_008202
669 Ga0501294_031396
670 Ga0501295_023862
671 Ga0501298_062842
672 Ga0501033_0417239
673 Ga0501034_0330959
674 Ga0501034_0398091
675 Ga0501037_0657282
676 Ga0501040_0024116
677 Ga0501067_0102659
678 Ga0501068_0149333
679 Ga0501069_0130239
680 Ga0501071_1099197
681 Ga0501074_0587345
682 Ga0501217_262620
683 Ga0501079_0556966
684 Ga0501080_0073549
685 Ga0501080_1294670
686 Ga0501083_0016189
687 nmdc:mga05p37_44416_c1
688 nmdc:mga05p37_649164_c1
689 nmdc:mga09592_96999_c1
690 nmdc:mga0qj67_16449_c1
691 nmdc:mga06r32_7372_c1
692 nmdc:mga06r32_84966_c1
693 nmdc:mga08y16_102346_c1
694 nmdc:mga08y16_282391_c1
695 nmdc:mga0rr50_394418_c1
696 nmdc:mga08x19_306992_c1
697 nmdc:mga08x19_333162_c1
698 nmdc:mga0a205_810975_c1
699 Ga0495601_0019773
700 Ga0495612_0031004
701 Ga0495619_0000206
702 Ga0500590_103167
703 Ga0587101_153058
704 Ga0501082_0055994
705 2883293316
706 2883356264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

25

151

0.87

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

24

152

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8809 1 133
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8627 1 133
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8565 1 133
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8565 1 133
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.837 1 134
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9241 74 132 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9117 75 133 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8999 8 134 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8974 75 133 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8959 74 132 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4Q3N8G3-F1-model_v4 VOC family protein 0.9811 74 134
AF-A0A4Q4WFV3-F1-model_v4 PhnB-like domain-containing protein 0.9763 46 134
AF-A0A2V6ZSN2-F1-model_v4 VOC family protein 0.9732 1 134 GO:0046872
AF-A0A257Z3W3-F1-model_v4 Uncharacterized protein 0.9717 70 134
AF-A0A2R7T845-F1-model_v4 deleted 0.9701 76 133

Map