F419226

General Info

Members Datasets Scaffolds Average Seq Length
352 181 704 296

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842134933|2842135823
Length 301
Sequence FIGLGVMGKPMAGHLVDAGHHVVVFNRSRAKVDELEARGAVGATSPAHAGEKADVVITMLPDSPEVEEVLFGPAGVTTTLRPGSLVIDCSTISPDAAVAIGARLAEKDIAFVDAPVSGGEAGAIAGALAVMMGGDEDAVRRAATVLDAVAATSVHVGPVGAGQLVKAANQMLVAGNIALVGEAVTLLQRTGVDVDAALAVLGGGLAASKVLEAKAPKMLARDFAPGFRIDLHYKDLKIALAAAEQARIAVPLTGIITQLVQALRSAGDGGLDHSALIKALERLSGADASGNRKEVESCQQH

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
96 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
97 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
98 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
119 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
180 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
181 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0.28
Rhizoplane 0.28
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 3.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100044370 3300005336 Bacteria 3613
2 Ga0070692_10269812 3300005345 Bacteria 1027
3 Ga0070669_100333094 3300005353 Unclassified 1228
4 Ga0070669_100340887 3300005353 Bacteria 1215
5 Ga0070703_10030398 3300005406 Bacteria 1627
6 Ga0070709_10080616 3300005434 Bacteria 2122
7 Ga0070714_100097527 3300005435 Bacteria 2584
8 Ga0070713_100132522 3300005436 Bacteria 2199
9 Ga0070710_10159960 3300005437 Bacteria 1396
10 Ga0070711_100316538 3300005439 Bacteria 1245
11 Ga0070708_100176122 3300005445 Bacteria 1998
12 Ga0070708_100484505 3300005445 Bacteria 1167
13 Ga0070706_100002512 3300005467 Bacteria 18467
14 Ga0070706_100034709 3300005467 Bacteria 4659
15 Ga0070706_100285610 3300005467 Bacteria 1540
16 Ga0070707_100009241 3300005468 Bacteria 9147
17 Ga0070707_100037364 3300005468 Bacteria 4634
18 Ga0070707_100223120 3300005468 Bacteria 1835
19 Ga0070707_100508348 3300005468 Bacteria 1167
20 Ga0070698_100091666 3300005471 Bacteria 3021
21 Ga0070698_100107938 3300005471 Bacteria 2751
22 Ga0070699_100033332 3300005518 Bacteria 4449
23 Ga0070699_100072955 3300005518 Bacteria 2986
24 Ga0070699_100425834 3300005518 Bacteria 1202
25 Ga0070697_100026904 3300005536 Bacteria 4599
26 Ga0070697_100035700 3300005536 Bacteria 4012
27 Ga0070697_100097690 3300005536 Bacteria 2437
28 Ga0070697_100184680 3300005536 Bacteria 1768
29 Ga0070695_100001317 3300005545 Bacteria 13733
30 Ga0070695_100308794 3300005545 Bacteria 1172
31 Ga0070696_100011432 3300005546 Bacteria 5947
32 Ga0070696_100079603 3300005546 Bacteria 2319
33 Ga0070693_100041053 3300005547 Bacteria 2601
34 Ga0070704_100077566 3300005549 Bacteria 2434
35 Ga0070704_100089492 3300005549 Bacteria 2290
36 Ga0068856_100190771 3300005614 Bacteria 2063
37 Ga0068859_100030330 3300005617 Bacteria 5426
38 Ga0068860_100079538 3300005843 Bacteria 3117
39 Ga0068862_100014326 3300005844 Bacteria 6577
40 Ga0068862_100376661 3300005844 Bacteria 1323
41 Ga0081455_10001297 3300005937 Bacteria 31031
42 Ga0081540_1042031 3300005983 Bacteria 2362
43 Ga0081539_10003586 3300005985 Bacteria 18805
44 Ga0081539_10007266 3300005985 Bacteria 10173
45 Ga0070717_10023950 3300006028 Bacteria 4843
46 Ga0075365_10180405 3300006038 Bacteria 1476
47 Ga0075364_10213842 3300006051 Bacteria 1308
48 Ga0075432_10084069 3300006058 Bacteria 1157
49 Ga0070715_10016445 3300006163 Bacteria 2780
50 Ga0070716_100130349 3300006173 Bacteria 1588
51 Ga0075362_10022352 3300006177 Bacteria 2664
52 Ga0075367_10090754 3300006178 Unclassified 1858
53 Ga0075369_10001478 3300006186 Bacteria 8014
54 Ga0075428_100093474 3300006844 Bacteria 3279
55 Ga0075430_100000122 3300006846 Bacteria 48376
56 Ga0075430_100000380 3300006846 Bacteria 32652
57 Ga0075430_100000826 3300006846 Bacteria 24185
58 Ga0075430_100281466 3300006846 Bacteria 1376
59 Ga0075431_100004525 3300006847 Bacteria 13655
60 Ga0075431_100010950 3300006847 Bacteria 9127
61 Ga0075431_100094875 3300006847 Bacteria 3079
62 Ga0075431_100106711 3300006847 Bacteria 2890
63 Ga0075433_10065547 3300006852 Bacteria 3185
64 Ga0075434_100012476 3300006871 Bacteria 8059
65 Ga0075434_100072662 3300006871 Bacteria 3432
66 Ga0075434_100098610 3300006871 Bacteria 2927
67 Ga0075434_100633792 3300006871 Bacteria 1087
68 Ga0075429_100000817 3300006880 Bacteria 24421
69 Ga0075429_100017797 3300006880 Bacteria 6146
70 Ga0075429_100075588 3300006880 Bacteria 2934
71 Ga0075429_100085098 3300006880 Bacteria 2757
72 Ga0075436_100114138 3300006914 Bacteria 1886
73 Ga0097620_100030330 3300006931 Bacteria 5426
74 Ga0075435_100002353 3300007076 Bacteria 12527
75 Ga0075435_100037442 3300007076 Bacteria 3863
76 Ga0075435_100123835 3300007076 Bacteria 2159
77 Ga0075435_100281159 3300007076 Bacteria 1421
78 Ga0099794_10007823 3300007265 Bacteria 4413
79 Ga0099795_10000794 3300007788 Bacteria 6231
80 Ga0111539_10152873 3300009094 Bacteria 2701
81 Ga0111539_10235309 3300009094 Bacteria 2133
82 Ga0105245_10160372 3300009098 Bacteria 2133
83 Ga0114129_10012516 3300009147 Bacteria 12081
84 Ga0114129_10020724 3300009147 Bacteria 9342
85 Ga0114129_10032652 3300009147 Bacteria 7355
86 Ga0114129_10090087 3300009147 Unclassified 4252
87 Ga0114129_10379228 3300009147 Bacteria 1868
88 Ga0105243_10091788 3300009148 Bacteria 2502
89 Ga0105243_10099245 3300009148 Bacteria 2413
90 Ga0105242_10555774 3300009176 Bacteria 1101
91 Ga0105238_10044631 3300009551 Bacteria 4481
92 Ga0105249_10168943 3300009553 Bacteria 2119
93 Ga0099796_10011483 3300010159 Bacteria 2472
94 Ga0163162_10449097 3300013306 Bacteria 1421
95 Ga0157372_10045471 3300013307 Bacteria 4870
96 Ga0157372_10058219 3300013307 Bacteria 4319
97 Ga0157372_10696633 3300013307 Bacteria 1182
98 Ga0163163_10509579 3300014325 Bacteria 1265
99 Ga0157380_10090151 3300014326 Bacteria 2528
100 Ga0157380_10399585 3300014326 Bacteria 1303
101 Ga0213876_10002026 3300021384 Bacteria 12066
102 Ga0207653_10016542 3300025885 Bacteria 2316
103 Ga0207692_10081544 3300025898 Bacteria 1731
104 Ga0207685_10022579 3300025905 Bacteria 2129
105 Ga0207645_10053230 3300025907 Bacteria 2587
106 Ga0207684_10013132 3300025910 Bacteria 7169
107 Ga0207684_10020078 3300025910 Bacteria 5708
108 Ga0207684_10033680 3300025910 Bacteria 4357
109 Ga0207684_10090690 3300025910 Bacteria 2604
110 Ga0207684_10162517 3300025910 Bacteria 1923
111 Ga0207684_10462357 3300025910 Bacteria 1089
112 Ga0207654_10143660 3300025911 Bacteria 1524
113 Ga0207693_10171235 3300025915 Bacteria 1710
114 Ga0207660_10013989 3300025917 Bacteria 5266
115 Ga0207660_10493983 3300025917 Bacteria 993
116 Ga0207646_10023347 3300025922 Bacteria 5682
117 Ga0207646_10179967 3300025922 Bacteria 1909
118 Ga0207646_10319802 3300025922 Bacteria 1402
119 Ga0207646_10383807 3300025922 Bacteria 1269
120 Ga0207694_10008221 3300025924 Bacteria 7890
121 Ga0207700_10009763 3300025928 Bacteria 6017
122 Ga0207700_10197619 3300025928 Bacteria 1693
123 Ga0207664_10065294 3300025929 Bacteria 2913
124 Ga0207664_10160655 3300025929 Bacteria 1916
125 Ga0207664_10283457 3300025929 Bacteria 1454
126 Ga0207665_10018785 3300025939 Bacteria 4543
127 Ga0207665_10161974 3300025939 Bacteria 1610
128 Ga0207689_10000942 3300025942 Bacteria 27963
129 Ga0207712_10302343 3300025961 Bacteria 1313
130 Ga0207702_10165223 3300026078 Bacteria 2024
131 Ga0207675_100190684 3300026118 Bacteria 1966
132 Ga0209996_1005458 3300027395 Bacteria 1628
133 Ga0209970_1001073 3300027614 Bacteria 4834
134 Ga0209983_1000013 3300027665 Bacteria 22196
135 Ga0209588_1014855 3300027671 Bacteria 2390
136 Ga0209971_1000042 3300027682 Bacteria 41413
137 Ga0209966_1000026 3300027695 Bacteria 66086
138 Ga0209998_10000004 3300027717 Bacteria 104862
139 Ga0209974_10003692 3300027876 Bacteria 5499
140 Ga0207428_10000227 3300027907 Bacteria 77877
141 Ga0268265_10226806 3300028380 Unclassified 1639
142 Ga0268264_10083472 3300028381 Bacteria 2737
143 Ga0268264_10195197 3300028381 Bacteria 1848
144 Ga0268264_10202656 3300028381 Bacteria 1816
145 Ga0307408_100004900 3300031548 Bacteria 9014
146 Ga0307408_100040865 3300031548 Bacteria 3286
147 Ga0316575_10079760 3300031665 Bacteria 1320
148 Ga0316579_10007269 3300031691 Bacteria 4564
149 Ga0316579_10036172 3300031691 Unclassified 2278
150 Ga0316576_10001555 3300031727 Bacteria 12446
151 Ga0316576_10004339 3300031727 Bacteria 8484
152 Ga0316576_10024130 3300031727 Bacteria 4244
153 Ga0316576_10055570 3300031727 Bacteria 2890
154 Ga0316576_10063068 3300031727 Bacteria 2719
155 Ga0316576_10101962 3300031727 Bacteria 2145
156 Ga0316578_10002729 3300031728 Bacteria 7853
157 Ga0316578_10004797 3300031728 Bacteria 6448
158 Ga0316578_10046785 3300031728 Archaea 2522
159 Ga0316578_10087417 3300031728 Unclassified 1859
160 Ga0316577_10000272 3300031733 Bacteria 18394
161 Ga0316577_10001582 3300031733 Bacteria 10815
162 Ga0316577_10028708 3300031733 Bacteria 3104
163 Ga0307416_100019644 3300032002 Bacteria 4798
164 Ga0316583_10005287 3300032133 Bacteria 4630
165 Ga0316585_10005959 3300032137 Bacteria 3463
166 Ga0316580_10000301 3300032139 Bacteria 10759
167 Ga0316580_10025041 3300032139 Unclassified 1844
168 Ga0373928_0034967 3300035084 Bacteria 1130
169 Ga0373936_0003457 3300035113 Bacteria 5927
170 Ga0373939_0012081 3300035114 Unclassified 2195
171 Ga0373941_0070860 3300035115 Bacteria 1157
172 Ga0373942_0017785 3300035207 Unclassified 1757
173 Ga0373942_0055243 3300035207 Bacteria 1124
174 Ga0316574_0000435 3300035398 Bacteria 16564
175 Ga0316574_0012650 3300035398 Bacteria 4832
176 Ga0316574_0015629 3300035398 Bacteria 4406
177 Ga0316574_0037695 3300035398 Archaea 2965
178 Ga0316574_0167845 3300035398 Bacteria 1413
179 Ga0373931_0001192 3300035691 Bacteria 11114
180 Ga0373931_0075484 3300035691 Unclassified 1849
181 Ga0373927_0055845 3300035695 Bacteria 2553
182 Ga0373947_0040168 3300035725 Bacteria 2786
183 Ga0316582_0016815 3300036647 Bacteria 4216
184 Ga0316584_0003052 3300036712 Bacteria 10787
185 Ga0316584_0019643 3300036712 Bacteria 4885
186 Ga0316584_0136959 3300036712 Bacteria 1827
187 Ga0395900_0000485 3300037418 Bacteria 56437
188 Ga0395900_0241214 3300037418 Bacteria 1813
189 Ga0395898_0007206 3300037466 Bacteria 11803
190 Ga0316581_0022105 3300037588 Bacteria 1874
191 Ga0316581_0031334 3300037588 Bacteria 1603
192 Ga0395901_0011468 3300038443 Bacteria 8982
193 Ga0436365_1063266 3300039437 Bacteria 16396
194 Ga0439461_0018145 3300041410 Bacteria 1374
195 Ga0439466_0037542 3300041411 Bacteria 1630
196 Ga0439431_0001389 3300041997 Bacteria 5340
197 Ga0439434_0003472 3300042435 Bacteria 4600
198 Ga0439464_0004225 3300042439 Bacteria 3663
199 Ga0439460_0000780 3300042461 Bacteria 7193
200 Ga0451577_0161131 3300042876 Unclassified 2020
201 Ga0466963_0018006 3300044694 Bacteria 4408
202 Ga0453684_0462378 3300044712 Bacteria 1411
203 Ga0466957_0012403 3300044842 Bacteria 4933
204 Ga0451576_0113946 3300045051 Bacteria 2814
205 Ga0451576_0485675 3300045051 Bacteria 1297
206 Ga0466967_0013548 3300045976 Bacteria 6307
207 Ga0495580_0000449 3300046472 Bacteria 34081
208 Ga0495580_0127405 3300046472 Bacteria 1767
209 Ga0496102_0023342 3300048905 Bacteria 5492
210 Ga0501299_019213 3300049522 Bacteria 1235
211 Ga0501031_0102423 3300049568 Bacteria 1868
212 Ga0501032_0024770 3300049569 Bacteria 4140
213 Ga0501032_0320244 3300049569 Bacteria 1001
214 Ga0501033_0031305 3300049570 Bacteria 3998
215 Ga0501033_0116137 3300049570 Bacteria 1945
216 Ga0501034_0001199 3300049571 Bacteria 35644
217 Ga0501034_0018035 3300049571 Bacteria 7242
218 Ga0501036_0034619 3300049572 Bacteria 4273
219 Ga0501036_0054895 3300049572 Bacteria 3375
220 Ga0501036_0355616 3300049572 Bacteria 1223
221 Ga0501037_0082774 3300049573 Bacteria 2325
222 Ga0501037_0093301 3300049573 Bacteria 2177
223 Ga0501038_0212988 3300049574 Bacteria 1545
224 Ga0501039_0091536 3300049575 Bacteria 2370
225 Ga0501040_0010051 3300049576 Bacteria 6179
226 Ga0501040_0034911 3300049576 Bacteria 3408
227 Ga0501040_0097625 3300049576 Bacteria 2047
228 Ga0501041_0001736 3300049577 Bacteria 12245
229 Ga0501042_0007150 3300049578 Bacteria 7304
230 Ga0501042_0011445 3300049578 Bacteria 5987
231 Ga0501042_0094568 3300049578 Bacteria 2146
232 Ga0501043_0204509 3300049579 Bacteria 1531
233 Ga0501046_0000569 3300049580 Bacteria 36558
234 Ga0501046_0087822 3300049580 Bacteria 2395
235 Ga0501047_0033810 3300049581 Bacteria 4935
236 Ga0501048_0031644 3300049582 Bacteria 3826
237 Ga0501048_0043512 3300049582 Bacteria 3214
238 Ga0501048_0141641 3300049582 Bacteria 1700
239 Ga0501068_0299263 3300049584 Bacteria 1030
240 Ga0501069_0261125 3300049585 Bacteria 1011
241 Ga0501071_0080536 3300049587 Bacteria 2381
242 Ga0501071_0174290 3300049587 Bacteria 1611
243 Ga0501072_0002974 3300049588 Bacteria 12771
244 Ga0501072_0047889 3300049588 Bacteria 3367
245 Ga0501072_0061734 3300049588 Bacteria 2956
246 Ga0501072_0309760 3300049588 Bacteria 1255
247 Ga0501072_0456715 3300049588 Bacteria 1011
248 Ga0501074_0015380 3300049590 Bacteria 5562
249 Ga0501074_0162792 3300049590 Bacteria 1593
250 Ga0501074_0173149 3300049590 Bacteria 1540
251 Ga0501074_0365521 3300049590 Bacteria 1024
252 Ga0501075_0002375 3300049591 Bacteria 12524
253 Ga0501075_0019654 3300049591 Bacteria 4903
254 Ga0501075_0022355 3300049591 Bacteria 4618
255 Ga0501075_0143834 3300049591 Bacteria 1818
256 Ga0501075_0149257 3300049591 Bacteria 1782
257 Ga0501076_0004611 3300049592 Bacteria 9811
258 Ga0501076_0043423 3300049592 Bacteria 3542
259 Ga0501076_0048375 3300049592 Bacteria 3362
260 Ga0501076_0078429 3300049592 Bacteria 2650
261 Ga0501076_0112879 3300049592 Bacteria 2198
262 Ga0501076_0451477 3300049592 Bacteria 1058
263 Ga0501076_0517082 3300049592 Unclassified 984
264 Ga0501077_0000731 3300049593 Bacteria 19868
265 Ga0501077_0006895 3300049593 Bacteria 6995
266 Ga0501077_0051920 3300049593 Bacteria 2604
267 Ga0501079_0000820 3300049741 Bacteria 21158
268 Ga0501079_0004359 3300049741 Bacteria 10504
269 Ga0501079_0060097 3300049741 Bacteria 2932
270 Ga0501079_0104785 3300049741 Bacteria 2194
271 Ga0501079_0162860 3300049741 Unclassified 1740
272 Ga0501079_0372446 3300049741 Bacteria 1119
273 Ga0501080_0020434 3300049742 Bacteria 6129
274 Ga0501080_0028719 3300049742 Bacteria 5178
275 Ga0501080_0080361 3300049742 Bacteria 3030
276 Ga0501080_0353717 3300049742 Bacteria 1326
277 Ga0501081_0014770 3300049743 Bacteria 5153
278 Ga0501081_0023177 3300049743 Bacteria 4160
279 Ga0501081_0207766 3300049743 Bacteria 1421
280 Ga0501081_0220521 3300049743 Bacteria 1379
281 Ga0501081_0438230 3300049743 Bacteria 970
282 Ga0501083_0041618 3300049744 Bacteria 3116
283 Ga0501083_0050448 3300049744 Bacteria 2801
284 Ga0501083_0058639 3300049744 Bacteria 2576
285 Ga0501035_0023012 3300049822 Bacteria 5719
286 Ga0501035_0151173 3300049822 Bacteria 2015
287 Ga0501035_0267990 3300049822 Bacteria 1446
288 Ga0501044_0081157 3300049823 Bacteria 3283
289 Ga0501045_0001908 3300049824 Bacteria 14095
290 Ga0501045_0075422 3300049824 Bacteria 2484
291 Ga0501045_0078609 3300049824 Bacteria 2432
292 Ga0501045_0200942 3300049824 Bacteria 1485
293 Ga0501045_0228463 3300049824 Bacteria 1385
294 nmdc:mga03683_21380_c1 3300050489 Bacteria 2493
295 nmdc:mga03683_3640_c1 3300050489 Bacteria 5008
296 nmdc:mga00v17_144415_c1 3300050491 Bacteria 1527
297 nmdc:mga06z11_142084_c1 3300050494 Bacteria 1358
298 nmdc:mga05p37_167621_c1 3300050507 Bacteria 2680
299 nmdc:mga05p37_227897_c2 3300050507 Bacteria 1923
300 nmdc:mga05p37_340985_c1 3300050507 Bacteria 1767
301 nmdc:mga05p37_349673_c1 3300050507 Unclassified 1741
302 nmdc:mga05p37_4619_c1 3300050507 Bacteria 16096
303 nmdc:mga05p37_545102_c1 3300050507 Bacteria 1322
304 nmdc:mga05p37_61676_c1 3300050507 Bacteria 4616
305 nmdc:mga05p37_80017_c1 3300050507 Bacteria 4024
306 nmdc:mga09592_24940_c1 3300050508 Bacteria 4946
307 nmdc:mga0qj67_12170_c1 3300050509 Bacteria 6474
308 nmdc:mga0qj67_1549_c1 3300050509 Bacteria 16133
309 nmdc:mga0qj67_6422_c1 3300050509 Bacteria 8641
310 nmdc:mga06r32_126999_c1 3300050510 Bacteria 2520
311 nmdc:mga06r32_149950_c1 3300050510 Bacteria 2310
312 nmdc:mga06r32_15961_c1 3300050510 Bacteria 6833
313 nmdc:mga06r32_639_c1 3300050510 Bacteria 30459
314 nmdc:mga06r32_826040_c1 3300050510 Bacteria 886
315 nmdc:mga08y16_153473_c1 3300050511 Bacteria 2393
316 nmdc:mga08y16_1702_c1 3300050511 Bacteria 22301
317 nmdc:mga08y16_332176_c1 3300050511 Bacteria 1563
318 nmdc:mga0n895_21572_c1 3300050512 Bacteria 6027
319 nmdc:mga0n895_273427_c1 3300050512 Bacteria 1713
320 nmdc:mga0n895_322547_c1 3300050512 Bacteria 1565
321 nmdc:mga0n895_325354_c1 3300050512 Bacteria 1558
322 nmdc:mga0n895_525757_c1 3300050512 Bacteria 1190
323 nmdc:mga0rr50_154315_c1 3300050513 Bacteria 1859
324 nmdc:mga0rr50_182903_c1 3300050513 Bacteria 1714
325 nmdc:mga0rr50_211329_c1 3300050513 Bacteria 1599
326 nmdc:mga0rr50_65276_c1 3300050513 Bacteria 2756
327 nmdc:mga08x19_258842_c1 3300050514 Bacteria 1202
328 nmdc:mga08x19_2871_c1 3300050514 Bacteria 10381
329 nmdc:mga08x19_76967_c1 3300050514 Bacteria 2184
330 nmdc:mga08x19_92203_c1 3300050514 Bacteria 2001
331 nmdc:mga0a205_13485_c1 3300050515 Bacteria 7610
332 nmdc:mga0sz30_336_c1 3300050516 Bacteria 17947
333 Ga0500651_0037396 3300053093 Bacteria 3059
334 Ga0500658_0042129 3300053134 Bacteria 1834
335 Ga0500568_0027682 3300053139 Bacteria 2368
336 Ga0500552_001806 3300053733 Bacteria 2051
337 Ga0501084_0005617 3300054114 Bacteria 10299
338 Ga0501084_0006119 3300054114 Bacteria 9893
339 Ga0501084_0035706 3300054114 Bacteria 4155
340 Ga0501084_0057196 3300054114 Bacteria 3264
341 Ga0501084_0079433 3300054114 Bacteria 2749
342 Ga0501082_0003434 3300060353 Bacteria 13830
343 Ga0501082_0010562 3300060353 Bacteria 7947
344 Ga0501082_0014046 3300060353 Bacteria 6888
345 Ga0501082_0026392 3300060353 Bacteria 5005
346 Ga0501082_0077407 3300060353 Bacteria 2868
347 Ga0530510_0026778 3300061734 Bacteria 4129
348 Ga0530510_0051073 3300061734 Bacteria 2987
349 Ga0530510_0179612 3300061734 Bacteria 1569
350 2842135823 2842134933 Bacteria 5847019
351 2883581235 2883577096 Bacteria 4709178
352 2902817123 2902810491 Bacteria 6794147
353 Ga0070680_100044370
354 Ga0070692_10269812
355 Ga0070669_100333094
356 Ga0070669_100340887
357 Ga0070703_10030398
358 Ga0070709_10080616
359 Ga0070714_100097527
360 Ga0070713_100132522
361 Ga0070710_10159960
362 Ga0070711_100316538
363 Ga0070708_100176122
364 Ga0070708_100484505
365 Ga0070706_100002512
366 Ga0070706_100034709
367 Ga0070706_100285610
368 Ga0070707_100009241
369 Ga0070707_100037364
370 Ga0070707_100223120
371 Ga0070707_100508348
372 Ga0070698_100091666
373 Ga0070698_100107938
374 Ga0070699_100033332
375 Ga0070699_100072955
376 Ga0070699_100425834
377 Ga0070697_100026904
378 Ga0070697_100035700
379 Ga0070697_100097690
380 Ga0070697_100184680
381 Ga0070695_100001317
382 Ga0070695_100308794
383 Ga0070696_100011432
384 Ga0070696_100079603
385 Ga0070693_100041053
386 Ga0070704_100077566
387 Ga0070704_100089492
388 Ga0068856_100190771
389 Ga0068859_100030330
390 Ga0068860_100079538
391 Ga0068862_100014326
392 Ga0068862_100376661
393 Ga0081455_10001297
394 Ga0081540_1042031
395 Ga0081539_10003586
396 Ga0081539_10007266
397 Ga0070717_10023950
398 Ga0075365_10180405
399 Ga0075364_10213842
400 Ga0075432_10084069
401 Ga0070715_10016445
402 Ga0070716_100130349
403 Ga0075362_10022352
404 Ga0075367_10090754
405 Ga0075369_10001478
406 Ga0075428_100093474
407 Ga0075430_100000122
408 Ga0075430_100000380
409 Ga0075430_100000826
410 Ga0075430_100281466
411 Ga0075431_100004525
412 Ga0075431_100010950
413 Ga0075431_100094875
414 Ga0075431_100106711
415 Ga0075433_10065547
416 Ga0075434_100012476
417 Ga0075434_100072662
418 Ga0075434_100098610
419 Ga0075434_100633792
420 Ga0075429_100000817
421 Ga0075429_100017797
422 Ga0075429_100075588
423 Ga0075429_100085098
424 Ga0075436_100114138
425 Ga0097620_100030330
426 Ga0075435_100002353
427 Ga0075435_100037442
428 Ga0075435_100123835
429 Ga0075435_100281159
430 Ga0099794_10007823
431 Ga0099795_10000794
432 Ga0111539_10152873
433 Ga0111539_10235309
434 Ga0105245_10160372
435 Ga0114129_10012516
436 Ga0114129_10020724
437 Ga0114129_10032652
438 Ga0114129_10090087
439 Ga0114129_10379228
440 Ga0105243_10091788
441 Ga0105243_10099245
442 Ga0105242_10555774
443 Ga0105238_10044631
444 Ga0105249_10168943
445 Ga0099796_10011483
446 Ga0163162_10449097
447 Ga0157372_10045471
448 Ga0157372_10058219
449 Ga0157372_10696633
450 Ga0163163_10509579
451 Ga0157380_10090151
452 Ga0157380_10399585
453 Ga0213876_10002026
454 Ga0207653_10016542
455 Ga0207692_10081544
456 Ga0207685_10022579
457 Ga0207645_10053230
458 Ga0207684_10013132
459 Ga0207684_10020078
460 Ga0207684_10033680
461 Ga0207684_10090690
462 Ga0207684_10162517
463 Ga0207684_10462357
464 Ga0207654_10143660
465 Ga0207693_10171235
466 Ga0207660_10013989
467 Ga0207660_10493983
468 Ga0207646_10023347
469 Ga0207646_10179967
470 Ga0207646_10319802
471 Ga0207646_10383807
472 Ga0207694_10008221
473 Ga0207700_10009763
474 Ga0207700_10197619
475 Ga0207664_10065294
476 Ga0207664_10160655
477 Ga0207664_10283457
478 Ga0207665_10018785
479 Ga0207665_10161974
480 Ga0207689_10000942
481 Ga0207712_10302343
482 Ga0207702_10165223
483 Ga0207675_100190684
484 Ga0209996_1005458
485 Ga0209970_1001073
486 Ga0209983_1000013
487 Ga0209588_1014855
488 Ga0209971_1000042
489 Ga0209966_1000026
490 Ga0209998_10000004
491 Ga0209974_10003692
492 Ga0207428_10000227
493 Ga0268265_10226806
494 Ga0268264_10083472
495 Ga0268264_10195197
496 Ga0268264_10202656
497 Ga0307408_100004900
498 Ga0307408_100040865
499 Ga0316575_10079760
500 Ga0316579_10007269
501 Ga0316579_10036172
502 Ga0316576_10001555
503 Ga0316576_10004339
504 Ga0316576_10024130
505 Ga0316576_10055570
506 Ga0316576_10063068
507 Ga0316576_10101962
508 Ga0316578_10002729
509 Ga0316578_10004797
510 Ga0316578_10046785
511 Ga0316578_10087417
512 Ga0316577_10000272
513 Ga0316577_10001582
514 Ga0316577_10028708
515 Ga0307416_100019644
516 Ga0316583_10005287
517 Ga0316585_10005959
518 Ga0316580_10000301
519 Ga0316580_10025041
520 Ga0373928_0034967
521 Ga0373936_0003457
522 Ga0373939_0012081
523 Ga0373941_0070860
524 Ga0373942_0017785
525 Ga0373942_0055243
526 Ga0316574_0000435
527 Ga0316574_0012650
528 Ga0316574_0015629
529 Ga0316574_0037695
530 Ga0316574_0167845
531 Ga0373931_0001192
532 Ga0373931_0075484
533 Ga0373927_0055845
534 Ga0373947_0040168
535 Ga0316582_0016815
536 Ga0316584_0003052
537 Ga0316584_0019643
538 Ga0316584_0136959
539 Ga0395900_0000485
540 Ga0395900_0241214
541 Ga0395898_0007206
542 Ga0316581_0022105
543 Ga0316581_0031334
544 Ga0395901_0011468
545 Ga0436365_1063266
546 Ga0439461_0018145
547 Ga0439466_0037542
548 Ga0439431_0001389
549 Ga0439434_0003472
550 Ga0439464_0004225
551 Ga0439460_0000780
552 Ga0451577_0161131
553 Ga0466963_0018006
554 Ga0453684_0462378
555 Ga0466957_0012403
556 Ga0451576_0113946
557 Ga0451576_0485675
558 Ga0466967_0013548
559 Ga0495580_0000449
560 Ga0495580_0127405
561 Ga0496102_0023342
562 Ga0501299_019213
563 Ga0501031_0102423
564 Ga0501032_0024770
565 Ga0501032_0320244
566 Ga0501033_0031305
567 Ga0501033_0116137
568 Ga0501034_0001199
569 Ga0501034_0018035
570 Ga0501036_0034619
571 Ga0501036_0054895
572 Ga0501036_0355616
573 Ga0501037_0082774
574 Ga0501037_0093301
575 Ga0501038_0212988
576 Ga0501039_0091536
577 Ga0501040_0010051
578 Ga0501040_0034911
579 Ga0501040_0097625
580 Ga0501041_0001736
581 Ga0501042_0007150
582 Ga0501042_0011445
583 Ga0501042_0094568
584 Ga0501043_0204509
585 Ga0501046_0000569
586 Ga0501046_0087822
587 Ga0501047_0033810
588 Ga0501048_0031644
589 Ga0501048_0043512
590 Ga0501048_0141641
591 Ga0501068_0299263
592 Ga0501069_0261125
593 Ga0501071_0080536
594 Ga0501071_0174290
595 Ga0501072_0002974
596 Ga0501072_0047889
597 Ga0501072_0061734
598 Ga0501072_0309760
599 Ga0501072_0456715
600 Ga0501074_0015380
601 Ga0501074_0162792
602 Ga0501074_0173149
603 Ga0501074_0365521
604 Ga0501075_0002375
605 Ga0501075_0019654
606 Ga0501075_0022355
607 Ga0501075_0143834
608 Ga0501075_0149257
609 Ga0501076_0004611
610 Ga0501076_0043423
611 Ga0501076_0048375
612 Ga0501076_0078429
613 Ga0501076_0112879
614 Ga0501076_0451477
615 Ga0501076_0517082
616 Ga0501077_0000731
617 Ga0501077_0006895
618 Ga0501077_0051920
619 Ga0501079_0000820
620 Ga0501079_0004359
621 Ga0501079_0060097
622 Ga0501079_0104785
623 Ga0501079_0162860
624 Ga0501079_0372446
625 Ga0501080_0020434
626 Ga0501080_0028719
627 Ga0501080_0080361
628 Ga0501080_0353717
629 Ga0501081_0014770
630 Ga0501081_0023177
631 Ga0501081_0207766
632 Ga0501081_0220521
633 Ga0501081_0438230
634 Ga0501083_0041618
635 Ga0501083_0050448
636 Ga0501083_0058639
637 Ga0501035_0023012
638 Ga0501035_0151173
639 Ga0501035_0267990
640 Ga0501044_0081157
641 Ga0501045_0001908
642 Ga0501045_0075422
643 Ga0501045_0078609
644 Ga0501045_0200942
645 Ga0501045_0228463
646 nmdc:mga03683_21380_c1
647 nmdc:mga03683_3640_c1
648 nmdc:mga00v17_144415_c1
649 nmdc:mga06z11_142084_c1
650 nmdc:mga05p37_167621_c1
651 nmdc:mga05p37_227897_c2
652 nmdc:mga05p37_340985_c1
653 nmdc:mga05p37_349673_c1
654 nmdc:mga05p37_4619_c1
655 nmdc:mga05p37_545102_c1
656 nmdc:mga05p37_61676_c1
657 nmdc:mga05p37_80017_c1
658 nmdc:mga09592_24940_c1
659 nmdc:mga0qj67_12170_c1
660 nmdc:mga0qj67_1549_c1
661 nmdc:mga0qj67_6422_c1
662 nmdc:mga06r32_126999_c1
663 nmdc:mga06r32_149950_c1
664 nmdc:mga06r32_15961_c1
665 nmdc:mga06r32_639_c1
666 nmdc:mga06r32_826040_c1
667 nmdc:mga08y16_153473_c1
668 nmdc:mga08y16_1702_c1
669 nmdc:mga08y16_332176_c1
670 nmdc:mga0n895_21572_c1
671 nmdc:mga0n895_273427_c1
672 nmdc:mga0n895_322547_c1
673 nmdc:mga0n895_325354_c1
674 nmdc:mga0n895_525757_c1
675 nmdc:mga0rr50_154315_c1
676 nmdc:mga0rr50_182903_c1
677 nmdc:mga0rr50_211329_c1
678 nmdc:mga0rr50_65276_c1
679 nmdc:mga08x19_258842_c1
680 nmdc:mga08x19_2871_c1
681 nmdc:mga08x19_76967_c1
682 nmdc:mga08x19_92203_c1
683 nmdc:mga0a205_13485_c1
684 nmdc:mga0sz30_336_c1
685 Ga0500651_0037396
686 Ga0500658_0042129
687 Ga0500568_0027682
688 Ga0500552_001806
689 Ga0501084_0005617
690 Ga0501084_0006119
691 Ga0501084_0035706
692 Ga0501084_0057196
693 Ga0501084_0079433
694 Ga0501082_0003434
695 Ga0501082_0010562
696 Ga0501082_0014046
697 Ga0501082_0026392
698 Ga0501082_0077407
699 Ga0530510_0026778
700 Ga0530510_0051073
701 Ga0530510_0179612
702 2842135823
703 2883581235
704 2902817123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

1

157

0.99

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

160

280

0.99

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

1

91

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9689 2 285
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9676 3 286
3cky-assembly2.cif.gz_D structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation 0.9607 52 297
2uyy-assembly1.cif.gz_D structure of the cytokine-like nuclear factor n-pac 0.9604 1 284
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.959 2 285
ID Description Score Start End Superfamily
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9937 2 164 3.40.50.720
af_Q9XTI0_3_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9861 5 164 3.40.50.720
af_F4IAP5_485_617_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.986 163 293 1.10.1040.10
af_Q4DFE2_2_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9854 2 163 3.40.50.720
1vpdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9844 5 164 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1V5E6N0-F1-model_v4 2-(Hydroxymethyl)glutarate dehydrogenase (EC 1.1.1.291) 0.9917 4 298 GO:0016054
GO:0043718
GO:0050661
GO:0051287
AF-A0A4W5M8A8-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) 0.9915 3 175 GO:0005739
GO:0006574
GO:0008442
GO:0050661
AF-A0A672KUH1-F1-model_v4 3-hydroxyisobutyrate dehydrogenase, mitochondrial-like 0.9904 2 175 GO:0005739
GO:0006574
GO:0008442
GO:0050661
AF-A0A3N5WC81-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9895 1 250 GO:0016054
GO:0016491
GO:0050661
GO:0051287
AF-A0A3B5LQV3-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.989 3 127 GO:0005739
GO:0006574
GO:0008442
GO:0050661

Map