F419215

General Info

Members Datasets Scaffolds Average Seq Length
352 204 704 230

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0211767|Ga0530510_0211767_301_1053
Length 250
Sequence VTRLDGQVAVVTGASRGIGAAVATVLARDGARVIRVARSLSDKTSGTVQDLRCDLTDPKQVDDLAARVLASYGAPDVMVSNAGAFLLRALEHTEPLELETQLAANVKGPFYVARAFLPAMRRAGRGSFITVGSVADHTGFPENAAYAASKYGLRGLHETLVAEYRGSGVRLTLISPGPTDTAVWDPVDPDHREGFPSRADMLRPADVADAIIFVATRPPHVLIDWLRLGPVGTGSHRHPQERVPDADSRR

Samples

Sample ID Description Type Environment
1 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
181 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
182 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
187 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
188 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.38
Rhizosphere 90.62
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0530510_0211767 3300061734 Bacteria 1440
2 MBSR1b_contig_2475066 2162886012 Unclassified 2278
3 Ga0065715_10001411 3300005293 Bacteria 6733
4 Ga0070676_10001156 3300005328 Bacteria 13184
5 Ga0070690_100117418 3300005330 Bacteria 1782
6 Ga0068869_100167140 3300005334 Bacteria 1716
7 Ga0070666_10021483 3300005335 Bacteria 4185
8 Ga0070680_100064714 3300005336 Bacteria 2997
9 Ga0070680_100206672 3300005336 Bacteria 1656
10 Ga0068868_100260465 3300005338 Bacteria 1462
11 Ga0068868_100428910 3300005338 Bacteria 1146
12 Ga0070660_100490830 3300005339 Bacteria 1021
13 Ga0070668_100092528 3300005347 Bacteria 2385
14 Ga0070675_100091260 3300005354 Bacteria 2552
15 Ga0070671_100032171 3300005355 Bacteria 4338
16 Ga0070671_100082860 3300005355 Bacteria 2682
17 Ga0070673_100013365 3300005364 Bacteria 5676
18 Ga0070667_100230078 3300005367 Bacteria 1653
19 Ga0070711_100554099 3300005439 Bacteria 954
20 Ga0070705_100002266 3300005440 Bacteria 9736
21 Ga0070705_100027340 3300005440 Bacteria 3114
22 Ga0070705_100032630 3300005440 Bacteria 2894
23 Ga0070700_100016452 3300005441 Bacteria 4212
24 Ga0070694_100012052 3300005444 Bacteria 5369
25 Ga0070694_100328830 3300005444 Unclassified 1178
26 Ga0070708_100038715 3300005445 Bacteria 4167
27 Ga0070663_100287688 3300005455 Bacteria 1312
28 Ga0070678_100031899 3300005456 Bacteria 3640
29 Ga0070678_100032769 3300005456 Bacteria 3600
30 Ga0070662_100000040 3300005457 Bacteria 73497
31 Ga0070662_100212796 3300005457 Unclassified 1539
32 Ga0070662_100274261 3300005457 Bacteria 1363
33 Ga0070681_10086979 3300005458 Bacteria 3079
34 Ga0068867_100001196 3300005459 Bacteria 17801
35 Ga0070706_100007945 3300005467 Bacteria 9903
36 Ga0070707_100026188 3300005468 Bacteria 5535
37 Ga0070698_100005635 3300005471 Bacteria 13706
38 Ga0070699_100002654 3300005518 Bacteria 15974
39 Ga0070699_100008984 3300005518 Bacteria 8654
40 Ga0070699_100034363 3300005518 Bacteria 4382
41 Ga0070699_100299070 3300005518 Bacteria 1444
42 Ga0070699_100449036 3300005518 Bacteria 1169
43 Ga0070679_100363580 3300005530 Bacteria 1394
44 Ga0070697_100050462 3300005536 Bacteria 3377
45 Ga0070697_100052390 3300005536 Bacteria 3316
46 Ga0068853_100542508 3300005539 Unclassified 1101
47 Ga0068853_100942374 3300005539 Bacteria 830
48 Ga0070686_100327640 3300005544 Unclassified 1144
49 Ga0070695_100010988 3300005545 Bacteria 5412
50 Ga0070695_100012754 3300005545 Bacteria 5045
51 Ga0070696_100011706 3300005546 Bacteria 5879
52 Ga0070696_100018331 3300005546 Bacteria 4730
53 Ga0070696_100042592 3300005546 Bacteria 3138
54 Ga0070696_100044381 3300005546 Bacteria 3078
55 Ga0070696_100177302 3300005546 Bacteria 1579
56 Ga0070696_100177484 3300005546 Bacteria 1578
57 Ga0070693_100023936 3300005547 Bacteria 3270
58 Ga0070704_100016539 3300005549 Bacteria 4664
59 Ga0068855_100076247 3300005563 Bacteria 3892
60 Ga0070664_100149144 3300005564 Bacteria 2064
61 Ga0070664_100299271 3300005564 Bacteria 1453
62 Ga0068857_100004792 3300005577 Bacteria 11466
63 Ga0068854_100001567 3300005578 Bacteria 13885
64 Ga0070702_100084255 3300005615 Bacteria 1911
65 Ga0068859_100029755 3300005617 Bacteria 5480
66 Ga0068864_100001195 3300005618 Bacteria 21554
67 Ga0068866_10000826 3300005718 Bacteria 13768
68 Ga0068861_100004158 3300005719 Bacteria 9707
69 Ga0068870_10018758 3300005840 Bacteria 3346
70 Ga0068863_100409738 3300005841 Bacteria 1327
71 Ga0068858_100034757 3300005842 Bacteria 4675
72 Ga0068858_100684858 3300005842 Bacteria 997
73 Ga0068860_100043276 3300005843 Bacteria 4297
74 Ga0068862_100136668 3300005844 Bacteria 2172
75 Ga0068862_100347204 3300005844 Bacteria 1376
76 Ga0097621_100024283 3300006237 Bacteria 4732
77 Ga0068871_100016496 3300006358 Bacteria 5565
78 Ga0075428_100294300 3300006844 Bacteria 1746
79 Ga0075428_100342042 3300006844 Bacteria 1606
80 Ga0075430_100046430 3300006846 Bacteria 3668
81 Ga0075431_100036953 3300006847 Bacteria 5031
82 Ga0075431_100233996 3300006847 Bacteria 1871
83 Ga0075431_100259903 3300006847 Bacteria 1762
84 Ga0075433_10007289 3300006852 Bacteria 8768
85 Ga0075433_10022733 3300006852 Bacteria 5268
86 Ga0075433_10037341 3300006852 Bacteria 4190
87 Ga0075434_100012797 3300006871 Bacteria 7964
88 Ga0075434_100029064 3300006871 Bacteria 5436
89 Ga0075434_100144755 3300006871 Bacteria 2397
90 Ga0075434_100257206 3300006871 Bacteria 1765
91 Ga0068865_100026290 3300006881 Bacteria 3836
92 Ga0075436_100067619 3300006914 Bacteria 2469
93 Ga0097620_100029754 3300006931 Bacteria 5480
94 Ga0075435_100358675 3300007076 Bacteria 1250
95 Ga0111539_10749298 3300009094 Bacteria 1137
96 Ga0105245_10851388 3300009098 Bacteria 952
97 Ga0114129_10000088 3300009147 Bacteria 86607
98 Ga0114129_10148704 3300009147 Bacteria 3207
99 Ga0114129_10150019 3300009147 Bacteria 3191
100 Ga0114129_10280040 3300009147 Bacteria 2228
101 Ga0114129_10519675 3300009147 Bacteria 1552
102 Ga0105243_10003605 3300009148 Bacteria 12472
103 Ga0105243_10725411 3300009148 Bacteria 972
104 Ga0105241_10003729 3300009174 Bacteria 11317
105 Ga0105242_10000522 3300009176 Bacteria 30175
106 Ga0105248_10012515 3300009177 Bacteria 9356
107 Ga0105248_10597871 3300009177 Bacteria 1245
108 Ga0105238_10523320 3300009551 Bacteria 1189
109 Ga0105249_10115357 3300009553 Bacteria 2545
110 Ga0105249_10170617 3300009553 Bacteria 2109
111 Ga0105239_10066269 3300010375 Bacteria 3967
112 Ga0105239_10158314 3300010375 Bacteria 2530
113 Ga0105239_10436576 3300010375 Bacteria 1484
114 Ga0105239_10845226 3300010375 Bacteria 1050
115 Ga0157378_10001653 3300013297 Bacteria 20161
116 Ga0163162_10007985 3300013306 Bacteria 10320
117 Ga0163162_10178444 3300013306 Bacteria 2250
118 Ga0157375_10114199 3300013308 Bacteria 2802
119 Ga0157375_10119138 3300013308 Bacteria 2747
120 Ga0157380_10132299 3300014326 Bacteria 2130
121 Ga0157380_10989163 3300014326 Unclassified 874
122 Ga0157379_10013742 3300014968 Bacteria 7096
123 Ga0157379_10209847 3300014968 Bacteria 1763
124 Ga0157376_10080128 3300014969 Bacteria 2800
125 Ga0163161_10037183 3300017792 Bacteria 3489
126 Ga0207642_10000216 3300025899 Bacteria 16971
127 Ga0207710_10202865 3300025900 Bacteria 980
128 Ga0207680_10058377 3300025903 Bacteria 2339
129 Ga0207645_10000321 3300025907 Bacteria 39983
130 Ga0207643_10006685 3300025908 Bacteria 6184
131 Ga0207684_10012713 3300025910 Bacteria 7307
132 Ga0207654_10042680 3300025911 Bacteria 2568
133 Ga0207707_10031592 3300025912 Bacteria 4634
134 Ga0207707_10448685 3300025912 Bacteria 1104
135 Ga0207671_10102498 3300025914 Bacteria 2169
136 Ga0207660_10129043 3300025917 Bacteria 1923
137 Ga0207660_10567258 3300025917 Bacteria 924
138 Ga0207657_10494534 3300025919 Bacteria 958
139 Ga0207646_10094719 3300025922 Bacteria 2674
140 Ga0207646_10294928 3300025922 Bacteria 1465
141 Ga0207681_10596792 3300025923 Bacteria 912
142 Ga0207659_10182530 3300025926 Bacteria 1663
143 Ga0207687_10637625 3300025927 Bacteria 900
144 Ga0207644_10033650 3300025931 Bacteria 3584
145 Ga0207706_10000220 3300025933 Bacteria 62430
146 Ga0207706_10036768 3300025933 Bacteria 4349
147 Ga0207686_10000138 3300025934 Bacteria 57684
148 Ga0207709_10004232 3300025935 Bacteria 8320
149 Ga0207669_10002015 3300025937 Bacteria 8621
150 Ga0207704_10012824 3300025938 Bacteria 4170
151 Ga0207691_10027044 3300025940 Bacteria 5383
152 Ga0207711_10001584 3300025941 Bacteria 21001
153 Ga0207689_10002369 3300025942 Bacteria 17598
154 Ga0207679_10111413 3300025945 Bacteria 2161
155 Ga0207651_10039984 3300025960 Bacteria 3098
156 Ga0207712_10002939 3300025961 Bacteria 10883
157 Ga0207668_10342038 3300025972 Bacteria 1248
158 Ga0207640_10001195 3300025981 Bacteria 14196
159 Ga0207658_10009120 3300025986 Bacteria 6729
160 Ga0207677_10902979 3300026023 Unclassified 796
161 Ga0207703_10108730 3300026035 Bacteria 2362
162 Ga0207678_10231885 3300026067 Bacteria 1581
163 Ga0207678_10283312 3300026067 Bacteria 1423
164 Ga0207708_10024260 3300026075 Bacteria 4586
165 Ga0207708_10031882 3300026075 Bacteria 4002
166 Ga0207708_10279054 3300026075 Bacteria 1353
167 Ga0207641_10275208 3300026088 Bacteria 1581
168 Ga0207648_10000021 3300026089 Bacteria 139257
169 Ga0207676_10005231 3300026095 Bacteria 9182
170 Ga0207676_10518678 3300026095 Bacteria 1134
171 Ga0207676_10631355 3300026095 Bacteria 1032
172 Ga0207674_10002007 3300026116 Bacteria 25837
173 Ga0207675_100071947 3300026118 Bacteria 3233
174 Ga0207675_100361765 3300026118 Bacteria 1424
175 Ga0207683_10028977 3300026121 Bacteria 4791
176 Ga0209983_1019105 3300027665 Bacteria 1424
177 Ga0209974_10029581 3300027876 Bacteria 1815
178 Ga0268264_10019833 3300028381 Bacteria 5492
179 Ga0268264_10636200 3300028381 Bacteria 1054
180 Ga0307408_100006622 3300031548 Bacteria 7684
181 Ga0307408_100073696 3300031548 Bacteria 2531
182 Ga0307408_100088446 3300031548 Bacteria 2333
183 Ga0307405_10084457 3300031731 Bacteria 2084
184 Ga0307405_10280641 3300031731 Bacteria 1254
185 Ga0307413_10025327 3300031824 Bacteria 3251
186 Ga0307413_10029855 3300031824 Bacteria 3056
187 Ga0307413_10046344 3300031824 Bacteria 2584
188 Ga0307413_10232487 3300031824 Bacteria 1355
189 Ga0307410_10003393 3300031852 Bacteria 7985
190 Ga0307410_10049000 3300031852 Bacteria 2833
191 Ga0307410_10057458 3300031852 Bacteria 2649
192 Ga0307410_10079019 3300031852 Bacteria 2304
193 Ga0307410_10083715 3300031852 Bacteria 2247
194 Ga0307410_10133539 3300031852 Bacteria 1826
195 Ga0307406_10006804 3300031901 Bacteria 6326
196 Ga0307406_10035625 3300031901 Bacteria 3062
197 Ga0307406_10552689 3300031901 Bacteria 942
198 Ga0307407_10005595 3300031903 Bacteria 5473
199 Ga0307407_10026281 3300031903 Bacteria 3080
200 Ga0307407_10027625 3300031903 Bacteria 3023
201 Ga0307407_10037550 3300031903 Bacteria 2677
202 Ga0307407_10222313 3300031903 Bacteria 1277
203 Ga0307412_10120796 3300031911 Bacteria 1886
204 Ga0307412_10164126 3300031911 Bacteria 1654
205 Ga0307409_100000491 3300031995 Bacteria 17000
206 Ga0307409_100065488 3300031995 Bacteria 2860
207 Ga0307409_100088477 3300031995 Bacteria 2528
208 Ga0307409_100099985 3300031995 Bacteria 2403
209 Ga0307409_100136889 3300031995 Bacteria 2103
210 Ga0307409_100602607 3300031995 Bacteria 1086
211 Ga0307416_100012946 3300032002 Bacteria 5647
212 Ga0307416_100022947 3300032002 Bacteria 4517
213 Ga0307416_100035492 3300032002 Bacteria 3809
214 Ga0307416_100083304 3300032002 Bacteria 2713
215 Ga0307416_100117088 3300032002 Bacteria 2364
216 Ga0307416_100124075 3300032002 Bacteria 2309
217 Ga0307416_100260779 3300032002 Bacteria 1694
218 Ga0307416_100402218 3300032002 Bacteria 1407
219 Ga0307414_10002391 3300032004 Bacteria 9818
220 Ga0307414_10073115 3300032004 Bacteria 2479
221 Ga0307414_10087472 3300032004 Bacteria 2303
222 Ga0307411_10000633 3300032005 Bacteria 12741
223 Ga0307411_10006781 3300032005 Bacteria 5764
224 Ga0307411_10032095 3300032005 Bacteria 3241
225 Ga0307415_100010937 3300032126 Bacteria 5165
226 Ga0307415_100061788 3300032126 Bacteria 2595
227 Ga0307415_100676136 3300032126 Bacteria 928
228 Ga0373949_0019843 3300035090 Bacteria 1535
229 Ga0395905_0081831 3300037471 Bacteria 3026
230 Ga0395905_0705750 3300037471 Bacteria 911
231 Ga0242420_008783 3300038996 Bacteria 1646
232 Ga0439448_0015562 3300042005 Bacteria 2306
233 Ga0439449_0035323 3300042007 Bacteria 1861
234 Ga0450902_046541 3300042137 Bacteria 742
235 Ga0451577_0005814 3300042876 Bacteria 12490
236 Ga0453683_0019320 3300044673 Bacteria 4367
237 Ga0453683_0046082 3300044673 Bacteria 2734
238 Ga0453684_0292633 3300044712 Bacteria 1854
239 Ga0453684_0382984 3300044712 Bacteria 1579
240 Ga0451576_0125482 3300045051 Bacteria 2674
241 Ga0466967_0388121 3300045976 Bacteria 1357
242 Ga0466967_1034995 3300045976 Bacteria 818
243 Ga0495603_0169881 3300046455 Bacteria 1263
244 Ga0495594_0053506 3300046499 Bacteria 2224
245 Ga0496100_0477659 3300048903 Bacteria 958
246 Ga0496101_0054475 3300048904 Bacteria 2888
247 Ga0496101_0058785 3300048904 Unclassified 2786
248 Ga0496102_0036546 3300048905 Bacteria 4425
249 Ga0496102_0130400 3300048905 Bacteria 2352
250 Ga0496103_0002515 3300048906 Bacteria 11492
251 Ga0496103_0055274 3300048906 Bacteria 2462
252 Ga0496103_0070546 3300048906 Bacteria 2186
253 Ga0496104_0041189 3300048907 Bacteria 4330
254 Ga0496104_0107605 3300048907 Bacteria 2672
255 Ga0496105_0135292 3300048908 Bacteria 2030
256 Ga0496105_0487751 3300048908 Bacteria 969
257 Ga0496106_0021791 3300048909 Bacteria 4759
258 Ga0496106_0074656 3300048909 Bacteria 2596
259 Ga0496106_0092890 3300048909 Bacteria 2331
260 Ga0496107_0208876 3300048910 Bacteria 1452
261 Ga0496107_0510206 3300048910 Bacteria 892
262 Ga0496108_0003507 3300048911 Bacteria 12569
263 Ga0496108_0027026 3300048911 Bacteria 4735
264 Ga0496108_0038784 3300048911 Bacteria 3969
265 Ga0496109_0001833 3300048912 Bacteria 17628
266 Ga0496109_0002817 3300048912 Bacteria 14563
267 Ga0496110_0028577 3300048913 Bacteria 4791
268 Ga0496110_0033612 3300048913 Bacteria 4437
269 Ga0496111_0024982 3300048914 Bacteria 4214
270 Ga0496112_0001659 3300048915 Bacteria 17307
271 Ga0496112_0011490 3300048915 Bacteria 8088
272 Ga0496112_0012630 3300048915 Bacteria 7764
273 Ga0496113_0001022 3300048916 Bacteria 15042
274 Ga0496113_0031148 3300048916 Bacteria 3868
275 Ga0496114_0165909 3300048917 Bacteria 1922
276 Ga0496114_0513994 3300048917 Unclassified 1059
277 Ga0496115_0746571 3300048918 Bacteria 766
278 Ga0501031_0380187 3300049568 Bacteria 914
279 Ga0501036_0071555 3300049572 Bacteria 2932
280 Ga0501036_0180212 3300049572 Bacteria 1779
281 Ga0501036_0551064 3300049572 Bacteria 958
282 Ga0501039_0168209 3300049575 Bacteria 1723
283 Ga0501040_0071494 3300049576 Bacteria 2395
284 Ga0501040_0295414 3300049576 Bacteria 1158
285 Ga0501041_0040586 3300049577 Bacteria 2825
286 Ga0501041_0131828 3300049577 Bacteria 1557
287 Ga0501042_0072758 3300049578 Bacteria 2459
288 Ga0501042_0197870 3300049578 Bacteria 1449
289 Ga0501043_0279040 3300049579 Bacteria 1281
290 Ga0501046_0164313 3300049580 Bacteria 1668
291 Ga0501048_0035432 3300049582 Bacteria 3593
292 Ga0501048_0243829 3300049582 Bacteria 1275
293 Ga0501048_0261620 3300049582 Bacteria 1229
294 Ga0501067_0042987 3300049583 Bacteria 2509
295 Ga0501067_0085604 3300049583 Bacteria 1749
296 Ga0501067_0252336 3300049583 Bacteria 982
297 Ga0501071_0337561 3300049587 Bacteria 1145
298 Ga0501072_0207231 3300049588 Bacteria 1563
299 Ga0501073_0352062 3300049589 Bacteria 1017
300 Ga0501075_0040025 3300049591 Bacteria 3509
301 Ga0501075_0099894 3300049591 Bacteria 2204
302 Ga0501075_0286299 3300049591 Bacteria 1255
303 Ga0501076_0056849 3300049592 Bacteria 3105
304 Ga0501076_0254010 3300049592 Bacteria 1439
305 Ga0501076_0312013 3300049592 Bacteria 1290
306 Ga0501077_0099127 3300049593 Bacteria 1847
307 Ga0501235_006862 3300049669 Bacteria 2479
308 Ga0501247_005552 3300049677 Bacteria 1409
309 Ga0501257_028055 3300049686 Bacteria 1349
310 Ga0501079_0063884 3300049741 Bacteria 2840
311 Ga0501079_0135644 3300049741 Bacteria 1916
312 Ga0501079_0236416 3300049741 Bacteria 1427
313 Ga0501080_0083814 3300049742 Bacteria 2962
314 Ga0501080_0165631 3300049742 Bacteria 2040
315 Ga0501083_0121395 3300049744 Bacteria 1714
316 Ga0501083_0467430 3300049744 Bacteria 821
317 Ga0501263_000091 3300049760 Bacteria 4655
318 Ga0501268_015287 3300049765 Bacteria 1259
319 Ga0501270_009641 3300049767 Bacteria 1252
320 Ga0501035_0083002 3300049822 Bacteria 2828
321 Ga0501045_0019297 3300049824 Bacteria 4858
322 nmdc:mga05p37_232030_c1 3300050507 Bacteria 2223
323 nmdc:mga05p37_356803_c1 3300050507 Bacteria 1720
324 nmdc:mga05p37_53756_c1 3300050507 Bacteria 4954
325 nmdc:mga09592_100805_c1 3300050508 Bacteria 2473
326 nmdc:mga0qj67_24293_c1 3300050509 Bacteria 4671
327 nmdc:mga06r32_50694_c1 3300050510 Bacteria 3970
328 nmdc:mga06r32_586976_c1 3300050510 Bacteria 1086
329 nmdc:mga06r32_98612_c1 3300050510 Bacteria 2864
330 nmdc:mga08y16_523796_c1 3300050511 Bacteria 1202
331 nmdc:mga0n895_118238_c1 3300050512 Bacteria 2670
332 nmdc:mga0n895_1413_c1 3300050512 Bacteria 17930
333 nmdc:mga0n895_175988_c1 3300050512 Bacteria 2170
334 nmdc:mga0n895_83429_c1 3300050512 Bacteria 3187
335 nmdc:mga0rr50_203346_c1 3300050513 Bacteria 1628
336 nmdc:mga0rr50_542064_c1 3300050513 Bacteria 990
337 nmdc:mga08x19_21283_c1 3300050514 Bacteria 4000
338 nmdc:mga0a205_100192_c1 3300050515 Bacteria 2796
339 nmdc:mga0a205_13338_c2 3300050515 Bacteria 2573
340 nmdc:mga0a205_31296_c1 3300050515 Bacteria 5097
341 Ga0501084_0005088 3300054114 Bacteria 10764
342 Ga0501084_0020217 3300054114 Bacteria 5550
343 Ga0501084_0171742 3300054114 Bacteria 1830
344 Ga0590071_004817 3300059421 Bacteria 3258
345 Ga0590071_023784 3300059421 Bacteria 1450
346 Ga0590074_004245 3300059423 Bacteria 2369
347 Ga0590075_049344 3300059424 Bacteria 1079
348 Ga0501082_0013542 3300060353 Bacteria 7007
349 Ga0501082_0030005 3300060353 Bacteria 4685
350 Ga0501082_0153563 3300060353 Bacteria 2000
351 Ga0501082_0723550 3300060353 Bacteria 871
352 Ga0530510_0117070 3300061734 Bacteria 1954
353 Ga0530510_0211767
354 MBSR1b_contig_2475066
355 Ga0065715_10001411
356 Ga0070676_10001156
357 Ga0070690_100117418
358 Ga0068869_100167140
359 Ga0070666_10021483
360 Ga0070680_100064714
361 Ga0070680_100206672
362 Ga0068868_100260465
363 Ga0068868_100428910
364 Ga0070660_100490830
365 Ga0070668_100092528
366 Ga0070675_100091260
367 Ga0070671_100032171
368 Ga0070671_100082860
369 Ga0070673_100013365
370 Ga0070667_100230078
371 Ga0070711_100554099
372 Ga0070705_100002266
373 Ga0070705_100027340
374 Ga0070705_100032630
375 Ga0070700_100016452
376 Ga0070694_100012052
377 Ga0070694_100328830
378 Ga0070708_100038715
379 Ga0070663_100287688
380 Ga0070678_100031899
381 Ga0070678_100032769
382 Ga0070662_100000040
383 Ga0070662_100212796
384 Ga0070662_100274261
385 Ga0070681_10086979
386 Ga0068867_100001196
387 Ga0070706_100007945
388 Ga0070707_100026188
389 Ga0070698_100005635
390 Ga0070699_100002654
391 Ga0070699_100008984
392 Ga0070699_100034363
393 Ga0070699_100299070
394 Ga0070699_100449036
395 Ga0070679_100363580
396 Ga0070697_100050462
397 Ga0070697_100052390
398 Ga0068853_100542508
399 Ga0068853_100942374
400 Ga0070686_100327640
401 Ga0070695_100010988
402 Ga0070695_100012754
403 Ga0070696_100011706
404 Ga0070696_100018331
405 Ga0070696_100042592
406 Ga0070696_100044381
407 Ga0070696_100177302
408 Ga0070696_100177484
409 Ga0070693_100023936
410 Ga0070704_100016539
411 Ga0068855_100076247
412 Ga0070664_100149144
413 Ga0070664_100299271
414 Ga0068857_100004792
415 Ga0068854_100001567
416 Ga0070702_100084255
417 Ga0068859_100029755
418 Ga0068864_100001195
419 Ga0068866_10000826
420 Ga0068861_100004158
421 Ga0068870_10018758
422 Ga0068863_100409738
423 Ga0068858_100034757
424 Ga0068858_100684858
425 Ga0068860_100043276
426 Ga0068862_100136668
427 Ga0068862_100347204
428 Ga0097621_100024283
429 Ga0068871_100016496
430 Ga0075428_100294300
431 Ga0075428_100342042
432 Ga0075430_100046430
433 Ga0075431_100036953
434 Ga0075431_100233996
435 Ga0075431_100259903
436 Ga0075433_10007289
437 Ga0075433_10022733
438 Ga0075433_10037341
439 Ga0075434_100012797
440 Ga0075434_100029064
441 Ga0075434_100144755
442 Ga0075434_100257206
443 Ga0068865_100026290
444 Ga0075436_100067619
445 Ga0097620_100029754
446 Ga0075435_100358675
447 Ga0111539_10749298
448 Ga0105245_10851388
449 Ga0114129_10000088
450 Ga0114129_10148704
451 Ga0114129_10150019
452 Ga0114129_10280040
453 Ga0114129_10519675
454 Ga0105243_10003605
455 Ga0105243_10725411
456 Ga0105241_10003729
457 Ga0105242_10000522
458 Ga0105248_10012515
459 Ga0105248_10597871
460 Ga0105238_10523320
461 Ga0105249_10115357
462 Ga0105249_10170617
463 Ga0105239_10066269
464 Ga0105239_10158314
465 Ga0105239_10436576
466 Ga0105239_10845226
467 Ga0157378_10001653
468 Ga0163162_10007985
469 Ga0163162_10178444
470 Ga0157375_10114199
471 Ga0157375_10119138
472 Ga0157380_10132299
473 Ga0157380_10989163
474 Ga0157379_10013742
475 Ga0157379_10209847
476 Ga0157376_10080128
477 Ga0163161_10037183
478 Ga0207642_10000216
479 Ga0207710_10202865
480 Ga0207680_10058377
481 Ga0207645_10000321
482 Ga0207643_10006685
483 Ga0207684_10012713
484 Ga0207654_10042680
485 Ga0207707_10031592
486 Ga0207707_10448685
487 Ga0207671_10102498
488 Ga0207660_10129043
489 Ga0207660_10567258
490 Ga0207657_10494534
491 Ga0207646_10094719
492 Ga0207646_10294928
493 Ga0207681_10596792
494 Ga0207659_10182530
495 Ga0207687_10637625
496 Ga0207644_10033650
497 Ga0207706_10000220
498 Ga0207706_10036768
499 Ga0207686_10000138
500 Ga0207709_10004232
501 Ga0207669_10002015
502 Ga0207704_10012824
503 Ga0207691_10027044
504 Ga0207711_10001584
505 Ga0207689_10002369
506 Ga0207679_10111413
507 Ga0207651_10039984
508 Ga0207712_10002939
509 Ga0207668_10342038
510 Ga0207640_10001195
511 Ga0207658_10009120
512 Ga0207677_10902979
513 Ga0207703_10108730
514 Ga0207678_10231885
515 Ga0207678_10283312
516 Ga0207708_10024260
517 Ga0207708_10031882
518 Ga0207708_10279054
519 Ga0207641_10275208
520 Ga0207648_10000021
521 Ga0207676_10005231
522 Ga0207676_10518678
523 Ga0207676_10631355
524 Ga0207674_10002007
525 Ga0207675_100071947
526 Ga0207675_100361765
527 Ga0207683_10028977
528 Ga0209983_1019105
529 Ga0209974_10029581
530 Ga0268264_10019833
531 Ga0268264_10636200
532 Ga0307408_100006622
533 Ga0307408_100073696
534 Ga0307408_100088446
535 Ga0307405_10084457
536 Ga0307405_10280641
537 Ga0307413_10025327
538 Ga0307413_10029855
539 Ga0307413_10046344
540 Ga0307413_10232487
541 Ga0307410_10003393
542 Ga0307410_10049000
543 Ga0307410_10057458
544 Ga0307410_10079019
545 Ga0307410_10083715
546 Ga0307410_10133539
547 Ga0307406_10006804
548 Ga0307406_10035625
549 Ga0307406_10552689
550 Ga0307407_10005595
551 Ga0307407_10026281
552 Ga0307407_10027625
553 Ga0307407_10037550
554 Ga0307407_10222313
555 Ga0307412_10120796
556 Ga0307412_10164126
557 Ga0307409_100000491
558 Ga0307409_100065488
559 Ga0307409_100088477
560 Ga0307409_100099985
561 Ga0307409_100136889
562 Ga0307409_100602607
563 Ga0307416_100012946
564 Ga0307416_100022947
565 Ga0307416_100035492
566 Ga0307416_100083304
567 Ga0307416_100117088
568 Ga0307416_100124075
569 Ga0307416_100260779
570 Ga0307416_100402218
571 Ga0307414_10002391
572 Ga0307414_10073115
573 Ga0307414_10087472
574 Ga0307411_10000633
575 Ga0307411_10006781
576 Ga0307411_10032095
577 Ga0307415_100010937
578 Ga0307415_100061788
579 Ga0307415_100676136
580 Ga0373949_0019843
581 Ga0395905_0081831
582 Ga0395905_0705750
583 Ga0242420_008783
584 Ga0439448_0015562
585 Ga0439449_0035323
586 Ga0450902_046541
587 Ga0451577_0005814
588 Ga0453683_0019320
589 Ga0453683_0046082
590 Ga0453684_0292633
591 Ga0453684_0382984
592 Ga0451576_0125482
593 Ga0466967_0388121
594 Ga0466967_1034995
595 Ga0495603_0169881
596 Ga0495594_0053506
597 Ga0496100_0477659
598 Ga0496101_0054475
599 Ga0496101_0058785
600 Ga0496102_0036546
601 Ga0496102_0130400
602 Ga0496103_0002515
603 Ga0496103_0055274
604 Ga0496103_0070546
605 Ga0496104_0041189
606 Ga0496104_0107605
607 Ga0496105_0135292
608 Ga0496105_0487751
609 Ga0496106_0021791
610 Ga0496106_0074656
611 Ga0496106_0092890
612 Ga0496107_0208876
613 Ga0496107_0510206
614 Ga0496108_0003507
615 Ga0496108_0027026
616 Ga0496108_0038784
617 Ga0496109_0001833
618 Ga0496109_0002817
619 Ga0496110_0028577
620 Ga0496110_0033612
621 Ga0496111_0024982
622 Ga0496112_0001659
623 Ga0496112_0011490
624 Ga0496112_0012630
625 Ga0496113_0001022
626 Ga0496113_0031148
627 Ga0496114_0165909
628 Ga0496114_0513994
629 Ga0496115_0746571
630 Ga0501031_0380187
631 Ga0501036_0071555
632 Ga0501036_0180212
633 Ga0501036_0551064
634 Ga0501039_0168209
635 Ga0501040_0071494
636 Ga0501040_0295414
637 Ga0501041_0040586
638 Ga0501041_0131828
639 Ga0501042_0072758
640 Ga0501042_0197870
641 Ga0501043_0279040
642 Ga0501046_0164313
643 Ga0501048_0035432
644 Ga0501048_0243829
645 Ga0501048_0261620
646 Ga0501067_0042987
647 Ga0501067_0085604
648 Ga0501067_0252336
649 Ga0501071_0337561
650 Ga0501072_0207231
651 Ga0501073_0352062
652 Ga0501075_0040025
653 Ga0501075_0099894
654 Ga0501075_0286299
655 Ga0501076_0056849
656 Ga0501076_0254010
657 Ga0501076_0312013
658 Ga0501077_0099127
659 Ga0501235_006862
660 Ga0501247_005552
661 Ga0501257_028055
662 Ga0501079_0063884
663 Ga0501079_0135644
664 Ga0501079_0236416
665 Ga0501080_0083814
666 Ga0501080_0165631
667 Ga0501083_0121395
668 Ga0501083_0467430
669 Ga0501263_000091
670 Ga0501268_015287
671 Ga0501270_009641
672 Ga0501035_0083002
673 Ga0501045_0019297
674 nmdc:mga05p37_232030_c1
675 nmdc:mga05p37_356803_c1
676 nmdc:mga05p37_53756_c1
677 nmdc:mga09592_100805_c1
678 nmdc:mga0qj67_24293_c1
679 nmdc:mga06r32_50694_c1
680 nmdc:mga06r32_586976_c1
681 nmdc:mga06r32_98612_c1
682 nmdc:mga08y16_523796_c1
683 nmdc:mga0n895_118238_c1
684 nmdc:mga0n895_1413_c1
685 nmdc:mga0n895_175988_c1
686 nmdc:mga0n895_83429_c1
687 nmdc:mga0rr50_203346_c1
688 nmdc:mga0rr50_542064_c1
689 nmdc:mga08x19_21283_c1
690 nmdc:mga0a205_100192_c1
691 nmdc:mga0a205_13338_c2
692 nmdc:mga0a205_31296_c1
693 Ga0501084_0005088
694 Ga0501084_0020217
695 Ga0501084_0171742
696 Ga0590071_004817
697 Ga0590071_023784
698 Ga0590074_004245
699 Ga0590075_049344
700 Ga0501082_0013542
701 Ga0501082_0030005
702 Ga0501082_0153563
703 Ga0501082_0723550
704 Ga0530510_0117070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

192

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

218

0.91

PF08659

KR

KR domain

7

180

0.85

PF23441

9

194

0.75

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

9

183

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bd0-assembly1.cif.gz_D chlorobium tepidum sepiapterin reductase complexed with nadp and sepiapterin 0.9352 29 210
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9276 26 212
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.927 33 212
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9207 33 211
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9189 26 208
ID Description Score Start End Superfamily
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9342 27 156 3.40.50.720
2bd0C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9315 29 207 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9279 63 161 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.927 33 212 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9258 36 153 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V7P552-F1-model_v4 Oxidoreductase 0.9455 19 212 GO:0016020
GO:0016491
AF-A0A7C7JRS1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9406 33 211 GO:0016020
GO:0016491
AF-A0A7X3UXX4-F1-model_v4 SDR family oxidoreductase 0.9382 31 211 GO:0016020
GO:0016491
AF-A0A3D4V665-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9381 31 208 GO:0016020
GO:0016491
AF-A0A3E1EK93-F1-model_v4 NAD(P)-dependent dehydrogenase 0.9376 32 211 GO:0016020
GO:0016491

Map